HHsearch alignment for GI: 254780166 and conserved domain: KOG1455

>KOG1455 consensus.
Probab=99.93  E-value=1.7e-24  Score=164.68  Aligned_cols=254  Identities=20%  Similarity=0.233  Sum_probs=169.7

Q ss_pred             CCCEEEEEECCCCEEEEEEECCC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             76407999349949999996489----98789999878888001221799999998689899996476554222222222
Q gi|254780166|r    2 MNEVKFFRSWRKYQFAFYDVGDK----DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN   77 (261)
Q Consensus         2 ~~~~~~~~~~dG~~l~y~~~g~~----~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~   77 (261)
T Consensus        26 ~~~~~~~~n~rG~~lft~~W~p~~~~~pr~lv~~~HG~g~~--~s~~~~~~a~~l~~~g~~v~a~D~~GhG~SdGl~~yi  103 (313)
T KOG1455          26 TYSESFFTNPRGAKLFTQSWLPLSGTEPRGLVFLCHGYGEH--SSWRYQSTAKRLAKSGFAVYAIDYEGHGRSDGLHAYV  103 (313)
T ss_pred             CEEEEEEECCCCCEEEEEECCCCCCCCCCEEEEEECCCCCC--CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCC
T ss_conf             00001377477787677743567899874699997477632--1046899999998579748975425777678874467


Q ss_pred             CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC----CCHHHHHHHH
Q ss_conf             222122222222222222------222222234434443101333210235652389628856331----1035699999
Q gi|254780166|r   78 DYRLVFMAADAVSLLEHL------GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD----SDVVDWQSLI  147 (261)
Q Consensus        78 ~~s~~~~~~di~~~i~~l------~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~----~~~~~~~~~~  147 (261)
T Consensus       104 -~~~d~~v~D~~~~~~~i~~~~e~~~lp~FL~GeSMGGAV~Ll~~~k~p~~w~G~ilvaPmc~i~~~~kp~p~v~~~l~~  182 (313)
T KOG1455         104 -PSFDLVVDDVISFFDSIKEREENKGLPRFLFGESMGGAVALLIALKDPNFWDGAILVAPMCKISEDTKPHPPVISILTL  182 (313)
T ss_pred             -CCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             -7578889889999988764124589976443057446999999761876102410000412257766898289999999


Q ss_pred             HHHHCCCCCHHHHH--HH-----HHHCCCCCCCCC--CCHHHHHHHHHHH-CCCCCHHHHHCCCCCEEEEEECCCCCCCC
Q ss_conf             98631111000011--10-----000000034766--5413567776541-01220012100357606998478887880
Q gi|254780166|r  148 DSFLLPSIDEVQNP--LG-----KKFRKFADLDPG--NDLKALASCLSMI-RKPFCQDDLYRIDVPVLIAVGSQDDLAGS  217 (261)
Q Consensus       148 ~~~~~~~~~~~~~~--~~-----~~~~~~~~~~~~--~~~~~~~~~~~~~-~~~~~~~~l~~i~~P~l~i~G~~D~~~~~  217 (261)
T Consensus       183 l~~liP~wk~vp~~d~~~~~~kdp~~r~~~~~npl~y~g~pRl~T~~ElLr~~~~le~~l~~vtvPflilHG~dD~VTDp  262 (313)
T KOG1455         183 LSKLIPTWKIVPTKDIIDVAFKDPEKRKILRSDPLCYTGKPRLKTAYELLRVTADLEKNLNEVTVPFLILHGTDDKVTDP  262 (313)
T ss_pred             HHHHCCCEEECCCCCCCCCCCCCHHHHHHHHCCCCEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCC
T ss_conf             98758710005876543200078999987523981533873088999999998999973324543479986588840580


Q ss_pred             --HHHHHHHCC--CCEEEEECCCCCCCCC-CCHH----HHHHHHHHHHHH
Q ss_conf             --799999679--9799998888738434-8489----999999998751
Q gi|254780166|r  218 --PQELMSFIP--SSQYLNICRRDHLLAV-GDKQ----FKQGVVNFYANE  258 (261)
Q Consensus       218 --~~~l~~~~p--~~~~~~i~~~gH~~~~-e~p~----~~~~i~~Fl~~~  258 (261)
T Consensus       263 ~~Sk~Lye~A~S~DKTlKlYpGm~H~Ll~gE~~en~e~Vf~DI~~Wl~~r  312 (313)
T KOG1455         263 KVSKELYEKASSSDKTLKLYPGMWHSLLSGEPDENVEIVFGDIISWLDER  312 (313)
T ss_pred             HHHHHHHHHCCCCCCCEECCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             78899998565778843405447778541798554999999999999733