HHsearch alignment for GI: 254780164 and conserved domain: COG2127

>COG2127 Uncharacterized conserved protein [Function unknown].
Probab=100.00  E-value=5e-35  Score=220.88  Aligned_cols=94  Identities=45%  Similarity=0.721  Sum_probs=89.6

Q ss_pred             CHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             10100010026899748999718988489999999998299989999999998237968999638999999999999999
Q gi|254780164|r   45 DSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYS  124 (138)
Q Consensus        45 ~~~~~~~~k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~A  124 (138)
T Consensus        14 ~~~~~~~t~~~~p~~ykVillNDd~T~mefVv~vL~~~F~~s~e~A~~lMl~VH~~G~av~gv~t~evAEtk~~~v~~~g   93 (107)
T COG2127          14 LVKRKTKTKTKPPKMYKVILLNDDYTPMEFVVYVLQKFFGMSEERATKLMLQVHREGKAVVGVYTREVAETKVAQVRDAG   93 (107)
T ss_pred             CCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHH
T ss_conf             21245775667997336898569985899999999999565999999999999866967999702799999999999999


Q ss_pred             HHCCCCEEEEEECC
Q ss_conf             97599817986119
Q gi|254780164|r  125 RQHQYPLQCIMEQK  138 (138)
Q Consensus       125 r~~~~PL~~~iE~e  138 (138)
T Consensus        94 ~~~~~pl~~~~e~~  107 (107)
T COG2127          94 LEATHPLLCTMEEE  107 (107)
T ss_pred             HHCCCCHHHHCCCC
T ss_conf             97259745640679