RPSBLAST alignment of GI: 254780152 and MMDB domain: 3kbo_A_96-280

>3kbo_A (A:96-280) Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD, structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella enterica subsp}Length = 185
 Score = 44.5 bits (104), Expect = 5e-06
 Identities = 7/36 (19%), Positives = 15/36 (41%)

Query: 39 GNSITTAEHAISLMLAIARQIPVANESTHKGKWEKF 74
          G  +   E+A+S +L   R+        ++  W+  
Sbjct: 2  GXGLQXQEYAVSQVLHWFRRFDDYQALKNQALWKPL 37