HHsearch alignment for GI: 254780166 and conserved domain: cd00707

>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes. Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=99.04  E-value=1.6e-10  Score=81.63  Aligned_cols=114  Identities=21%  Similarity=0.294  Sum_probs=74.9

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CC
Q ss_conf             899878999987888800122179999999868989999647655422222222222212222222222222------22
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH------LG   96 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~------l~   96 (261)
T Consensus        33 n~~~pt~iiiHG~~~~~~~~~~~~~~~a~l~~~d~NVi~VDW~~~--a~~~Y~~a~~n~~~Vg~~va~~i~~L~~~~g~~  110 (275)
T cd00707          33 NPSRPTRFIIHGWTSSGEESWISDLRKAYLSRGDYNVIVVDWGRG--ANPNYPQAVNNTRVVGAELAKFLDFLVDNTGLS  110 (275)
T ss_pred             CCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             788986999898798998747999999998638938999988200--161099999979999999999999999742988


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCC
Q ss_conf             222222344344431013332102356523896288563311
Q gi|254780166|r   97 ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS  138 (261)
Q Consensus        97 ~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~  138 (261)
T Consensus       111 ~~~ihlIGhSLGAHiaG~aG~~~~~~l~rItGLDPA~P~F~~  152 (275)
T cd00707         111 LENVHLIGHSLGAHVAGFAGKRLNGKLGRITGLDPAGPLFSG  152 (275)
T ss_pred             HHCEEEEEECHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCC
T ss_conf             210589951435778778888607742626623787653468