HHsearch alignment for GI: 254780166 and conserved domain: TIGR02821

>TIGR02821 fghA_ester_D S-formylglutathione hydrolase; InterPro: IPR014186 This entry describes proteins from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (3.1.2.12 from EC). Eukaryotic members, particularly the human protein, are better known as esterase D (3.1.1.1 from EC), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well..
Probab=98.20  E-value=2.4e-06  Score=56.78  Aligned_cols=103  Identities=19%  Similarity=0.245  Sum_probs=71.8

Q ss_pred             EEE-EECCCCCCCHHHHHHHHHHHHH-HHCCCEEEEECCCCCCCCCCCC--------------------CCCCCCCCCC-
Q ss_conf             899-9987888800122179999999-8689899996476554222222--------------------2222221222-
Q gi|254780166|r   28 TIL-LIHGLASSVQTNWLFSGWIQLL-CDQGFRVIAFDNLGHGKSDKSY--------------------IENDYRLVFM-   84 (261)
Q Consensus        28 ~vv-~iHG~~~~~~~~~~~~~~~~~l-~~~g~~vi~~D~~G~G~S~~~~--------------------~~~~~s~~~~-   84 (261)
T Consensus        44 PvL~yLsGLTCT~en~-m~Kag~~R~AAe~G~aLVaPDTSPR~~gi~gE~D~wDfG~GAGFYvDAt~~PWs~hYRmysYv  122 (279)
T TIGR02821        44 PVLYYLSGLTCTEENF-MIKAGAQRFAAEYGLALVAPDTSPRGTGIAGEDDEWDFGKGAGFYVDATEEPWSQHYRMYSYV  122 (279)
T ss_pred             CEEEECCCCCHHHHHH-HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCHHHHCCCCHHHH
T ss_conf             2331000013115789-987778999976890797267898777776786542147987521102201233207023558


Q ss_pred             CCCCCCCCCC-C--CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECC
Q ss_conf             2222222222-2--222222234434443101333210235652389628
Q gi|254780166|r   85 AADAVSLLEH-L--GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV  131 (261)
Q Consensus        85 ~~di~~~i~~-l--~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~  131 (261)
T Consensus       123 ~~ELpal~~~~fPld~~r~GI~GHSMGGhGAL~~AlknP~~fkSVSAFAP  172 (279)
T TIGR02821       123 VQELPALVAAQFPLDGERQGITGHSMGGHGALVIALKNPDRFKSVSAFAP  172 (279)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEECCCCC
T ss_conf             88999999985892201160135555467999998618873133124112