BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780159|ref|YP_003064572.1| hypothetical protein CLIBASIA_00210 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780159|ref|YP_003064572.1| hypothetical protein CLIBASIA_00210 [Candidatus Liberibacter asiaticus str. psy62] Length = 96 Score = 195 bits (496), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 96/96 (100%), Positives = 96/96 (100%) Query: 1 MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL 60 MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL Sbjct: 1 MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL 60 Query: 61 LIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT 96 LIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT Sbjct: 61 LIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT 96 >gi|254780468|ref|YP_003064881.1| sensory box/GGDEF family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 26.2 bits (56), Expect = 0.12, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 33 IGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQ 70 IG W +I KR D+I + G L+ ++I++ FT++Q Sbjct: 352 IGLWM-AITKRLDNDIIQPALVGGLVLIVILIGFTVIQ 388 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.137 0.414 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,076 Number of Sequences: 1233 Number of extensions: 1817 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 96 length of database: 328,796 effective HSP length: 61 effective length of query: 35 effective length of database: 253,583 effective search space: 8875405 effective search space used: 8875405 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 31 (16.5 bits)