RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780154|ref|YP_003064567.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >gnl|CDD|131342 TIGR02289, M3_not_pepF, oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family. Length = 549 Score = 30.1 bits (68), Expect = 0.13 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 14 LSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEG 58 L L + EKNI ++EN LSTKYREI+ + + EG Sbjct: 99 LFKLIKNKLKLFN-EKNIPLLQKEN-ILSTKYREIISNISIIFEG 141 >gnl|CDD|163209 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). Length = 235 Score = 26.0 bits (58), Expect = 2.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 4 RKKTIVLITILSTLAGCDSESKKIE 28 I+L+ +L LAGC S+ KK Sbjct: 1 LLLLILLLALLLLLAGCSSKKKKEA 25 >gnl|CDD|150456 pfam09789, DUF2353, Uncharacterized coiled-coil protein (DUF2353). Members of this family of uncharacterized proteins have no known function. Length = 319 Score = 25.6 bits (56), Expect = 3.2 Identities = 9/45 (20%), Positives = 22/45 (48%) Query: 22 SESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGISIIDVTL 66 ++ + + + + R EN +LST +E+ + I ++ T+ Sbjct: 65 TKRQDLSQLLEKYREENQQLSTDVQELRQRKAELQGDIKLLRQTI 109 >gnl|CDD|180770 PRK06946, PRK06946, lipid A biosynthesis lauroyl acyltransferase; Provisional. Length = 293 Score = 25.0 bits (55), Expect = 4.4 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 33 DTRRENAKLSTKYREIVESY 52 D RR NA L + R + E Y Sbjct: 256 DARRMNAFLEEQIRLMPEQY 275 >gnl|CDD|169557 PRK08706, PRK08706, lipid A biosynthesis lauroyl acyltransferase; Provisional. Length = 289 Score = 24.8 bits (54), Expect = 4.6 Identities = 7/20 (35%), Positives = 10/20 (50%) Query: 33 DTRRENAKLSTKYREIVESY 52 D +R N + + RE E Y Sbjct: 252 DAQRMNRFIEERVREHPEQY 271 >gnl|CDD|183507 PRK12407, flgH, flagellar basal body L-ring protein; Reviewed. Length = 221 Score = 24.8 bits (54), Expect = 5.0 Identities = 8/26 (30%), Positives = 17/26 (65%) Query: 5 KKTIVLITILSTLAGCDSESKKIEKN 30 K+ ++L +L L GC+S + ++K+ Sbjct: 2 KRFLILTALLLALCGCESPALLVQKD 27 >gnl|CDD|179539 PRK03103, PRK03103, DNA polymerase IV; Reviewed. Length = 409 Score = 24.6 bits (54), Expect = 6.2 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Query: 42 STKYREIVESYTPAMEGISI----IDVT 65 S + I+E +T +E SI +DVT Sbjct: 85 SLQITRILEDFTDLVEPFSIDEQFLDVT 112 >gnl|CDD|129718 TIGR00632, vsr, DNA mismatch endonuclease Vsr. All proteins in this family for which functions are known are G:T mismatch endonucleases that function in a specialized mismatch repair process used usually to repair G:T mismatches in specific sections of the genome. This family was based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Members of this family typically are found near to a DNA cytosine methyltransferase. Length = 117 Score = 23.7 bits (51), Expect = 10.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 24 SKKIEKNINDTRRENAKL 41 S KIEKN+ RR N++L Sbjct: 86 SPKIEKNVERDRRVNSRL 103 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.130 0.341 Gapped Lambda K H 0.267 0.0804 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 982,943 Number of extensions: 44116 Number of successful extensions: 131 Number of sequences better than 10.0: 1 Number of HSP's gapped: 131 Number of HSP's successfully gapped: 23 Length of query: 68 Length of database: 5,994,473 Length adjustment: 39 Effective length of query: 29 Effective length of database: 5,151,761 Effective search space: 149401069 Effective search space used: 149401069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (22.9 bits)