BLAST/PSIBLAST alignment of GI: 254780165 and GI: 121602164 at iteration 1
>gi|121602164|ref|YP_989119.1| hypothetical protein BARBAKC583_0831 [Bartonella bacilliformis KC583] Length = 70
>gi|120614341|gb|ABM44942.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 70
 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 1/68 (1%)

Query: 5  MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63
          M ADEIKKL+ Y K +F  S + V++R  + DS EV +  EF+G++YR++DE+E+SY+F 
Sbjct: 1  MNADEIKKLDNYFKTIFQNSALQVKARPKKDDSCEVYIRDEFLGIIYRDEDEDELSYNFS 60

Query: 64 MSILEDDL 71
          M+IL+ DL
Sbjct: 61 MAILDVDL 68