RPSBLAST alignment of GI: 254780152 and protein with PDBid: 2nac

>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* Length = 393
 Score = 62.9 bits (152), Expect = 2e-11
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            ++ AK +K+   AGIG+D+VDL  A    + V    + NSI+ AEH + ++L++ R   
Sbjct: 107 RIAKAKNLKLALTAGIGSDHVDLQSAIDRNVTVAEVTYCNSISVAEHVVMMILSLVRNYL 166

Query: 61  VANESTHKGKWEKFNFM 77
            ++E   KG W   + +
Sbjct: 167 PSHEWARKGGWNIADCV 183