BLAST/PSIBLAST alignment of GI: 254780165 and GI: 163868310 at iteration 1
>gi|163868310|ref|YP_001609519.1| hypothetical protein Btr_1152 [Bartonella tribocorum CIP 105476] Length = 87
>gi|161017966|emb|CAK01524.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 87
 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 51/68 (75%), Gaps = 1/68 (1%)

Query: 5  MRADEIKKLERYLKRVF-GSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFD 63
          + ADEIKKL+ YLK  F  S + V++R  + DS EV M  EF+G++YR++DE+E+SY+F 
Sbjct: 18 VNADEIKKLDNYLKNTFQNSALQVRARPKKDDSCEVYMGDEFLGVIYRDEDEDELSYNFS 77

Query: 64 MSILEDDL 71
          M+IL+ DL
Sbjct: 78 MAILDIDL 85