RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780165|ref|YP_003064578.1| hypothetical protein
CLIBASIA_00240 [Candidatus Liberibacter asiaticus str. psy62]
         (71 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
          acyl-carrier-protein, beta-ketoacyl reductase,
          beta-ketoacyl synthase, dehydratase; 4.00A
          {Saccharomyces cerevisiae}
          Length = 2006

 Score = 33.4 bits (76), Expect = 0.013
 Identities = 10/57 (17%), Positives = 22/57 (38%), Gaps = 9/57 (15%)

Query: 17 LKRVFGSGIAVQSRENQSD-----SVEVLMNSEFIGLVYRNDDEEEISYHFDMSILE 68
          L+  F   +   +    +D       E++   +F+G V    +  ++   FD  +L 
Sbjct: 33 LQEQFNKILPEPTEGFAADDEPTTPAELV--GKFLGYVSSLVEPSKVG-QFD-QVLN 85


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 26.9 bits (58), Expect = 1.0
 Identities = 6/24 (25%), Positives = 14/24 (58%), Gaps = 5/24 (20%)

Query: 10 IKKLERYLKRVFGS----GIAVQS 29
          +KKL+  LK ++       +A+++
Sbjct: 22 LKKLQASLK-LYADDSAPALAIKA 44


>3lfk_A MSCTV, MARR like protein, TVG0766549; multiple antibiotic
           resistance regulator, transcriptional regulator, winged
           helix-turn-helix motif; HET: CIT; 1.60A {Thermoplasma
           volcanium}
          Length = 129

 Score = 26.3 bits (57), Expect = 1.9
 Identities = 13/48 (27%), Positives = 22/48 (45%)

Query: 10  IKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEE 57
           +K  E  LK +   G A++ +E   + + +    EF+    R  DEE 
Sbjct: 63  LKDPESVLKNLMDYGFALEDKERLGEKIVLTSEGEFVAQAIRVRDEEL 110


>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose,
          covalent glycosyl-enzyme intermediate; 2.10A
          {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2
          c.1.8.3 PDB: 1px8_A
          Length = 500

 Score = 25.3 bits (54), Expect = 3.8
 Identities = 10/47 (21%), Positives = 17/47 (36%), Gaps = 2/47 (4%)

Query: 1  MEVRMRADEIKKLERYLKRVFGSGIAVQ--SRENQSDSVEVLMNSEF 45
          ++VR+     KK     +   G+G       +E       V  N +F
Sbjct: 2  IKVRVPDFSDKKFSDRWRYCVGTGRLGLALQKEYIETLKYVKENIDF 48


>2if1_A EIF1, SUI1; translation initiation factor; NMR {Homo sapiens}
          SCOP: d.64.1.1
          Length = 126

 Score = 24.1 bits (52), Expect = 8.4
 Identities = 6/31 (19%), Positives = 13/31 (41%)

Query: 9  EIKKLERYLKRVFGSGIAVQSRENQSDSVEV 39
          + KKL +  K+ F     V       + +++
Sbjct: 68 DKKKLVKAFKKKFACNGTVIEHPEYGEVIQL 98


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.317    0.135    0.357 

Gapped
Lambda     K      H
   0.267   0.0500    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 633,067
Number of extensions: 23525
Number of successful extensions: 85
Number of sequences better than 10.0: 1
Number of HSP's gapped: 85
Number of HSP's successfully gapped: 7
Length of query: 71
Length of database: 5,693,230
Length adjustment: 41
Effective length of query: 30
Effective length of database: 4,699,226
Effective search space: 140976780
Effective search space used: 140976780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.6 bits)