RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62] (138 letters) >gnl|CDD|178809 PRK00033, clpS, ATP-dependent Clp protease adaptor protein ClpS; Reviewed. Length = 100 Score = 111 bits (279), Expect = 8e-26 Identities = 44/88 (50%), Positives = 57/88 (64%), Gaps = 6/88 (6%) Query: 51 SSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAY 110 K++ P +Y+VLL ND+YTPMEFV++VLQ FF D E A IML+VH++G GV Sbjct: 19 EPKLKPPPMYKVLLHNDDYTPMEFVVYVLQKFFGYDRERATQIMLEVHNEGKAVVGVCTR 78 Query: 111 EIAEMKVNQVMNYSRQHQYPLQCIMEQK 138 E+AE KV QV HQ+ L C ME+ Sbjct: 79 EVAETKVEQV------HQHGLLCTMEKD 100 >gnl|CDD|183845 PRK13019, clpS, ATP-dependent Clp protease adaptor; Reviewed. Length = 94 Score = 56.9 bits (138), Expect = 2e-09 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Query: 53 KVRVPKLYRVLLVNDNYTPMEFVIH-VLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYE 111 K+ LY+V+++ND++ E V++ +L+ + A +M+ H +G V E Sbjct: 15 KLERYPLYKVIVLNDDFNTFEHVVNCLLKAIPGMSEDRAWRLMITAHKEGSAVVWVGPLE 74 Query: 112 IAEMKVNQ 119 AE+ Q Sbjct: 75 QAELYHQQ 82 >gnl|CDD|178361 PLN02761, PLN02761, lipase class 3 family protein. Length = 527 Score = 26.2 bits (57), Expect = 2.7 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 85 KDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120 + HE + I + H G V AY+IAE+ +N V Sbjct: 290 EGHEIS--ITVTGHSLGASLALVSAYDIAELNLNHV 323 >gnl|CDD|182309 PRK10213, nepI, ribonucleoside transporter; Reviewed. Length = 394 Score = 26.0 bits (57), Expect = 2.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 8 SMYHRVKRDGILALMSFIFMA 28 + + ++R G++A M IFM+ Sbjct: 208 NTFRLLQRPGVMAGMIAIFMS 228 >gnl|CDD|131843 TIGR02796, tolQ, TolQ protein. TolQ is one of the essential components of the Tol-Pal system. Together with TolR, it harnesses protonmotive force to energize TolA, which spans the periplasm to reach the complex of TolB and Pal at the outer member. The tol-pal system proves to be important for maintaining outer membrane integrity. Gene pairs similar to the TolQ and TolR gene pair often number several per genome, but this model describes specificially TolQ per se, as found in tol-pal operons. A close homolog, excluded from this model, is ExbB of the ExbB/ExbD/TonB protein complex, which powers transport of siderophores and vitamin B12 across the bacterial outer membrane. The Tol-Pal system is exploited by colicin and filamentous phage DNA to enter the cell. It is also implicated in pathogenesis in several bacterial species. Length = 215 Score = 25.7 bits (57), Expect = 4.8 Identities = 17/64 (26%), Positives = 25/64 (39%), Gaps = 15/64 (23%) Query: 18 ILALMSFI---FMAD-----SRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNY 69 IL L S I + R ++ EF++ RF S + KLY L N Sbjct: 19 ILLLASIISWAIIFQKFFIFRRARRE-AEEFED------RFWSGGDLEKLYNSLSNNKPT 71 Query: 70 TPME 73 + +E Sbjct: 72 SGLE 75 >gnl|CDD|185540 PTZ00288, PTZ00288, glucokinase 1; Provisional. Length = 405 Score = 25.3 bits (55), Expect = 5.5 Identities = 9/40 (22%), Positives = 17/40 (42%), Gaps = 8/40 (20%) Query: 61 RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100 V+L+ DN V +FF+ + E K + ++ Sbjct: 326 TVVLMGDNI--------VYNSFFFDNPENVKQLQARITEH 357 >gnl|CDD|172382 PRK13861, PRK13861, type IV secretion system protein VirB9; Provisional. Length = 292 Score = 24.8 bits (54), Expect = 6.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 40 FDNCLDSEVRFSSKVRVPKLYRV 62 FDN + RF VR+P +Y + Sbjct: 203 FDNGFSTVFRFPGNVRIPSIYTI 225 >gnl|CDD|178625 PLN03076, PLN03076, ARF guanine nucleotide exchange factor (ARF-GEF); Provisional. Length = 1780 Score = 24.8 bits (54), Expect = 7.0 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 9/71 (12%) Query: 22 MSFIFMADSRMNKKGIAEFDNCL----DSEVRFSSKVRVPKLYRVL-LVNDNYTPMEFV- 75 M+ IF ++N + I +F L E+R S RV L +++ + + N + V Sbjct: 1072 MNRIFTRSQKLNSEAIIDFVKALCKVSMEELRSPSDPRVFSLTKIVEIAHYNMNRIRLVW 1131 Query: 76 ---IHVLQNFF 83 HVL +FF Sbjct: 1132 SSIWHVLSDFF 1142 >gnl|CDD|162112 TIGR00926, 2A1704, Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors). Length = 654 Score = 25.1 bits (55), Expect = 7.1 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Query: 17 GILALMSFI-FMADSRMNKK 35 IL +++ I FMA S+M KK Sbjct: 168 AILMILALIVFMAGSKMYKK 187 >gnl|CDD|184043 PRK13417, PRK13417, F0F1 ATP synthase subunit A; Provisional. Length = 352 Score = 24.5 bits (53), Expect = 9.1 Identities = 9/13 (69%), Positives = 9/13 (69%) Query: 18 ILALMSFIFMADS 30 ILALM FIF S Sbjct: 296 ILALMGFIFQFQS 308 >gnl|CDD|162465 TIGR01652, ATPase-Plipid, phospholipid-translocating P-type ATPase, flippase. This model describes the P-type ATPase responsible for transporting phospholipids from one leaflet of bilayer membranes to the other. These ATPases are found only in eukaryotes. Length = 1057 Score = 24.6 bits (54), Expect = 9.3 Identities = 10/41 (24%), Positives = 17/41 (41%) Query: 43 CLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFF 83 D +V S +R P+LYR ++ F +L + Sbjct: 885 VFDQDVSASLSLRYPQLYREGQKGQGFSTKTFWGWMLDGIY 925 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.139 0.421 Gapped Lambda K H 0.267 0.0762 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,162,383 Number of extensions: 120146 Number of successful extensions: 227 Number of sequences better than 10.0: 1 Number of HSP's gapped: 225 Number of HSP's successfully gapped: 13 Length of query: 138 Length of database: 5,994,473 Length adjustment: 84 Effective length of query: 54 Effective length of database: 4,179,401 Effective search space: 225687654 Effective search space used: 225687654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (23.7 bits)