RPSBLAST alignment of GI: 254780152 and SCOP domain: d1ygya1

Alignment
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184
 Score = 48.4 bits (114), Expect = 1e-07
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 40 NSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFM 77
          N  + AEHA++L+LA +RQIP A+ S  +  W++ +F 
Sbjct: 1  NIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFS 38

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]