RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780160|ref|YP_003064573.1| hypothetical protein CLIBASIA_00215 [Candidatus Liberibacter asiaticus str. psy62] (298 letters) >gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase. Length = 484 Score = 30.5 bits (69), Expect = 0.53 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 60 IFDSISNKKNTLSTTKKIIGGKVS 83 I DS+S+ ++T +I+GGK Sbjct: 222 IVDSLSSSRDTKVAVNRIVGGKWG 245 >gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional. Length = 237 Score = 29.1 bits (65), Expect = 1.4 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query: 176 QITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVA 225 ++++HYGK A+ + + G+I+ + N A K T L+ + G+ A Sbjct: 10 KVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTT--LLGTLCGDPRA 57 >gnl|CDD|184710 PRK14498, PRK14498, putative molybdopterin biosynthesis protein MoeA/LysR substrate binding-domain-containing protein; Provisional. Length = 633 Score = 28.3 bits (64), Expect = 2.4 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 12/46 (26%) Query: 186 AIVST---VV----KVEPGKIIDVTIQNRAAKITFKLVSEMGGEAV 224 I+ST +V ++PGKI DV AA V E GGE V Sbjct: 190 GIISTGDELVEPGEPLKPGKIYDVNSYTLAA-----AVEEAGGEPV 230 >gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional. Length = 919 Score = 27.9 bits (63), Expect = 3.3 Identities = 9/12 (75%), Positives = 11/12 (91%) Query: 211 ITFKLVSEMGGE 222 IT KLV+EMGG+ Sbjct: 488 ITQKLVNEMGGD 499 >gnl|CDD|183852 PRK13030, PRK13030, 2-oxoacid ferredoxin oxidoreductase; Provisional. Length = 1159 Score = 27.6 bits (62), Expect = 4.3 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Query: 266 NYSRE----FSVLTGKSTIVEVLMRQKRMDKNGQHNT 298 Y+ F LTG +V +L+ Q+R D+ NT Sbjct: 10 RYTATRGRIF--LTGTQALVRLLLMQRRRDRARGLNT 44 >gnl|CDD|164786 PHA00202, PHA00202, DNA replication initiation protein. Length = 388 Score = 26.9 bits (59), Expect = 6.4 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 27 KGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68 +G+G +V +RIT L E +T + S S I+ I NKK Sbjct: 223 RGQGPSMVPHKRITSIGALMEEATIVGSRSS-AIYWRIYNKK 263 >gnl|CDD|130031 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP). This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved. Length = 1522 Score = 26.8 bits (59), Expect = 7.7 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 5/81 (6%) Query: 24 NISKGKGKRVVDAQRITCEAR---LTENSTSIDSGVSWHIFDSISNKKNTLST-TKKIIG 79 N+S G+ +RV A+ + A + +++D+ V HIF+ + + L T+ ++ Sbjct: 760 NLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFEHVIGPEGVLKNKTRILVT 819 Query: 80 GKVSFDLFPGDYLISASFGHV 100 +S+ L D +I S G + Sbjct: 820 HGISY-LPQVDVIIVMSGGKI 839 >gnl|CDD|148061 pfam06229, FRG1, FRG1-like family. The human FRG1 gene maps to human chromosome 4q35 and has been identified as a candidate for facioscapulohumeral muscular dystrophy. Currently, the function of FRG1 is unknown. Length = 189 Score = 26.6 bits (59), Expect = 8.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Query: 166 TLVRLGTNNYQITSHYGKY 184 T V++G S YGKY Sbjct: 31 TAVKVGDEKISFKSGYGKY 49 >gnl|CDD|185499 PTZ00174, PTZ00174, phosphomannomutase; Provisional. Length = 247 Score = 26.5 bits (59), Expect = 9.6 Identities = 8/11 (72%), Positives = 11/11 (100%) Query: 78 IGGKVSFDLFP 88 IGG++SFD+FP Sbjct: 174 IGGQISFDVFP 184 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.313 0.129 0.353 Gapped Lambda K H 0.267 0.0655 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,526,778 Number of extensions: 276613 Number of successful extensions: 430 Number of sequences better than 10.0: 1 Number of HSP's gapped: 430 Number of HSP's successfully gapped: 22 Length of query: 298 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 205 Effective length of database: 3,984,929 Effective search space: 816910445 Effective search space used: 816910445 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 57 (25.9 bits)