RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780165|ref|YP_003064578.1| hypothetical protein
CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62]
         (71 letters)



>gnl|CDD|151765 pfam11324, DUF3126, Protein of unknown function (DUF3126).  This
          family of proteins with unknown function appear to be
          restricted to Alphaproteobacteria.
          Length = 63

 Score = 74.2 bits (183), Expect = 7e-15
 Identities = 31/63 (49%), Positives = 47/63 (74%), Gaps = 1/63 (1%)

Query: 9  EIKKLERYLKRVFGS-GIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSIL 67
          EIKKL+ YLKR FG+  + V++R  + DS EV +  EFIG++++++DE E SY F+M+IL
Sbjct: 1  EIKKLQAYLKRKFGNPTLRVKARPKKGDSAEVYIGDEFIGVLFKDEDEGETSYSFEMAIL 60

Query: 68 EDD 70
          + D
Sbjct: 61 DID 63


>gnl|CDD|168689 PRK06824, PRK06824, translation initiation factor Sui1; Validated.
          Length = 118

 Score = 30.0 bits (68), Expect = 0.14
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 7   ADEIKKLERYLKRVFGSGIAVQ--SRENQSDSVEVLM 41
            D +K+L + LKR  G+G  ++    E Q D VE+L+
Sbjct: 67  EDALKELAKELKRRCGTGGTLKDGVIEIQGDHVELLL 103


>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit;
           Validated.
          Length = 564

 Score = 25.4 bits (56), Expect = 3.5
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 31  ENQSDSVEVLMNSEFIGLVYRNDD 54
           ENQ D   +LMN+E +GLV++   
Sbjct: 461 ENQLDVKIILMNNEALGLVHQQQS 484


>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein;
          Provisional.
          Length = 389

 Score = 25.2 bits (56), Expect = 3.5
 Identities = 11/16 (68%), Positives = 11/16 (68%), Gaps = 2/16 (12%)

Query: 14 ERYLKRVFGSGIAVQS 29
          ERYL   F SGIAV S
Sbjct: 31 ERYLD--FASGIAVNS 44


>gnl|CDD|180372 PRK06058, PRK06058, 4-aminobutyrate aminotransferase;
          Provisional.
          Length = 443

 Score = 24.2 bits (53), Expect = 7.4
 Identities = 9/17 (52%), Positives = 10/17 (58%)

Query: 21 FGSGIAVQSRENQSDSV 37
           GSGIAV S  N +  V
Sbjct: 61 LGSGIAVTSVGNSAPRV 77


>gnl|CDD|178137 PLN02522, PLN02522, ATP citrate (pro-S)-lyase.
          Length = 608

 Score = 24.0 bits (52), Expect = 8.2
 Identities = 10/33 (30%), Positives = 20/33 (60%)

Query: 10  IKKLERYLKRVFGSGIAVQSRENQSDSVEVLMN 42
           ++ +++   RV G G  ++SR+N+   VE+L  
Sbjct: 473 VEGMKKKGIRVPGIGHRIKSRDNRDKRVELLQK 505


>gnl|CDD|183601 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase;
           Provisional.
          Length = 641

 Score = 23.9 bits (52), Expect = 9.0
 Identities = 8/14 (57%), Positives = 9/14 (64%)

Query: 15  RYLKRVFGSGIAVQ 28
           R+  RVF  GIA Q
Sbjct: 358 RFPNRVFDVGIAEQ 371


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.317    0.135    0.357 

Gapped
Lambda     K      H
   0.267   0.0724    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 1,188,368
Number of extensions: 59848
Number of successful extensions: 160
Number of sequences better than 10.0: 1
Number of HSP's gapped: 159
Number of HSP's successfully gapped: 19
Length of query: 71
Length of database: 5,994,473
Length adjustment: 42
Effective length of query: 29
Effective length of database: 5,086,937
Effective search space: 147521173
Effective search space used: 147521173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.0 bits)