BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780154|ref|YP_003064567.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780154|ref|YP_003064567.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] gi|254039831|gb|ACT56627.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 135 bits (341), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS 60 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS Sbjct: 1 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS 60 Query: 61 IIDVTLVI 68 IIDVTLVI Sbjct: 61 IIDVTLVI 68 >gi|324323843|gb|ADY24887.1| hypothetical protein YBT020_28664 [Bacillus thuringiensis serovar finitimus YBT-020] gi|324323986|gb|ADY25029.1| hypothetical protein YBT020_29386 [Bacillus thuringiensis serovar finitimus YBT-020] Length = 258 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Query: 5 KKTIVLITILSTLAGCDSESKKIEKNINDTRRE------NAKLSTKYREIVESYTPAMEG 58 K+ ++L + S LAGC ++ +EK+ ++ E N K +T E ++S P+++ Sbjct: 2 KRLLILYVLFSILAGCSTKQSPVEKHESNIGHEDVELTKNIKKTTSKNEPLQSPAPSVQE 61 Query: 59 ISIIDVTLV 67 I+DV L+ Sbjct: 62 KVILDVPLI 70 >gi|156972410|ref|YP_001443317.1| fimbrial assembly protein PilP [Vibrio harveyi ATCC BAA-1116] gi|156524004|gb|ABU69090.1| hypothetical protein VIBHAR_00030 [Vibrio harveyi ATCC BAA-1116] Length = 171 Score = 33.5 bits (75), Expect = 9.4, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 4/55 (7%) Query: 4 RKKTIVLITILSTLAGCDSESKKIEKNI----NDTRRENAKLSTKYREIVESYTP 54 R K++++++++S L+GC + + + I N RR+ AKL +V SY P Sbjct: 2 RNKSLLMVSMVSLLSGCQANDESLTDFIRGVENQARRDVAKLQPTEEYVVVSYEP 56 Searching..................................................done Results from round 2 CONVERGED! >gi|254780154|ref|YP_003064567.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] gi|254039831|gb|ACT56627.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 118 bits (296), Expect = 2e-25, Method: Composition-based stats. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS 60 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS Sbjct: 1 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS 60 Query: 61 IIDVTLVI 68 IIDVTLVI Sbjct: 61 IIDVTLVI 68 >gi|324323843|gb|ADY24887.1| hypothetical protein YBT020_28664 [Bacillus thuringiensis serovar finitimus YBT-020] gi|324323986|gb|ADY25029.1| hypothetical protein YBT020_29386 [Bacillus thuringiensis serovar finitimus YBT-020] Length = 258 Score = 37.8 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Query: 5 KKTIVLITILSTLAGCDSESKKIEKNINDTRRE------NAKLSTKYREIVESYTPAMEG 58 K+ ++L + S LAGC ++ +EK+ ++ E N K +T E ++S P+++ Sbjct: 2 KRLLILYVLFSILAGCSTKQSPVEKHESNIGHEDVELTKNIKKTTSKNEPLQSPAPSVQE 61 Query: 59 ISIIDVTLV 67 I+DV L+ Sbjct: 62 KVILDVPLI 70 >gi|156972410|ref|YP_001443317.1| fimbrial assembly protein PilP [Vibrio harveyi ATCC BAA-1116] gi|156524004|gb|ABU69090.1| hypothetical protein VIBHAR_00030 [Vibrio harveyi ATCC BAA-1116] Length = 171 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Query: 4 RKKTIVLITILSTLAGCDSESKKIEKNI----NDTRRENAKLSTKYREIVESYTPAM 56 R K++++++++S L+GC + + + I N RR+ AKL +V SY P + Sbjct: 2 RNKSLLMVSMVSLLSGCQANDESLTDFIRGVENQARRDVAKLQPTEEYVVVSYEPEI 58 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.314 0.130 0.341 Lambda K H 0.267 0.0406 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 968,682,275 Number of Sequences: 13984884 Number of extensions: 24871047 Number of successful extensions: 84209 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 84205 Number of HSP's gapped (non-prelim): 9 length of query: 68 length of database: 4,792,584,752 effective HSP length: 40 effective length of query: 28 effective length of database: 4,233,189,392 effective search space: 118529302976 effective search space used: 118529302976 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 75 (33.5 bits)