BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780161|ref|YP_003064574.1| phytoene synthase protein [Candidatus Liberibacter asiaticus str. psy62] (299 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780161|ref|YP_003064574.1| phytoene synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 299 Score = 613 bits (1581), Expect = e-177, Method: Compositional matrix adjust. Identities = 299/299 (100%), Positives = 299/299 (100%) Query: 1 MVLKFLTKNTRKEEKIFSRDSLFVLRNLRDIDYDRYLACLLSPPLYRISLSFLYYFHTEL 60 MVLKFLTKNTRKEEKIFSRDSLFVLRNLRDIDYDRYLACLLSPPLYRISLSFLYYFHTEL Sbjct: 1 MVLKFLTKNTRKEEKIFSRDSLFVLRNLRDIDYDRYLACLLSPPLYRISLSFLYYFHTEL 60 Query: 61 MRVRDTARNPITRDMRLQWWKDIFESSTKGLIAESISPFSVELLSIVRQYDLPNQYFLDM 120 MRVRDTARNPITRDMRLQWWKDIFESSTKGLIAESISPFSVELLSIVRQYDLPNQYFLDM Sbjct: 61 MRVRDTARNPITRDMRLQWWKDIFESSTKGLIAESISPFSVELLSIVRQYDLPNQYFLDM 120 Query: 121 IEAHFFDSYNDSIFDCKQFEHYAFRISSRLIHLATMILDSERYSASLRVIKYAGIAQFIG 180 IEAHFFDSYNDSIFDCKQFEHYAFRISSRLIHLATMILDSERYSASLRVIKYAGIAQFIG Sbjct: 121 IEAHFFDSYNDSIFDCKQFEHYAFRISSRLIHLATMILDSERYSASLRVIKYAGIAQFIG 180 Query: 181 QLICQLPIHYHRGQLYFPLDILGAVGLDRESFLSGQNSDRISLAIKIFAELGLKYLFKAR 240 QLICQLPIHYHRGQLYFPLDILGAVGLDRESFLSGQNSDRISLAIKIFAELGLKYLFKAR Sbjct: 181 QLICQLPIHYHRGQLYFPLDILGAVGLDRESFLSGQNSDRISLAIKIFAELGLKYLFKAR 240 Query: 241 EEMRYILPDVFPAFIPVSITESVLKHAQNHGFKIVSHSHTPNQLVRPWYMLSSSIKKRF 299 EEMRYILPDVFPAFIPVSITESVLKHAQNHGFKIVSHSHTPNQLVRPWYMLSSSIKKRF Sbjct: 241 EEMRYILPDVFPAFIPVSITESVLKHAQNHGFKIVSHSHTPNQLVRPWYMLSSSIKKRF 299 >gi|254781114|ref|YP_003065527.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 263 Score = 23.5 bits (49), Expect = 4.2, Method: Compositional matrix adjust. Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Query: 60 LMRVRDTARNPITRDMRLQWWKDIFES--STKGLIAESI--SPFSVELLSIVRQYDLPNQ 115 L+ VR PI DM+ WW+ S + G + E+I + ++E +VR+ Sbjct: 165 LLNVRKNIYRPIDMDMK-HWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPL 223 Query: 116 YF 117 YF Sbjct: 224 YF 225 >gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Score = 23.5 bits (49), Expect = 4.5, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 7/55 (12%) Query: 173 AGIAQFIGQL-------ICQLPIHYHRGQLYFPLDILGAVGLDRESFLSGQNSDR 220 GI+Q I L +C+L I FP +LG+V SF+ S R Sbjct: 249 GGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKR 303 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.141 0.423 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 187,339 Number of Sequences: 1233 Number of extensions: 7567 Number of successful extensions: 25 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 23 Number of HSP's gapped (non-prelim): 5 length of query: 299 length of database: 328,796 effective HSP length: 73 effective length of query: 226 effective length of database: 238,787 effective search space: 53965862 effective search space used: 53965862 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 38 (19.2 bits)