HHsearch alignment for GI: 254780166 and conserved domain: TIGR03101

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 1, TIGR03100) of the same superfamily.
Probab=99.10  E-value=1.8e-10  Score=81.27  Aligned_cols=124  Identities=16%  Similarity=0.240  Sum_probs=95.5

Q ss_pred             EEEEECCCCEEEEEEE--CCCCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             7999349949999996--48998789999878888001-22179999999868989999647655422222222222212
Q gi|254780166|r    6 KFFRSWRKYQFAFYDV--GDKDAPTILLIHGLASSVQT-NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV   82 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~--g~~~~~~vv~iHG~~~~~~~-~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~   82 (261)
T Consensus         3 ffl~~~~g~~F~~~h~P~~~~~~g~vl~~~PFaeE~n~srRm~a~~A~~laa~G~~vLrfD~~G~GDSaGdf~~--a~we   80 (266)
T TIGR03101         3 FFLDAPHGFRFCLYHPPVAVGPRGVVIYLPPFAEEMNKSRRMVALQARAFAAGGFGVLQIDLYGCGDSAGDFAA--ARWD   80 (266)
T ss_pred             EECCCCCCCEEEEEECCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC--CHHH
T ss_conf             02058998658997379888985079993840765314489999999999867974996244677786455540--2288


Q ss_pred             CCCCCCCCCCCC---CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECC
Q ss_conf             222222222222---2222222234434443101333210235652389628
Q gi|254780166|r   83 FMAADAVSLLEH---LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV  131 (261)
Q Consensus        83 ~~~~di~~~i~~---l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~  131 (261)
T Consensus        81 ~W~~Dv~aA~~~L~~~g~~~v~LwGLRlGAlLA~~aA~~~~~~v~~LVLWqP  132 (266)
T TIGR03101        81 VWKEDVAAAYRWLIEQGHPPVTLWGLRLGALLALDAANPLAAKCNRLVLWQP  132 (266)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             8999999999999864999568984004089999998644567673899702