HHsearch alignment for GI: 254780166 and conserved domain: PRK10349

>PRK10349 carboxylesterase BioH; Provisional.
Probab=100.00  E-value=1.3e-42  Score=272.49  Aligned_cols=231  Identities=19%  Similarity=0.265  Sum_probs=164.3

Q ss_pred             EEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999964899878999987888800122179999999868989999647655422222222222212222222222222
Q gi|254780166|r   15 QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH   94 (261)
Q Consensus        15 ~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~   94 (261)
T Consensus         3 ~i~Y~~~G~G-~~plvllHG~g~~~~---~W~~~~~~L~~~-~rvi~~DlpG~G~S~~~---~~~~~~~~a~~l~~----   70 (256)
T PRK10349          3 NIWWQTKGQG-NVHLVLLHGWGLNAE---VWRCIDEELSSH-FTLHLVDLPGFGRSRGF---GALSLADMAEAVLK----   70 (256)
T ss_pred             CEEEEEECCC-CCCEEEECCCCCCHH---HHHHHHHHHHCC-CEEEEECCCCCCCCCCC---CCCCHHHHHHHHHH----
T ss_conf             6699966128-997799899987878---999999997347-77999579888889998---84589999999997----


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCH-----HH------------HHHHHHHHHC-CCC-
Q ss_conf             2222222234434443101333210235652389628856331103-----56------------9999998631-111-
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV-----VD------------WQSLIDSFLL-PSI-  155 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~-----~~------------~~~~~~~~~~-~~~-  155 (261)
T Consensus        71 ~~~~~~~lvG~SmGG~iA~~~A~~~P~rV~~Lvlv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  150 (256)
T PRK10349         71 QAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMG  150 (256)
T ss_pred             HCCCCEEEEEECHHHHHHHHHHHHCCHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             38767379998961899999999795555424155777444455455544699999999998888999999998765316


Q ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEE
Q ss_conf             00001110000000034766541356777654101220012100357606998478887880--7999996799799998
Q gi|254780166|r  156 DEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNI  233 (261)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i  233 (261)
T Consensus       151 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~d~~~~L~~i~~PtLvi~G~~D~~vp~~~~~~l~~~ip~a~l~ii  230 (256)
T PRK10349        151 TETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIF  230 (256)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             33457899999999980778879999999999980645878731899979998389988799999999986899889997


Q ss_pred             CCCCCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             888738434848-999999999875
Q gi|254780166|r  234 CRRDHLLAVGDK-QFKQGVVNFYAN  257 (261)
Q Consensus       234 ~~~gH~~~~e~p-~~~~~i~~Fl~~  257 (261)
T Consensus       231 ~~~GH~p~~E~P~~f~~~ll~Fl~r  255 (256)
T PRK10349        231 AKAAHAPFISHPAEFCHLLVALKQR  255 (256)
T ss_pred             CCCCCCHHHHCHHHHHHHHHHHHHH
T ss_conf             9999832543999999999999970