RPSBLAST alignment of GI: 254780152 and SCOP domain: d1mx3a1

Alignment
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193
 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 5/31 (16%), Positives = 15/31 (48%)

Query: 43 TTAEHAISLMLAIARQIPVANESTHKGKWEK 73
           TA+  +  +L + R+    +++  +G   +
Sbjct: 2  ETADSTLCHILNLYRRATWLHQALREGTRVQ 32

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: Transcription corepressor CtbP
species: Human (Homo sapiens), Ctbp1 [TaxId: 9606]