RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62] (138 letters) >2w9r_A YLJA, ATP-dependent CLP protease adapter protein CLPS; chaperone, adaptor protein, DNA condensation, iron, CLPS, CLPA, cytoplasm, N-END RULE; HET: DNA; 1.70A {Escherichia coli} PDB: 2wa9_A 1mbx_C* 1mbv_B 1mbu_C* 1r6o_C* 1r6q_C* 2wa8_A 1mg9_A* 1lzw_A* (A:24-108) Length = 85 Score = 111 bits (280), Expect = 3e-26 Identities = 44/81 (54%), Positives = 59/81 (72%) Query: 57 PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116 P +Y+V+LVND+YTPMEFVI VLQ FF D E A +ML VH+QG CGV+ E+AE K Sbjct: 2 PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETK 61 Query: 117 VNQVMNYSRQHQYPLQCIMEQ 137 V V Y+R++++PL C +E+ Sbjct: 62 VAMVNKYARENEHPLLCTLEK 82 >3dnj_A ATP-dependent CLP protease adapter protein CLPS; adaptor, protein-peptide complex, peptide binding protein; 1.15A {Caulobacter vibrioides} PDB: 3g19_A 3gq0_A 3gq1_A 3gw1_A 3g1b_A (A:) Length = 85 Score = 109 bits (275), Expect = 1e-25 Identities = 50/81 (61%), Positives = 64/81 (79%) Query: 57 PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116 P LYRVL++ND+YTPMEFV++VL+ FF K E A IML VH G+G CGVY YE+AE K Sbjct: 4 PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETK 63 Query: 117 VNQVMNYSRQHQYPLQCIMEQ 137 V QV++ +R+HQ+PLQC ME+ Sbjct: 64 VAQVIDSARRHQHPLQCTMEK 84 >2j5l_A Apical membrane antigen 1; malaria vaccine candidate, apical membrane antigen 1, hypothetical protein, immunoglobulin domain; 2.9A {Plasmodium falciparum} (A:) Length = 581 Score = 24.9 bits (54), Expect = 3.7 Identities = 7/33 (21%), Positives = 11/33 (33%) Query: 68 NYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQ 100 N P + D+ KC +L + Q Sbjct: 191 NMNPDNDKNSNYKYPAVYDYNDKKCHILYIAAQ 223 >1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} (A:1-13,A:287-500) Length = 227 Score = 23.7 bits (51), Expect = 9.0 Identities = 13/94 (13%), Positives = 23/94 (24%), Gaps = 20/94 (21%) Query: 53 KVRVPKLYRVLLVNDNYTPMEFVIHVLQ-----------NFFYKDHETAK--------CI 93 KVRVP V+D ++ +L F E Sbjct: 3 KVRVPDFSDKKPVHDTPFNAAYIARILSEGGDYVDSFSYWTFSDVFEERDVPRSQFHGGF 62 Query: 94 MLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQH 127 L I + Y ++ +++ Sbjct: 63 GLV-ALNMIPKPTFYTFKFFNAMGEEMLYRDEHM 95 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.327 0.139 0.421 Gapped Lambda K H 0.267 0.0608 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,052,737 Number of extensions: 42893 Number of successful extensions: 151 Number of sequences better than 10.0: 1 Number of HSP's gapped: 151 Number of HSP's successfully gapped: 9 Length of query: 138 Length of database: 4,956,049 Length adjustment: 80 Effective length of query: 58 Effective length of database: 2,251,649 Effective search space: 130595642 Effective search space used: 130595642 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.3 bits)