HHsearch alignment for GI: 254780166 and conserved domain: KOG2565

>KOG2565 consensus.
Probab=99.60  E-value=4e-15  Score=108.97  Aligned_cols=244  Identities=22%  Similarity=0.254  Sum_probs=147.2

Q ss_pred             EECCCCEEEEEEECCCC------CCEEEEECCCCCCCHHHHHHHHHHHHHHHC---------CCEEEEECCCCCCCCCCC
Q ss_conf             93499499999964899------878999987888800122179999999868---------989999647655422222
Q gi|254780166|r    9 RSWRKYQFAFYDVGDKD------APTILLIHGLASSVQTNWLFSGWIQLLCDQ---------GFRVIAFDNLGHGKSDKS   73 (261)
Q Consensus         9 ~~~dG~~l~y~~~g~~~------~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~---------g~~vi~~D~~G~G~S~~~   73 (261)
T Consensus       129 TeIeGL~iHFlhvk~p~~k~~k~v~PlLl~HGwPGsv~E---FykfIPlLT~p~~hg~~~d~~FEVI~PSlPGygwSd~~  205 (469)
T KOG2565         129 TEIEGLKIHFLHVKPPQKKKKKKVKPLLLLHGWPGSVRE---FYKFIPLLTDPKRHGNESDYAFEVIAPSLPGYGWSDAP  205 (469)
T ss_pred             HHHCCEEEEEEEECCCCCCCCCCCCCEEEECCCCCHHHH---HHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCCCC
T ss_conf             441341578898148732357765515895379851888---87640420586546875213699861588876667687


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEE--CCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             22222221222222222222222222222344344431013332102356523896--2885633110356999999863
Q gi|254780166|r   74 YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG--GVGSVLYDSDVVDWQSLIDSFL  151 (261)
Q Consensus        74 ~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~--~~~~~~~~~~~~~~~~~~~~~~  151 (261)
T Consensus       206 s-k~GFn~~a~ArvmrkLMlRLg~nkffiqGgDwGSiI~snlasLyPenV~GlHlnm~~~~s~~s~l~~~~---~a~~~~  281 (469)
T KOG2565         206 S-KTGFNAAATARVMRKLMLRLGYNKFFIQGGDWGSIIGSNLASLYPENVLGLHLNMCFVNSPFSTLKLLY---YAGFFP  281 (469)
T ss_pred             C-CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCHHHHHHHH---HHHHCC
T ss_conf             6-578549999999999999827641676157367888877776550456676643665588288999999---987544


Q ss_pred             CCCC-----CHHHHHHHH---------------------------------------HHCCCCCCCCCCC----------
Q ss_conf             1111-----000011100---------------------------------------0000003476654----------
Q gi|254780166|r  152 LPSI-----DEVQNPLGK---------------------------------------KFRKFADLDPGND----------  177 (261)
Q Consensus       152 ~~~~-----~~~~~~~~~---------------------------------------~~~~~~~~~~~~~----------  177 (261)
T Consensus       282 ~~~l~sre~~d~~~p~~~~~~~lmeesgYfhiqaTkpdTiGaAl~dsPvGlAaYIleKfstwTn~~~r~l~dggL~krFt  361 (469)
T KOG2565         282 GQFLPSREFQDFHFPVGKKFDQLMEESGYFHIQATKPDTIGAALNDSPVGLAAYILEKFSTWTNTEFRSLPDGGLNKRFT  361 (469)
T ss_pred             CCCCCCHHHHHHHCHHHHHHHHHHHHCCCEEEECCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHCCCCCHHEEEC
T ss_conf             43576066787506057789999985182688437962355664069337999999987620475554088875120222


Q ss_pred             HHHHH-HHH---------------HHHCCCC-CHHHH--HCCCCCEEEEEECCCCCCCCHHHHHHHCCCC-EEEEECCCC
Q ss_conf             13567-776---------------5410122-00121--0035760699847888788079999967997-999988887
Q gi|254780166|r  178 LKALA-SCL---------------SMIRKPF-CQDDL--YRIDVPVLIAVGSQDDLAGSPQELMSFIPSS-QYLNICRRD  237 (261)
Q Consensus       178 ~~~~~-~~~---------------~~~~~~~-~~~~l--~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~~-~~~~i~~~g  237 (261)
T Consensus       362 ~D~lltnvmiYwlT~si~ss~r~y~e~~~~~~r~~~~~r~~v~vPtg~a~f~~el~~~~~~~lrdky~nL~~~s~~~~GG  441 (469)
T KOG2565         362 MDELLTNVMIYWLTNSITSSQRFYDESFNQRQRDLALDRVQVRVPTGCARFKFELWHTSDDVLRDKYPNLTHSSYHPKGG  441 (469)
T ss_pred             HHHHHHHHHHHEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCHHHCCHHHHHHHCCCCEEEEECCCCC
T ss_conf             88986553222004861466999999875778888762215545404422544243285899864334620267536786


Q ss_pred             CCCCCCCH-HHHHHHHHHHHHHC
Q ss_conf             38434848-99999999987516
Q gi|254780166|r  238 HLLAVGDK-QFKQGVVNFYANEL  259 (261)
Q Consensus       238 H~~~~e~p-~~~~~i~~Fl~~~~  259 (261)
T Consensus       442 hFaalE~p~~La~D~~~FV~~~~  464 (469)
T KOG2565         442 HFAALEDPKKLAQDFFSFVEKLN  464 (469)
T ss_pred             CHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             40654074889999999999987