RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780164|ref|YP_003064577.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter asiaticus str. psy62] (138 letters) >d1r6oc1 d.45.1.2 (C:20-106) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]} Length = 87 Score = 119 bits (301), Expect = 7e-29 Identities = 44/85 (51%), Positives = 61/85 (71%) Query: 53 KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112 ++ P +Y+V+LVND+YTPMEFVI VLQ FF D E A +ML VH+QG CGV+ E+ Sbjct: 2 ALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEV 61 Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137 AE KV V Y+R++++PL C +E+ Sbjct: 62 AETKVAMVNKYARENEHPLLCTLEK 86 >d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 79 Score = 24.2 bits (53), Expect = 4.2 Identities = 7/48 (14%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Query: 48 VRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIML 95 V F ++P +Y L+V T + + + + + + + Sbjct: 15 VAFPPG-KMPNIYNALIVKGRDTAGQPMNVTCEVQQLLGNNRVRAVAM 61 >d1aoca_ g.17.1.5 (A:) Coagulogen {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 175 Score = 23.5 bits (50), Expect = 6.5 Identities = 8/36 (22%), Positives = 14/36 (38%) Query: 98 HHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC 133 HH ECG Y + ++ N+ + +C Sbjct: 53 HHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKSEC 88 >d1h0ha1 b.52.2.2 (A:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Length = 165 Score = 23.2 bits (49), Expect = 9.7 Identities = 10/59 (16%), Positives = 17/59 (28%) Query: 4 FDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRV 62 + G M F M++ +GI D + VR + R+ Sbjct: 49 WQTGLMTRNTPWLLEAEPQMFCEMSEELATLRGIKNGDKVILESVRGKLWAKAIITKRI 107 >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Score = 22.9 bits (48), Expect = 9.9 Identities = 9/73 (12%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Query: 61 RVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV 120 R+L+V+D + + L +Y + TA + + ++ ++ Sbjct: 3 RILVVDDIEANVRLLEAKLTAEYY-EVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGF 61 Query: 121 MNYSRQHQYPLQC 133 + P Sbjct: 62 TVCRKLKDDPTTR 74 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.139 0.421 Gapped Lambda K H 0.267 0.0642 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 511,025 Number of extensions: 21470 Number of successful extensions: 85 Number of sequences better than 10.0: 1 Number of HSP's gapped: 85 Number of HSP's successfully gapped: 17 Length of query: 138 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 62 Effective length of database: 1,364,116 Effective search space: 84575192 Effective search space used: 84575192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (22.4 bits)