HHsearch alignment for GI: 254780166 and conserved domain: KOG2281

>KOG2281 consensus.
Probab=98.72  E-value=2.6e-07  Score=62.52  Aligned_cols=226  Identities=17%  Similarity=0.132  Sum_probs=127.5

Q ss_pred             CEEEEEECCCCEEEEEEEC------CCCCCEEEEECCCCCCCHHHHHHHH----HHHHHHHCCCEEEEECCCCCCCCCCC
Q ss_conf             4079993499499999964------8998789999878888001221799----99999868989999647655422222
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVG------DKDAPTILLIHGLASSVQTNWLFSG----WIQLLCDQGFRVIAFDNLGHGKSDKS   73 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g------~~~~~~vv~iHG~~~~~~~~~~~~~----~~~~l~~~g~~vi~~D~~G~G~S~~~   73 (261)
T Consensus       614 eif~fqs~tg~~lYgmiyKPhn~~pgkkYptvl~VYGGP~VQlVnnsfkgi~ylR~~~LaslGy~Vv~IDnRGS~hRGlk  693 (867)
T KOG2281         614 EIFSFQSKTGLTLYGMIYKPHNFQPGKKYPTVLNVYGGPGVQLVNNSFKGIQYLRFCRLASLGYVVVFIDNRGSAHRGLK  693 (867)
T ss_pred             HHEEEECCCCCEEEEEEECCCCCCCCCCCCEEEEECCCCEEEEEECCCCCEEEHHHHHHHHCCEEEEEECCCCCCCCCCH
T ss_conf             21311138884799999645447778877649996179705886134443120101357537559999858874014403


Q ss_pred             ------CCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHH
Q ss_conf             ------2222222122222222222222---2222222344344431013332102356523896288563311035699
Q gi|254780166|r   74 ------YIENDYRLVFMAADAVSLLEHL---GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ  144 (261)
Q Consensus        74 ------~~~~~~s~~~~~~di~~~i~~l---~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~  144 (261)
T Consensus       694 FE~~ik~kmGqVE~eDQVeglq~Laeq~gfidmdrV~vhGWSYGGYLSlm~L~~~P~IfrvAIAGapVT~W~~YDTgYTE  773 (867)
T KOG2281         694 FESHIKKKMGQVEVEDQVEGLQMLAEQTGFIDMDRVGVHGWSYGGYLSLMGLAQYPNIFRVAIAGAPVTDWRLYDTGYTE  773 (867)
T ss_pred             HHHHHHHCCCEEEEHHHHHHHHHHHHHCCCCCHHHEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEECCCCCHH
T ss_conf             68888612771775677789999998508656124578433530288888876175403677417851133420242136


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCC---CHH--
Q ss_conf             999986311110000111000000003476654135677765410122001210035760699847888788---079--
Q gi|254780166|r  145 SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG---SPQ--  219 (261)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~---~~~--  219 (261)
T Consensus       774 RY----------------M--------g~P~~nE~gY~agSV~~~----VeklpdepnRLlLvHGliDENVHF~Hts~Lv  825 (867)
T KOG2281         774 RY----------------M--------GYPDNNEHGYGAGSVAGH----VEKLPDEPNRLLLVHGLIDENVHFAHTSRLV  825 (867)
T ss_pred             HH----------------C--------CCCCCCHHCCCCHHHHHH----HHCCCCCCCEEEEEEECCCCCHHHHHHHHHH
T ss_conf             54----------------3--------798630111330128888----7508887760799850334530346689999


Q ss_pred             -HHHHHCCCCEEEEECCCCCCCCC-CCHH-HHHHHHHHHHH
Q ss_conf             -99996799799998888738434-8489-99999999875
Q gi|254780166|r  220 -ELMSFIPSSQYLNICRRDHLLAV-GDKQ-FKQGVVNFYAN  257 (261)
Q Consensus       220 -~l~~~~p~~~~~~i~~~gH~~~~-e~p~-~~~~i~~Fl~~  257 (261)
T Consensus       826 s~lvkagKpyeL~IfP~ERHsiR~~es~~~yE~rll~FlQ~  866 (867)
T KOG2281         826 SALVKAGKPYELQIFPNERHSIRNPESGIYYEARLLHFLQE  866 (867)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99986799348997763014567775412499999999853