HHsearch alignment for GI: 254780166 and conserved domain: COG4553

>COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism].
Probab=96.05  E-value=0.051  Score=31.08  Aligned_cols=105  Identities=17%  Similarity=0.127  Sum_probs=70.8

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             87899998788880012217999999986898999964765542222222222221222222222222222222222344
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGY  105 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGh  105 (261)
T Consensus       103 dPkvLivapmsGH~--aTLLR~TV~alLp~-~~vyitDW~dA--r~Vp~~~G~FdldDYIdyvie~~~~~Gp~-~hv~aV  176 (415)
T COG4553         103 DPKVLIVAPMSGHY--ATLLRGTVEALLPY-HDVYITDWVDA--RMVPLEAGHFDLDDYIDYVIEMINFLGPD-AHVMAV  176 (415)
T ss_pred             CCEEEEEECCCCCH--HHHHHHHHHHHCCC-CCEEEEECCCC--CEEECCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEE
T ss_conf             97089983266307--99998889986655-64468531221--34432467766788999999999973999-747887


Q ss_pred             CCCCC-----CHHHHHHHCCCCCCCEEEECCCCCCC
Q ss_conf             34443-----10133321023565238962885633
Q gi|254780166|r  106 SMGAR-----IACSMVLFYPSYVRSVILGGVGSVLY  136 (261)
Q Consensus       106 S~Gg~-----ia~~~a~~~p~~v~~lvl~~~~~~~~  136 (261)
T Consensus       177 CQP~vPvLAAisLM~~~~~p~~PssMtlmGgPIDaR  212 (415)
T COG4553         177 CQPTVPVLAAISLMEEDGDPNVPSSMTLMGGPIDAR  212 (415)
T ss_pred             ECCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCCC
T ss_conf             069824999999997529999973456515754345