HHsearch alignment for GI: 254780166 and conserved domain: KOG1516

>KOG1516 consensus.
Probab=93.33  E-value=0.052  Score=31.02  Aligned_cols=122  Identities=16%  Similarity=0.104  Sum_probs=59.4

Q ss_pred             EECCCCEEEEEEEC-CCC--CCEEEEECCCCCCCHHHHHH--HHHHHHHHHCCCEEEEECCC----CCCCCCCCCCCCCC
Q ss_conf             93499499999964-899--87899998788880012217--99999998689899996476----55422222222222
Q gi|254780166|r    9 RSWRKYQFAFYDVG-DKD--APTILLIHGLASSVQTNWLF--SGWIQLLCDQGFRVIAFDNL----GHGKSDKSYIENDY   79 (261)
Q Consensus         9 ~~~dG~~l~y~~~g-~~~--~~~vv~iHG~~~~~~~~~~~--~~~~~~l~~~g~~vi~~D~~----G~G~S~~~~~~~~~   79 (261)
T Consensus        92 ~sEDCLylNV~tp~~~~~~~~pV~V~iHGG~~~~gs~~~~~~~~~~~~~~~~~VVvVt~~YRLG~lGF~st~d~~~~gN~  171 (545)
T KOG1516          92 GSEDCLYLNVYTPQGCSESKLPVMVYIHGGGFQFGSASSFEIISPAYVLLLKDVVVVTINYRLGPLGFLSTGDSAAPGNL  171 (545)
T ss_pred             CCCCCCEEEEECCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHCCHHHCCCCCEEEEEEEEEEEEEEECCCCCCCCCCHH
T ss_conf             67887556553465234358975999807850027621123305201115688899985220031152235887788618


Q ss_pred             CCCCCC---CCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHC--CCCCCCEEEEC
Q ss_conf             212222---22222222222--22222234434443101333210--23565238962
Q gi|254780166|r   80 RLVFMA---ADAVSLLEHLG--ISKVHVMGYSMGARIACSMVLFY--PSYVRSVILGG  130 (261)
Q Consensus        80 s~~~~~---~di~~~i~~l~--~~~~~liGhS~Gg~ia~~~a~~~--p~~v~~lvl~~  130 (261)
T Consensus       172 gl~Dq~~AL~wv~~~I~~FGGdp~~VTl~G~saGa~~v~~l~~Sp~s~~LF~~aI~~S  229 (545)
T KOG1516         172 GLFDQLLALRWVKDNIPSFGGDPKNVTLFGHSAGAASVSLLTLSPHSRGLFHKAISMS  229 (545)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCHHHHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             8899999999998366666899710578641589999998725853555677641066