HHsearch alignment for GI: 254780166 and conserved domain: TIGR03100

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 2, TIGR03101) of the same superfamily.
Probab=99.84  E-value=2.5e-19  Score=134.02  Aligned_cols=239  Identities=16%  Similarity=0.126  Sum_probs=145.6

Q ss_pred             EEEEECCCCEEEEEEE--CCCCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             7999349949999996--48998789999878888001-22179999999868989999647655422222222222212
Q gi|254780166|r    6 KFFRSWRKYQFAFYDV--GDKDAPTILLIHGLASSVQT-NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV   82 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~--g~~~~~~vv~iHG~~~~~~~-~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~   82 (261)
T Consensus         4 ~~~~~~~g~~L~G~l~~p~~~~~~~vli~~~g~~~r~g~~r~~v~la~~la~~g~~~~rfd~~g~g~s~g~~----~~~~   79 (274)
T TIGR03100         4 ALTFSCEGETLVGVLHIPGASHTTGVLIVVGGPQYRVGSHRQFVLLARRLAEAGFPVLRFDYRGMGDSEGEN----LGFE   79 (274)
T ss_pred             EEEEECCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC----CCHH
T ss_conf             699965992899998379988887289988997666676427999999999789879997588887889887----8725


Q ss_pred             CCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHH--HHHHHHHHCCCC
Q ss_conf             2222222222222-----222222234434443101333210235652389628856331103569--999998631111
Q gi|254780166|r   83 FMAADAVSLLEHL-----GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW--QSLIDSFLLPSI  155 (261)
Q Consensus        83 ~~~~di~~~i~~l-----~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~--~~~~~~~~~~~~  155 (261)
T Consensus        80 ~~~~D~~aA~d~~~~~~~~~~~ivl~G~c~Ga~~al~~a~~~~-~v~glvL~nPw~~~~~~~~~~~~~~~y~~rL~~~--  156 (274)
T TIGR03100        80 GIDADIAAAIDAFREAAPHLRRIVAWGLCDAASAALLYAPADL-RVAGLVLLNPWVRTEAAQAASRIRHYYLGQLLSA--  156 (274)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHHHHCCC-CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCH--
T ss_conf             5489999999999863778673799997687999998753278-8437999777446544310145556789885086--


Q ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH-----------HHCCCCCHHHHHCCCCCEEEEEECCCCCCCC-------
Q ss_conf             0000111000000003476654135677765-----------4101220012100357606998478887880-------
Q gi|254780166|r  156 DEVQNPLGKKFRKFADLDPGNDLKALASCLS-----------MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS-------  217 (261)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~-------  217 (261)
T Consensus       157 ~~w~kll~g~------v~~~~~~~gl~~~l~~~~~~~~~~~~~~~~~r~~~~l~~~~gpvLiV~g~~D~t~~~f~~~~~~  230 (274)
T TIGR03100       157 DFWRKLLSGE------VNLGSSLRGLGDALLKARQKGDEVAHGGLAERMKAGLERFQGPVLFILSGNDLTAQEFADSVLG  230 (274)
T ss_pred             HHHHHHCCCC------CCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             8776641576------5367776647888764210356654214789999999855998899988986740343666504


Q ss_pred             HHH--HHHHCCCCEEEEECCCCCCCCC-C-CHHHHHHHHHHHHH
Q ss_conf             799--9996799799998888738434-8-48999999999875
Q gi|254780166|r  218 PQE--LMSFIPSSQYLNICRRDHLLAV-G-DKQFKQGVVNFYAN  257 (261)
Q Consensus       218 ~~~--l~~~~p~~~~~~i~~~gH~~~~-e-~p~~~~~i~~Fl~~  257 (261)
T Consensus       231 ~~~~~~l~~~p~~~~v~L~~ADHtFS~~~~r~~v~~~t~~Wl~r  274 (274)
T TIGR03100       231 EPAWRGALEDPGIERVEIDGADHTFSDRVWREWVAARTTEWLRR  274 (274)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             89999862089843998189998889889999999999999749