HHsearch alignment for GI: 254780165 and conserved domain: pfam11324

>pfam11324 DUF3126 Protein of unknown function (DUF3126). This family of proteins with unknown function appear to be restricted to Alphaproteobacteria.
Probab=99.96  E-value=6e-30  Score=195.66  Aligned_cols=62  Identities=50%  Similarity=0.900  Sum_probs=60.4

Q ss_pred             HHHHHHHHHHHHCCC-CEEEEECCCCCCCEEEEECCEEEEEEEEECCCCCEEEEEEEEEEECC
Q ss_conf             999999999986199-63995079988727898889799999843467825789984544113
Q gi|254780165|r    9 EIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDD   70 (71)
Q Consensus         9 Ei~klq~yLr~~F~~-~i~v~~r~~~~DSaEV~i~~EfiGvi~~D~eeGe~sY~f~MtILd~D   70 (71)
T Consensus         1 Ei~klq~yLr~~F~n~~i~v~~r~k~~DSaEV~~~~EFiGvi~~D~eeGe~sy~f~M~ILd~D   63 (63)
T pfam11324         1 EIKKLQAYLKRKFGNPTLRVKARPKKGDSAEVYIGDEFIGVLFKDEDEGETSYSFEMAILDID   63 (63)
T ss_pred             CHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEECCEEEEEEEEECCCCCEEEEEEEEEECCC
T ss_conf             958999999997199965997679999876998589899999873578838899988996369