HHsearch alignment for GI: 254780166 and conserved domain: TIGR03343

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Probab=100.00  E-value=0  Score=293.52  Aligned_cols=250  Identities=21%  Similarity=0.289  Sum_probs=171.4

Q ss_pred             EEEEEECC-----CCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             07999349-----9499999964899878999987888800122179999999868989999647655422222222222
Q gi|254780166|r    5 VKFFRSWR-----KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY   79 (261)
Q Consensus         5 ~~~~~~~d-----G~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~   79 (261)
T Consensus         6 ~~~~v~v~~~~v~~~ri~Y~~~G~--G~pvvllHG~~~~~~~W~~~~~~l~~~~~~~yrVIa~Dl~G~G~S~~~~~~~-~   82 (282)
T TIGR03343         6 TSKFVKINEKGLSNFRIHYNEAGN--GEAVIMLHGGGPGAGGWSNYYRNIGPFVDAGYRVILKDSPGFNKSDAVVMDE-Q   82 (282)
T ss_pred             CCCEEEECCCCCCCEEEEEEEECC--CCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC-C
T ss_conf             760499558873878999999746--8818988399987427899999779999789859997189988899876555-3


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC---CCHHH-HHHHHHHHHCCCC
Q ss_conf             2122222222222222222222234434443101333210235652389628856331---10356-9999998631111
Q gi|254780166|r   80 RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD---SDVVD-WQSLIDSFLLPSI  155 (261)
Q Consensus        80 s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~---~~~~~-~~~~~~~~~~~~~  155 (261)
T Consensus        83 ~~~~~a~~~~~lld~L~i~~~~lvG~S~GG~iA~~~A~~~P~rV~~LvL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (282)
T TIGR03343        83 RGLVNARAVKGLMDALDIEKAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSLFAPMPMEGIKLLFKLYAEPSY  162 (282)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHCHHHHHEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCH
T ss_conf             24799999999999749983799973737999999999786862478998887666212465708899999997515789


Q ss_pred             CHHHHHHH----------HHHCCCCCCCCCCCHHHHHH-----HHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--H
Q ss_conf             00001110----------00000003476654135677-----7654101220012100357606998478887880--7
Q gi|254780166|r  156 DEVQNPLG----------KKFRKFADLDPGNDLKALAS-----CLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--P  218 (261)
Q Consensus       156 ~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~  218 (261)
T Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~i~~PtLvi~G~~D~~~p~~~~  242 (282)
T TIGR03343       163 ETLKQMLNVFLFDQSLITEELLQGRWENIQRQPEHLKNFLISSQKAPLSTWDVTARLGEIKAKTLVTWGRDDRFVPLDHG  242 (282)
T ss_pred             HHHHHHHHHHCCCHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCHHHHHHCCCCCEEEEEECCCCCCCHHHH
T ss_conf             99999999853480006899999999998729788999999976401202344788721898779998378874589999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             999996799799998888738434848-999999999875
Q gi|254780166|r  219 QELMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYAN  257 (261)
Q Consensus       219 ~~l~~~~p~~~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~~  257 (261)
T Consensus       243 ~~l~~~ip~a~l~~i~~aGH~~~~E~P~~fn~~l~~FLk~  282 (282)
T TIGR03343       243 LKLLWNMPDAQLHVFSRCGHWAQWEHADAFNRLVIDFLRN  282 (282)
T ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             9999868998899989999954886499999999998486