BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780152|ref|YP_003064565.1| D-3-phosphoglycerate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] (82 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780152|ref|YP_003064565.1| D-3-phosphoglycerate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Score = 167 bits (423), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 82/82 (100%), Positives = 82/82 (100%) Query: 1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP Sbjct: 1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60 Query: 61 VANESTHKGKWEKFNFMGVEAG 82 VANESTHKGKWEKFNFMGVEAG Sbjct: 61 VANESTHKGKWEKFNFMGVEAG 82 >gi|254781078|ref|YP_003065491.1| hypothetical protein CLIBASIA_04900 [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Score = 23.1 bits (48), Expect = 0.87, Method: Compositional matrix adjust. Identities = 8/33 (24%), Positives = 20/33 (60%) Query: 41 SITTAEHAISLMLAIARQIPVANESTHKGKWEK 73 SI H++++ L + R+I + NE+ + +++ Sbjct: 16 SIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQD 48 >gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 15 GIGTDNVDLVVASR 28 GIG D +D+V +SR Sbjct: 74 GIGDDTIDIVNSSR 87 >gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 21.6 bits (44), Expect = 3.1, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Query: 17 GTDNVDLVVASR---AGIVVMNTPFGNSITTAEHAISL 51 GT + L +A + +G+V+++TP ++ + AIS+ Sbjct: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISM 250 >gi|254780300|ref|YP_003064713.1| aspartate carbamoyltransferase catalytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 20.8 bits (42), Expect = 4.6, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 16/31 (51%) Query: 19 DNVDLVVASRAGIVVMNTPFGNSITTAEHAI 49 D + + A R I+V+ P+ ++ + H I Sbjct: 93 DTIATLNALRPNIIVIRHPYSGAVNSLMHKI 123 >gi|255764497|ref|YP_003065010.2| ABC transporter permease [Candidatus Liberibacter asiaticus str. psy62] Length = 587 Score = 20.4 bits (41), Expect = 6.3, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 55 IARQIPVANESTHKGKWEKFNFMGV 79 I R + + S W+KF ++GV Sbjct: 161 IPRDLEEVSRSFRLSGWQKFWYLGV 185 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.131 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,674 Number of Sequences: 1233 Number of extensions: 1480 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 82 length of database: 328,796 effective HSP length: 51 effective length of query: 31 effective length of database: 265,913 effective search space: 8243303 effective search space used: 8243303 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)