RPSBLAST alignment of GI: 254780152 and SCOP domain: d1ygya2

Alignment
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130
 Score = 53.6 bits (128), Expect = 4e-09
 Identities = 22/68 (32%), Positives = 36/68 (52%)

Query: 4   HAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVAN 63
            A K+K+V RAG+G DNVD+  A+  G++V+N P   S   A+      +A + ++ +A 
Sbjct: 61  AAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSASTAEAQDRAGTDVAESVRLALAG 120

Query: 64  ESTHKGKW 71
           E       
Sbjct: 121 EFVPDAVN 128

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]