RPSBLAST alignment of GI: 254780152 and MMDB domain: 3k5p_A_1-111_300-332

>3k5p_A (A:1-111,A:300-332) D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}Length = 144
 Score = 52.2 bits (125), Expect = 3e-08
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           + + A ++  VG   +GT+ V+L  A + GI V N PFG S   A+  I     + R++
Sbjct: 74  IFAAANRLIAVGCFSVGTNQVELKAARKRGIPVFNAPFG-STEEAQERIGTE--VTRKL 129