RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780165|ref|YP_003064578.1| hypothetical protein CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >1x99_A Lectin, XCL lectin; fungal lectin, sugar binding protein; HET: MSE; 1.40A {Xerocomus chrysenteron} (A:) Length = 145 Score = 26.4 bits (58), Expect = 1.6 Identities = 8/40 (20%), Positives = 14/40 (35%), Gaps = 6/40 (15%) Query: 3 VRMRADE--IKKLERYLKRVFGSGIAVQSRENQSDSVEVL 40 ++ DE + +Y + +G RE Q V Sbjct: 84 TGLKPDETALVINPQY----YNNGGRDYVREKQLAEYSVT 119 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} (F:1-76) Length = 76 Score = 24.7 bits (53), Expect = 4.1 Identities = 5/10 (50%), Positives = 7/10 (70%) Query: 9 EIKKLERYLK 18 +KKL+ LK Sbjct: 21 ALKKLQASLK 30 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.135 0.357 Gapped Lambda K H 0.267 0.0715 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 552,526 Number of extensions: 19609 Number of successful extensions: 64 Number of sequences better than 10.0: 1 Number of HSP's gapped: 64 Number of HSP's successfully gapped: 7 Length of query: 71 Length of database: 4,956,049 Length adjustment: 38 Effective length of query: 33 Effective length of database: 3,671,459 Effective search space: 121158147 Effective search space used: 121158147 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.1 bits)