Query         gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 261
No_of_seqs    116 out of 18398
Neff          9.9 
Searched_HMMs 39220
Date          Mon May 23 03:20:33 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780166.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR03343 biphenyl_bphD 2-hydr 100.0       0       0  293.5  16.8  250    5-257     6-282 (282)
  2 PRK00870 haloalkane dehalogena 100.0 8.4E-45       0  285.6  17.6  249    6-257    22-300 (302)
  3 TIGR03056 bchO_mg_che_rel puta 100.0 8.4E-45       0  285.5  16.9  248    4-256     6-278 (278)
  4 TIGR03611 RutD pyrimidine util 100.0 5.6E-45       0  286.8  15.8  237   16-257     1-257 (257)
  5 TIGR02427 protocat_pcaD 3-oxoa 100.0 1.4E-45       0  289.4   9.5  234   15-256     1-256 (256)
  6 PRK03592 haloalkane dehalogena 100.0 5.7E-43       0  274.5  17.2  247    4-260     8-289 (294)
  7 PRK03204 haloalkane dehalogena 100.0 1.2E-42       0  272.6  16.9  240    8-256    18-286 (286)
  8 PRK10349 carboxylesterase BioH 100.0 1.3E-42       0  272.5  16.1  231   15-257     3-255 (256)
  9 PRK10673 hypothetical protein; 100.0 1.5E-42       0  272.1  14.8  234   15-258     2-255 (255)
 10 TIGR01250 pro_imino_pep_2 prol 100.0 1.5E-37 3.9E-42  242.3  14.2  248    6-256     4-302 (302)
 11 PRK11126 acyl-CoA thioester hy 100.0 5.3E-37 1.3E-41  239.1  12.0  218   25-257     1-241 (242)
 12 KOG4178 consensus              100.0   1E-36 2.6E-41  237.4  13.4  251    6-259    24-321 (322)
 13 pfam03096 Ndr Ndr family. This 100.0 1.2E-32   3E-37  213.3  14.7  239   10-256     6-279 (285)
 14 KOG1454 consensus              100.0   5E-31 1.3E-35  203.5  14.4  231   25-259    57-325 (326)
 15 PRK05855 short chain dehydroge 100.0 1.7E-30 4.2E-35  200.4  13.7  248    4-257     3-291 (582)
 16 pfam00561 Abhydrolase_1 alpha/ 100.0 4.8E-31 1.2E-35  203.7  10.0  196   57-253     1-225 (225)
 17 PRK10749 lysophospholipase L2; 100.0 1.2E-29   3E-34  195.4  16.7  248    4-257    31-328 (330)
 18 TIGR01738 bioH putative pimelo 100.0 1.1E-30 2.7E-35  201.6   8.2  219   26-255     4-248 (248)
 19 KOG4409 consensus              100.0 5.2E-29 1.3E-33  191.5  15.5  248    6-257    68-363 (365)
 20 TIGR01249 pro_imino_pep_1 prol 100.0 2.1E-30 5.4E-35  199.8   8.0  232    6-245     7-297 (310)
 21 COG2267 PldB Lysophospholipase 100.0 2.2E-27 5.6E-32  181.9  15.7  253    4-261    10-297 (298)
 22 KOG1455 consensus               99.9 1.7E-24 4.4E-29  164.7  15.1  254    2-258    26-312 (313)
 23 KOG2382 consensus               99.9 1.3E-23 3.4E-28  159.4  13.9  239   14-258    36-313 (315)
 24 COG1647 Esterase/lipase [Gener  99.9 1.5E-23 3.8E-28  159.1  11.5  217   26-256    15-242 (243)
 25 KOG2984 consensus               99.9 1.4E-23 3.5E-28  159.3   9.9  238    9-258    26-276 (277)
 26 COG0596 MhpC Predicted hydrola  99.9   3E-22 7.8E-27  151.3  14.3  239    9-255     5-279 (282)
 27 PRK06489 hypothetical protein;  99.9   5E-22 1.3E-26  150.1  12.1  247   12-258    48-357 (358)
 28 PRK07581 hypothetical protein;  99.9 3.6E-22 9.1E-27  150.9   9.4  243   12-257    24-340 (340)
 29 PRK10985 putative hydrolase; P  99.9 4.3E-21 1.1E-25  144.5  14.1  251    4-260    32-322 (325)
 30 PRK00175 metX homoserine O-ace  99.9 3.1E-21 7.9E-26  145.3  12.5  247   12-259    30-374 (379)
 31 PRK10566 esterase; Provisional  99.9 1.2E-20 2.9E-25  141.9  13.3  217   12-259    10-249 (249)
 32 PRK06765 homoserine O-acetyltr  99.8 9.7E-21 2.5E-25  142.4  10.6  250   12-261    35-385 (387)
 33 TIGR03100 hydr1_PEP hydrolase,  99.8 2.5E-19 6.3E-24  134.0  16.1  239    6-257     4-274 (274)
 34 PRK08775 homoserine O-acetyltr  99.8 1.6E-19   4E-24  135.2  13.2  241   14-261    46-342 (343)
 35 KOG4667 consensus               99.8 1.9E-19 4.9E-24  134.7  11.3  219   24-258    31-258 (269)
 36 KOG2564 consensus               99.8 1.6E-19 4.1E-24  135.1   8.6  231   16-257    62-326 (343)
 37 COG1506 DAP2 Dipeptidyl aminop  99.8 2.3E-18 5.9E-23  128.3  14.4  229    4-260   366-618 (620)
 38 COG2021 MET2 Homoserine acetyl  99.8 3.2E-18 8.1E-23  127.4  11.1  246   11-257    33-367 (368)
 39 KOG2931 consensus               99.8 1.7E-17 4.4E-22  123.1  14.3  235   14-256    32-304 (326)
 40 pfam06342 DUF1057 Alpha/beta h  99.8 3.5E-17   9E-22  121.2  14.7  238   10-254    13-295 (297)
 41 KOG1838 consensus               99.8 4.4E-17 1.1E-21  120.6  14.8  252    4-259    94-389 (409)
 42 TIGR01392 homoserO_Ac_trn homo  99.7 1.5E-17 3.7E-22  123.5   8.4  245   10-256    12-395 (395)
 43 KOG1552 consensus               99.7 3.5E-16   9E-21  115.3  12.3  206    6-260    38-254 (258)
 44 COG0429 Predicted hydrolase of  99.7 4.4E-16 1.1E-20  114.7  12.6  251    7-260    53-342 (345)
 45 KOG4391 consensus               99.7 1.4E-15 3.7E-20  111.6  12.3  221    1-260    52-284 (300)
 46 pfam00326 Peptidase_S9 Prolyl   99.7   3E-16 7.6E-21  115.7   7.3  191   45-260     3-210 (212)
 47 pfam00975 Thioesterase Thioest  99.6 1.7E-15 4.4E-20  111.2   9.9  211   27-255     1-224 (224)
 48 TIGR01607 PST-A Plasmodium sub  99.6   1E-16 2.6E-21  118.5   2.3  243    7-257     1-379 (379)
 49 KOG2565 consensus               99.6   4E-15   1E-19  109.0   8.8  244    9-259   129-464 (469)
 50 pfam01738 DLH Dienelactone hyd  99.6 8.3E-14 2.1E-18  101.2  11.8  176   22-257    10-215 (216)
 51 pfam02230 Abhydrolase_2 Phosph  99.5 4.4E-13 1.1E-17   96.9  12.5  179   22-259     7-213 (213)
 52 pfam05448 AXE1 Acetyl xylan es  99.4 2.1E-12 5.2E-17   92.9  11.1  228    7-257    60-319 (320)
 53 PRK11460 esterase YpfH; Provis  99.4 2.1E-12 5.5E-17   92.8  11.0  170   25-260    15-210 (230)
 54 COG3208 GrsT Predicted thioest  99.4 2.1E-12 5.3E-17   92.8  10.1  215   24-256     5-234 (244)
 55 TIGR01836 PHA_synth_III_C poly  99.4 3.1E-13 7.9E-18   97.8   4.5  241    7-257    48-366 (367)
 56 KOG2624 consensus               99.4 4.2E-11 1.1E-15   85.1  15.0  256    3-259    48-399 (403)
 57 pfam08538 DUF1749 Protein of u  99.4 1.4E-11 3.7E-16   87.9  12.2  218   25-256    32-303 (303)
 58 COG0412 Dienelactone hydrolase  99.4 3.8E-11 9.8E-16   85.3  13.8  191   10-261     9-236 (236)
 59 pfam12146 Hydrolase_4 Putative  99.4 1.3E-12 3.3E-17   94.0   6.0   77   13-93      1-79  (79)
 60 PRK10252 entF enterobactin syn  99.3 1.2E-11   3E-16   88.3   9.6  221   21-255  1060-1291(1293)
 61 PRK05077 frsA fermentation/res  99.3 6.9E-11 1.8E-15   83.8  13.1  232    8-260   173-414 (414)
 62 smart00824 PKS_TE Thioesterase  99.3 1.1E-11 2.9E-16   88.5   8.8  200   30-255     1-212 (212)
 63 COG4757 Predicted alpha/beta h  99.3 2.1E-11 5.3E-16   86.9   9.8  242    9-255    11-280 (281)
 64 pfam06821 DUF1234 Alpha/Beta h  99.3 7.9E-12   2E-16   89.4   6.8  154   29-243     1-157 (171)
 65 pfam03403 PAF-AH_p_II isoform   99.3 9.3E-11 2.4E-15   83.0  11.8  176   25-260    99-353 (372)
 66 COG3458 Acetyl esterase (deace  99.2 3.2E-11 8.1E-16   85.8   8.0  210    7-240    60-301 (321)
 67 pfam06500 DUF1100 Alpha/beta h  99.2 3.3E-10 8.4E-15   79.8  12.9  228   12-259   173-410 (411)
 68 COG3243 PhaC Poly(3-hydroxyalk  99.2 3.5E-11 8.9E-16   85.6   7.7  221   25-245   106-377 (445)
 69 pfam07859 Abhydrolase_3 alpha/  99.2 2.2E-11 5.5E-16   86.8   5.7  190   29-242     1-209 (209)
 70 COG0400 Predicted esterase [Ge  99.2 6.8E-11 1.7E-15   83.9   8.1  171   21-259    13-206 (207)
 71 COG2945 Predicted hydrolase of  99.2   4E-10   1E-14   79.3  11.4  182   16-259    18-209 (210)
 72 PRK10162 acetyl esterase; Prov  99.2 1.1E-09 2.9E-14   76.6  13.2  224   15-259    71-319 (319)
 73 pfam06028 DUF915 Alpha/beta hy  99.1 2.8E-09 7.1E-14   74.3  13.2  202   24-255     4-247 (249)
 74 COG0657 Aes Esterase/lipase [L  99.1 2.2E-09 5.5E-14   74.9  12.0  214   24-258    77-310 (312)
 75 TIGR03101 hydr2_PEP hydrolase,  99.1 1.8E-10 4.7E-15   81.3   6.3  124    6-131     3-132 (266)
 76 pfam05728 UPF0227 Uncharacteri  99.1 5.4E-10 1.4E-14   78.5   8.6  183   29-255     2-186 (187)
 77 pfam02129 Peptidase_S15 X-Pro   99.1 9.6E-10 2.4E-14   77.0   9.6  118   12-132     1-129 (265)
 78 COG4188 Predicted dienelactone  99.1 4.8E-11 1.2E-15   84.7   2.7  205   25-244    70-299 (365)
 79 PRK11071 esterase YqiA; Provis  99.1 2.8E-09 7.1E-14   74.3  11.1  184   27-256     2-189 (190)
 80 KOG1515 consensus               99.0 6.4E-09 1.6E-13   72.1  12.2  221   25-258    89-335 (336)
 81 cd00707 Pancreat_lipase_like P  99.0 1.6E-10 4.1E-15   81.6   4.0  114   23-138    33-152 (275)
 82 pfam09752 DUF2048 Uncharacteri  99.0 1.1E-08 2.9E-13   70.7  11.9  218   24-255    89-335 (337)
 83 pfam03959 FSH1 Serine hydrolas  99.0 7.4E-09 1.9E-13   71.7  10.5  166   25-245     3-205 (210)
 84 COG2936 Predicted acyl esteras  98.9 8.5E-09 2.2E-13   71.4   9.8  227    5-234    21-287 (563)
 85 PRK13604 luxD acyl transferase  98.9 1.9E-08 4.8E-13   69.3  11.0  217    8-241    12-244 (305)
 86 pfam02273 Acyl_transf_2 Acyl t  98.9 1.9E-08 4.8E-13   69.3  10.9  218    7-241     6-239 (294)
 87 pfam10230 DUF2305 Uncharacteri  98.9 1.7E-08 4.4E-13   69.6  10.3  100   26-128     2-111 (260)
 88 PRK12467 peptide synthase; Pro  98.9   1E-08 2.6E-13   70.9   8.8  121   22-150  3689-3815(3951)
 89 TIGR03230 lipo_lipase lipoprot  98.9 1.8E-09 4.5E-14   75.5   4.7  113   23-137    38-158 (442)
 90 pfam08840 BAAT_C BAAT / Acyl-C  98.8 1.3E-08 3.3E-13   70.3   7.8  150   96-260    20-210 (211)
 91 pfam10503 Esterase_phd Esteras  98.8 2.1E-08 5.3E-13   69.1   8.5  110   26-137    21-142 (226)
 92 KOG2100 consensus               98.8 3.9E-08   1E-12   67.4   9.4  214   11-258   505-747 (755)
 93 pfam00151 Lipase Lipase.        98.8 2.3E-09 5.9E-14   74.7   2.4  114   23-138    68-190 (329)
 94 pfam01674 Lipase_2 Lipase (cla  98.7 6.1E-09 1.6E-13   72.2   3.5   86   26-116     1-93  (218)
 95 COG3319 Thioesterase domains o  98.7 5.3E-08 1.4E-12   66.6   8.0  100   27-134     1-104 (257)
 96 KOG2281 consensus               98.7 2.6E-07 6.7E-12   62.5  11.0  226    4-257   614-866 (867)
 97 COG3571 Predicted hydrolase of  98.7 1.9E-07 4.8E-12   63.4   9.9  164   24-240    11-182 (213)
 98 PRK07868 acyl-CoA synthetase;   98.7 4.8E-08 1.2E-12   66.9   6.8  212   25-242    66-341 (990)
 99 PRK10115 protease 2; Provision  98.7   5E-07 1.3E-11   60.9  11.6  232    4-260   417-677 (686)
100 KOG4840 consensus               98.7 2.4E-07   6E-12   62.8   9.6  229   26-261    36-292 (299)
101 pfam06057 VirJ Bacterial virul  98.7 2.4E-07 6.1E-12   62.8   9.1  180   27-258     3-191 (192)
102 pfam05990 DUF900 Alpha/beta hy  98.6 1.5E-08 3.9E-13   69.9   3.0  110   23-132    16-137 (230)
103 KOG2551 consensus               98.6 6.2E-07 1.6E-11   60.3  10.7   60  197-258   159-220 (230)
104 TIGR01838 PHA_synth_I poly(R)-  98.6 8.4E-08 2.1E-12   65.5   6.0  212   25-245   187-468 (541)
105 pfam07819 PGAP1 PGAP1-like pro  98.6 8.6E-08 2.2E-12   65.4   5.9   98   24-130     2-120 (225)
106 COG3545 Predicted esterase of   98.5 1.2E-06 3.1E-11   58.6   9.6  172   26-258     2-179 (181)
107 KOG3043 consensus               98.4 6.6E-06 1.7E-10   54.2  11.9  185   10-259    24-241 (242)
108 KOG3975 consensus               98.4 5.9E-06 1.5E-10   54.5  11.1  240    8-255     5-300 (301)
109 pfam00450 Peptidase_S10 Serine  98.4 1.1E-05 2.9E-10   52.8  11.3  120   13-132    23-179 (415)
110 COG1073 Hydrolases of the alph  98.3 1.4E-05 3.6E-10   52.2  11.3  225   24-260    47-299 (299)
111 COG1075 LipA Predicted acetylt  98.3 7.9E-07   2E-11   59.7   4.3  101   26-133    59-164 (336)
112 COG1505 Serine proteases of th  98.3 3.6E-05 9.2E-10   49.8  12.8  229    6-260   397-648 (648)
113 pfam03583 LIP Secretory lipase  98.3 5.2E-06 1.3E-10   54.8   7.9   55  201-255   220-283 (291)
114 KOG3253 consensus               98.2 2.5E-05 6.4E-10   50.8  11.1  163   25-242   175-348 (784)
115 pfam04301 DUF452 Protein of un  98.2 3.3E-05 8.3E-10   50.1  11.3  183   26-242    11-205 (213)
116 COG4814 Uncharacterized protei  98.2 1.4E-05 3.7E-10   52.2   9.3  201   24-257    43-286 (288)
117 TIGR02821 fghA_ester_D S-formy  98.2 2.4E-06 6.2E-11   56.8   5.1  103   28-131    44-172 (279)
118 COG4782 Uncharacterized protei  98.2 1.3E-06 3.3E-11   58.4   3.6  109   24-132   114-233 (377)
119 pfam07224 Chlorophyllase Chlor  98.2 2.3E-06 5.7E-11   57.0   4.9   92   25-121    45-144 (307)
120 pfam05057 DUF676 Putative seri  98.2 4.1E-06 1.1E-10   55.4   6.0   87   27-116     6-93  (212)
121 TIGR01849 PHB_depoly_PhaZ poly  98.2 2.9E-06 7.5E-11   56.3   5.1  227   26-257   109-413 (414)
122 KOG4627 consensus               98.2 8.6E-06 2.2E-10   53.5   7.2  182   18-243    58-251 (270)
123 TIGR03502 lipase_Pla1_cef extr  98.1 3.7E-06 9.3E-11   55.7   4.5  105   26-133   449-601 (792)
124 pfam02089 Palm_thioest Palmito  98.1 2.9E-05 7.5E-10   50.4   8.8  105   24-130     3-113 (279)
125 pfam12048 DUF3530 Protein of u  98.1 2.1E-05 5.2E-10   51.3   7.7  203    4-258    56-293 (294)
126 KOG3724 consensus               98.1 3.3E-06 8.4E-11   56.0   3.5  105   11-126    65-209 (973)
127 KOG2237 consensus               98.0 2.4E-05   6E-10   50.9   7.1  229    4-260   442-707 (712)
128 PRK04940 hypothetical protein;  98.0 2.9E-05 7.4E-10   50.4   7.2  175   29-255     2-177 (179)
129 PRK05371 x-prolyl-dipeptidyl a  98.0 3.2E-05 8.1E-10   50.1   7.2  210   50-259   276-523 (769)
130 KOG2112 consensus               98.0 1.4E-05 3.5E-10   52.3   5.1  174   26-257     3-203 (206)
131 COG3509 LpqC Poly(3-hydroxybut  97.9 1.4E-05 3.6E-10   52.2   4.3  121   11-133    42-179 (312)
132 KOG1553 consensus               97.9 7.9E-06   2E-10   53.7   3.0  101   26-134   243-346 (517)
133 COG0627 Predicted esterase [Ge  97.9 0.00011 2.7E-09   47.1   8.7  226   25-260    53-313 (316)
134 COG4099 Predicted peptidase [G  97.8 7.7E-05   2E-09   47.9   7.0  123    3-133   161-304 (387)
135 pfam11339 DUF3141 Protein of u  97.8 0.00022 5.6E-09   45.1   9.3  208   23-242    65-351 (581)
136 pfam00756 Esterase Putative es  97.8 3.1E-05 7.9E-10   50.2   4.5   49   84-132    93-145 (243)
137 KOG3847 consensus               97.8 8.1E-05 2.1E-09   47.7   6.5   41   26-69    118-158 (399)
138 KOG3101 consensus               97.6 0.00012 3.1E-09   46.7   5.4  128    3-131     2-174 (283)
139 pfam05705 DUF829 Eukaryotic pr  97.6 0.00047 1.2E-08   43.2   8.2  213   28-255     1-239 (239)
140 KOG1551 consensus               97.6 0.00064 1.6E-08   42.4   8.9  226   26-258   113-366 (371)
141 pfam05577 Peptidase_S28 Serine  97.6 0.00014 3.5E-09   46.4   5.2  108   22-130    25-145 (433)
142 COG1770 PtrB Protease II [Amin  97.5  0.0016   4E-08   40.1  10.3  220    4-252   420-669 (682)
143 COG3150 Predicted esterase [Ge  97.5 0.00034 8.8E-09   44.0   6.4  184   29-256     2-187 (191)
144 pfam08386 Abhydrolase_4 TAP-li  97.5 0.00029 7.5E-09   44.4   6.1   59  200-258    33-94  (103)
145 pfam10340 DUF2424 Protein of u  97.3  0.0017 4.4E-08   39.8   8.1  102   25-134   121-236 (374)
146 pfam10142 PhoPQ_related PhoPQ-  97.1  0.0028 7.1E-08   38.6   7.6  149   95-259   165-316 (360)
147 pfam02450 LACT Lecithin:choles  97.1 0.00011 2.8E-09   47.0   0.2   80   42-131    64-158 (382)
148 pfam11144 DUF2920 Protein of u  97.0  0.0022 5.7E-08   39.2   6.1  159   99-259   185-368 (403)
149 cd00312 Esterase_lipase Estera  96.9  0.0014 3.6E-08   40.4   4.7  122   10-133    75-213 (493)
150 KOG2541 consensus               96.9  0.0048 1.2E-07   37.2   7.2  103   25-133    22-129 (296)
151 pfam05677 DUF818 Chlamydia CHL  96.8  0.0053 1.3E-07   37.0   6.8   91   25-120   136-237 (364)
152 COG2819 Predicted hydrolase of  96.7   0.005 1.3E-07   37.1   5.8   52   86-137   122-176 (264)
153 KOG1202 consensus               96.6   0.019   5E-07   33.6   8.6  214   23-252  2120-2371(2376)
154 KOG4372 consensus               96.6  0.0026 6.5E-08   38.8   3.9  101   11-116    66-168 (405)
155 pfam07082 DUF1350 Protein of u  96.5   0.024   6E-07   33.1   8.5  189   28-259    19-233 (250)
156 COG2272 PnbA Carboxylesterase   96.5  0.0012 3.2E-08   40.7   1.7  123   10-134    76-218 (491)
157 pfam00135 COesterase Carboxyle  96.4  0.0025 6.4E-08   38.8   2.9  121   11-132    89-226 (517)
158 KOG2182 consensus               96.4  0.0089 2.3E-07   35.6   5.5  110   21-135    81-208 (514)
159 pfam06441 EHN Epoxide hydrolas  96.2  0.0072 1.8E-07   36.2   4.4   35    6-40     66-102 (108)
160 KOG3967 consensus               96.2   0.011 2.8E-07   35.1   5.0  107   26-132   101-226 (297)
161 COG3946 VirJ Type IV secretory  96.1  0.0053 1.3E-07   37.0   3.2  178   26-255   260-446 (456)
162 COG4553 DepA Poly-beta-hydroxy  96.0   0.051 1.3E-06   31.1   8.0  105   26-136   103-212 (415)
163 KOG2369 consensus               96.0  0.0016 4.1E-08   40.0   0.1   72   43-121   124-205 (473)
164 KOG2183 consensus               95.9  0.0047 1.2E-07   37.3   2.3  101   24-129    78-198 (492)
165 TIGR01839 PHA_synth_II poly(R)  95.9   0.048 1.2E-06   31.2   7.5  210   25-245   214-488 (560)
166 COG2382 Fes Enterochelin ester  95.7   0.016 4.1E-07   34.1   4.4  183   25-255    97-296 (299)
167 TIGR01840 esterase_phb esteras  95.7   0.011 2.7E-07   35.1   3.2  167   25-218    17-204 (231)
168 COG2830 Uncharacterized protei  95.4    0.12 3.1E-06   28.8   7.8  182   28-242    13-204 (214)
169 COG2939 Carboxypeptidase C (ca  95.2   0.021 5.4E-07   33.3   3.5   94   25-119   100-219 (498)
170 COG4947 Uncharacterized protei  95.0   0.037 9.5E-07   31.9   4.2  180   12-227    13-199 (227)
171 PRK10439 enterobactin/ferric e  94.8    0.05 1.3E-06   31.2   4.5  105   25-135   191-308 (398)
172 KOG1282 consensus               93.4    0.14 3.4E-06   28.6   4.4  116   12-132    55-212 (454)
173 KOG1516 consensus               93.3   0.052 1.3E-06   31.0   2.2  122    9-130    92-229 (545)
174 pfam05576 Peptidase_S37 PS-10   93.2    0.17 4.3E-06   28.0   4.6  103   25-132    62-169 (448)
175 KOG2521 consensus               92.9    0.65 1.7E-05   24.5   8.2  233   21-260    33-292 (350)
176 pfam01764 Lipase_3 Lipase (cla  92.6   0.014 3.6E-07   34.4  -1.6   35   85-119    50-84  (141)
177 pfam04083 Abhydro_lipase ab-hy  92.1    0.28 7.2E-06   26.7   4.5   38    4-41     13-57  (62)
178 TIGR01369 CPSaseII_lrg carbamo  92.0    0.63 1.6E-05   24.6   6.2  116   28-154   576-704 (1089)
179 pfam06850 PHB_depo_C PHB de-po  91.9   0.068 1.7E-06   30.4   1.2   63  195-257   127-201 (203)
180 cd00519 Lipase_3 Lipase (class  90.1   0.052 1.3E-06   31.1  -0.8   32   88-119   118-149 (229)
181 cd00741 Lipase Lipase.  Lipase  90.1   0.036 9.2E-07   32.0  -1.6   25   95-119    25-49  (153)
182 pfam05277 DUF726 Protein of un  88.9    0.25 6.4E-06   27.0   1.9   43   95-137   215-262 (343)
183 pfam11187 DUF2974 Protein of u  87.6    0.15 3.9E-06   28.3   0.2   44   89-133    76-123 (224)
184 pfam06259 DUF1023 Alpha/beta h  87.6    0.17 4.2E-06   28.0   0.4  114   17-134     8-144 (177)
185 KOG2029 consensus               84.2    0.14 3.5E-06   28.6  -1.5   21   98-118   526-546 (697)
186 pfam01083 Cutinase Cutinase.    83.7    0.38 9.6E-06   25.9   0.6   50   81-130    64-119 (179)
187 pfam11288 DUF3089 Protein of u  83.0    0.14 3.5E-06   28.6  -1.9   75   44-119    34-116 (201)
188 TIGR02764 spore_ybaN_pdaB poly  80.3     2.5 6.5E-05   21.0   3.8   40   82-128    18-60  (198)
189 COG1087 GalE UDP-glucose 4-epi  79.3     4.4 0.00011   19.6   4.8   94   44-138    12-125 (329)
190 KOG4388 consensus               77.4       2   5E-05   21.7   2.5   97   26-130   395-505 (880)
191 KOG4569 consensus               76.3    0.42 1.1E-05   25.6  -1.1   36   83-118   156-191 (336)
192 KOG2385 consensus               75.9     1.5 3.9E-05   22.3   1.6   43   95-137   444-491 (633)
193 pfam07519 Tannase Tannase and   75.4     5.7 0.00015   18.9   5.1   57  202-258   330-403 (451)
194 COG4287 PqaA PhoPQ-activated p  72.2     6.8 0.00017   18.4   4.8   44  197-240   325-371 (507)
195 TIGR00976 /NonD hydrolase CocE  68.7     3.7 9.4E-05   20.0   2.2  116   10-127     3-155 (663)
196 PRK13768 GTPase; Provisional    66.6     9.1 0.00023   17.7   4.3   64   28-99      3-70  (253)
197 TIGR02759 TraD_Ftype type IV c  64.4      10 0.00025   17.5   3.9   36   30-66    211-246 (613)
198 TIGR01324 cysta_beta_ly_B cyst  61.4     2.2 5.6E-05   21.4  -0.1   10  102-111   177-186 (389)
199 TIGR03131 malonate_mdcH malona  61.3     1.6   4E-05   22.2  -0.8   28   90-117    68-95  (295)
200 TIGR02193 heptsyl_trn_I lipopo  61.1      11 0.00029   17.1   3.6   39   24-62    202-244 (359)
201 TIGR01425 SRP54_euk signal rec  60.2     6.1 0.00016   18.7   2.0   55   93-152   258-316 (453)
202 PRK10279 hypothetical protein;  59.6     1.5 3.9E-05   22.3  -1.1   30   89-118    24-53  (300)
203 pfam09949 DUF2183 Uncharacteri  59.5      10 0.00026   17.4   3.1   86   42-129    10-98  (100)
204 TIGR01120 rpiB ribose 5-phosph  59.4     6.8 0.00017   18.4   2.2   71   36-118     5-75  (143)
205 TIGR02824 quinone_pig3 putativ  58.8      11 0.00028   17.2   3.1   98   29-137   147-252 (334)
206 pfam10329 DUF2417 Region of un  56.8      14 0.00035   16.7   6.4   48    6-56     71-124 (126)
207 COG0529 CysC Adenylylsulfate k  56.7      14 0.00035   16.6   5.2   62   24-90     20-83  (197)
208 pfam03976 PPK2 Polyphosphate k  56.3      13 0.00034   16.8   3.2   75   25-113    29-104 (229)
209 PRK06849 hypothetical protein;  56.3      13 0.00033   16.8   3.2   69   25-98      2-78  (387)
210 TIGR01748 rhaA L-rhamnose isom  55.6     6.8 0.00017   18.4   1.6   38  205-243   226-264 (415)
211 PRK10751 molybdopterin-guanine  54.2      15 0.00038   16.4   4.8   43   27-70      2-44  (170)
212 PRK05294 carB carbamoyl phosph  53.8      15 0.00039   16.4   6.2   79   36-119   567-648 (1063)
213 pfam00698 Acyl_transf_1 Acyl t  53.8     3.8 9.8E-05   19.9   0.1   29   89-117    74-102 (319)
214 pfam11713 Peptidase_C80 Peptid  53.6     2.4 6.1E-05   21.1  -1.0   51   60-110    58-117 (160)
215 KOG1387 consensus               53.3     8.1 0.00021   18.0   1.7   33   88-120   117-150 (465)
216 TIGR00137 gid gid protein; Int  52.1      16 0.00042   16.2   4.3   63  192-255   257-338 (444)
217 PRK12815 carB carbamoyl phosph  50.4      17 0.00044   16.0   7.2  101   26-133   554-661 (1068)
218 KOG1209 consensus               50.1      18 0.00045   16.0   4.2   38   24-65      4-41  (289)
219 cd07227 Pat_Fungal_NTE1 Fungal  49.6     2.9 7.4E-05   20.7  -1.1   32   88-119    28-59  (269)
220 COG3933 Transcriptional antite  49.4      16  0.0004   16.3   2.7   73   27-115   110-182 (470)
221 smart00827 PKS_AT Acyl transfe  49.2     2.9 7.4E-05   20.6  -1.1   28   89-116    73-100 (298)
222 cd07225 Pat_PNPLA6_PNPLA7 Pata  49.2     2.9 7.4E-05   20.7  -1.1   62   44-119     3-64  (306)
223 pfam03205 MobB Molybdopterin g  48.6      19 0.00047   15.9   4.2   43   28-71      1-43  (122)
224 pfam06309 Torsin Torsin. This   48.2      19 0.00048   15.8   3.0   34   22-56     48-81  (127)
225 COG4822 CbiK Cobalamin biosynt  47.2      19  0.0005   15.7   4.8   53  202-259   199-257 (265)
226 pfam09994 DUF2235 Uncharacteri  46.8      20  0.0005   15.7   3.4   92   27-118     2-103 (261)
227 pfam05724 TPMT Thiopurine S-me  45.8      20 0.00052   15.6   3.3   31   27-65     23-53  (203)
228 PRK12490 6-phosphogluconate de  45.7      21 0.00052   15.6   4.0   22   44-65     11-32  (298)
229 PRK00143 trmU tRNA (5-methylam  43.7      14 0.00036   16.6   1.7   36   26-68      5-40  (355)
230 COG5153 CVT17 Putative lipase   43.3     6.1 0.00016   18.7  -0.2   22   98-119   276-297 (425)
231 KOG4540 consensus               43.3     6.1 0.00016   18.7  -0.2   22   98-119   276-297 (425)
232 PRK07659 enoyl-CoA hydratase;   43.2      22 0.00057   15.4   4.9  112    1-119     1-122 (260)
233 pfam05707 Zot Zonular occluden  43.2      23 0.00057   15.4   4.7   37   29-67      2-39  (183)
234 KOG1283 consensus               40.3     6.6 0.00017   18.5  -0.4  116    6-124     6-148 (414)
235 COG1752 RssA Predicted esteras  40.1     5.3 0.00014   19.1  -0.9   10   47-56     28-37  (306)
236 PRK11705 cyclopropane fatty ac  39.4     6.6 0.00017   18.5  -0.5   40   88-128   156-198 (383)
237 CHL00197 carA carbamoyl-phosph  39.2      13 0.00034   16.7   1.0   37    1-37      1-41  (383)
238 TIGR01368 CPSaseIIsmall carbam  37.9      16 0.00042   16.2   1.3   31    7-37      2-34  (383)
239 pfam03283 PAE Pectinacetyleste  37.2      28 0.00072   14.8   4.3   21   97-117   155-175 (366)
240 TIGR00313 cobQ cobyric acid sy  36.8      22 0.00056   15.4   1.8   68   50-128   117-192 (502)
241 PRK05541 adenylylsulfate kinas  36.8      28 0.00072   14.8   4.8   39   25-64      5-43  (176)
242 PRK09599 6-phosphogluconate de  36.4      29 0.00074   14.7   4.2   22   44-65     11-32  (301)
243 PRK13512 coenzyme A disulfide   36.4      25 0.00064   15.1   2.1   43   90-135   141-183 (438)
244 TIGR03453 partition_RepA plasm  35.9      29 0.00075   14.7   5.0   44   25-69    102-146 (387)
245 TIGR03385 CoA_CoA_reduc CoA-di  35.4      30 0.00076   14.6   2.3   48   86-136   123-173 (427)
246 PRK11613 folP dihydropteroate   34.6      31 0.00079   14.5   2.5   45   46-95     41-85  (282)
247 PRK13869 plasmid-partitioning   34.0      32 0.00081   14.5   5.0   44   25-69    119-163 (405)
248 PRK12838 carbamoyl phosphate s  33.8      20 0.00052   15.6   1.2   32    6-37      3-36  (356)
249 PRK03846 adenylylsulfate kinas  33.2      32 0.00083   14.4   4.7   40   24-64     21-60  (198)
250 COG5083 SMP2 Uncharacterized p  33.2      33 0.00083   14.4   6.3   15   22-36     55-69  (580)
251 PRK13255 thiopurine S-methyltr  33.2      33 0.00083   14.4   3.2   31   27-65     38-68  (218)
252 cd03818 GT1_ExpC_like This fam  32.9      33 0.00084   14.4   4.5   32   29-65      2-33  (396)
253 TIGR02873 spore_ylxY probable   32.7      33 0.00085   14.4   2.4   26  198-223   197-223 (269)
254 cd05312 NAD_bind_1_malic_enz N  32.5      33 0.00085   14.3   3.4   88   27-117    26-125 (279)
255 PHA02519 plasmid partition pro  32.3      34 0.00086   14.3   4.9   41   27-68    106-148 (387)
256 cd01523 RHOD_Lact_B Member of   32.0      34 0.00087   14.3   3.6   13   54-66     11-23  (100)
257 pfam00070 Pyr_redox Pyridine n  31.5      35 0.00089   14.2   2.9   33  100-135     2-34  (82)
258 PRK10416 cell division protein  31.2      35  0.0009   14.2   5.7   98   24-138   292-392 (499)
259 COG4850 Uncharacterized conser  31.2      12 0.00031   16.9  -0.2   17  221-237   271-287 (373)
260 pfam05973 Gp49 Phage derived p  30.7      36 0.00092   14.2   3.2   21   12-35     52-72  (92)
261 PRK06851 hypothetical protein;  30.4      36 0.00093   14.1   3.3   61    1-62      1-65  (368)
262 TIGR00176 mobB molybdopterin-g  30.2      37 0.00093   14.1   3.3   38   31-69      3-40  (165)
263 COG1856 Uncharacterized homolo  30.1      26 0.00066   15.0   1.3   77   48-130   102-187 (275)
264 TIGR01350 lipoamide_DH dihydro  29.8      37 0.00095   14.1   3.2   59   98-159   179-239 (481)
265 COG0482 TrmU Predicted tRNA(5-  29.7      35  0.0009   14.2   1.9   37   26-69      4-40  (356)
266 cd00739 DHPS DHPS subgroup of   29.6      37 0.00096   14.0   3.2   18  195-212   192-209 (257)
267 TIGR02683 upstrm_HI1419 probab  29.4      38 0.00096   14.0   2.9   28    4-35     49-76  (95)
268 pfam02353 CMAS Cyclopropane-fa  29.1      13 0.00032   16.9  -0.5   43   85-128    48-93  (273)
269 pfam08237 PE-PPE PE-PPE domain  28.8      16 0.00042   16.2   0.1   22   97-118    46-67  (227)
270 TIGR00455 apsK adenylylsulfate  28.5      39   0.001   13.9   5.0   61   23-88     15-77  (187)
271 cd01444 GlpE_ST GlpE sulfurtra  27.7      41   0.001   13.8   2.9   17   50-66      8-24  (96)
272 cd01998 tRNA_Me_trans tRNA met  27.6      31 0.00079   14.5   1.3   20   49-68     16-35  (349)
273 KOG1264 consensus               27.5      41   0.001   13.8   3.6   13  106-118   813-825 (1267)
274 TIGR02884 spore_pdaA delta-lac  27.5      36 0.00093   14.1   1.7   66   48-127    18-86  (225)
275 pfam01583 APS_kinase Adenylyls  26.7      42  0.0011   13.7   4.6   39   26-65      1-39  (157)
276 TIGR01179 galE UDP-glucose 4-e  25.4      45  0.0011   13.6   3.5  102   30-139     2-135 (341)
277 PRK13705 plasmid-partitioning   25.3      45  0.0011   13.6   5.7   43   25-68    104-148 (388)
278 COG2230 Cfa Cyclopropane fatty  25.3      17 0.00043   16.1  -0.4   42   86-128    59-103 (283)
279 cd07210 Pat_hypo_W_succinogene  25.0      12 0.00032   16.9  -1.1   29   91-119    21-49  (221)
280 TIGR00064 ftsY signal recognit  24.8      46  0.0012   13.5   4.4  111   23-151    78-194 (284)
281 KOG2872 consensus               24.4      47  0.0012   13.5   3.1   51  198-250   288-348 (359)
282 PRK10037 cell division protein  24.3      47  0.0012   13.5   4.4   38   28-65      2-39  (250)
283 TIGR01007 eps_fam capsular exo  24.2      47  0.0012   13.5   3.9  115   11-146     3-119 (207)
284 PRK07854 enoyl-CoA hydratase;   24.1      47  0.0012   13.4   2.2   74   46-119    33-110 (243)
285 PRK10964 ADP-heptose:LPS hepto  24.0      47  0.0012   13.4   4.9   51  198-255   269-320 (322)
286 PRK12564 carbamoyl phosphate s  23.9      48  0.0012   13.4   3.3   32    6-37      5-38  (355)
287 cd01534 4RHOD_Repeat_3 Member   22.9      50  0.0013   13.3   3.5   20   50-69      7-27  (95)
288 PRK13753 dihydropteroate synth  22.7      50  0.0013   13.3   2.5   14  199-212   200-213 (279)
289 pfam08433 KTI12 Chromatin asso  22.5      51  0.0013   13.3   4.1   36   29-65      1-36  (266)
290 cd07207 Pat_ExoU_VipD_like Exo  22.3      15 0.00039   16.4  -1.1   25   95-119    24-48  (194)
291 PRK13700 conjugal transfer pro  21.9      52  0.0013   13.2   4.3   40   26-66    184-223 (732)
292 pfam03054 tRNA_Me_trans tRNA m  21.9      42  0.0011   13.7   1.1   20   49-68     17-36  (354)
293 PRK00162 glpE thiosulfate sulf  21.2      54  0.0014   13.1   3.4   18   49-67     12-29  (104)
294 TIGR03371 cellulose_yhjQ cellu  21.1      54  0.0014   13.1   4.9   42   28-70      3-44  (246)
295 KOG1532 consensus               21.0      55  0.0014   13.1   2.6   44   20-64     12-55  (366)
296 cd02970 PRX_like2 Peroxiredoxi  20.4      56  0.0014   13.0   3.9   54    9-63      8-64  (149)
297 cd03116 MobB Molybdenum is an   20.1      57  0.0015   13.0   4.9   42   28-70      2-43  (159)
298 TIGR02114 coaB_strep phosphopa  20.0      57  0.0015   12.9   2.7   61   43-107    27-91  (253)

No 1  
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Probab=100.00  E-value=0  Score=293.52  Aligned_cols=250  Identities=21%  Similarity=0.289  Sum_probs=171.4

Q ss_pred             EEEEEECC-----CCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             07999349-----9499999964899878999987888800122179999999868989999647655422222222222
Q gi|254780166|r    5 VKFFRSWR-----KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY   79 (261)
Q Consensus         5 ~~~~~~~d-----G~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~   79 (261)
                      ++=|++.+     |.+|||.+.|+  ++||||+||++++...|..|...+..+++++||||++|+||||.|+.+.... +
T Consensus         6 ~~~~v~v~~~~v~~~ri~Y~~~G~--G~pvvllHG~~~~~~~W~~~~~~l~~~~~~~yrVIa~Dl~G~G~S~~~~~~~-~   82 (282)
T TIGR03343         6 TSKFVKINEKGLSNFRIHYNEAGN--GEAVIMLHGGGPGAGGWSNYYRNIGPFVDAGYRVILKDSPGFNKSDAVVMDE-Q   82 (282)
T ss_pred             CCCEEEECCCCCCCEEEEEEEECC--CCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC-C
T ss_conf             760499558873878999999746--8818988399987427899999779999789859997189988899876555-3


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC---CCHHH-HHHHHHHHHCCCC
Q ss_conf             2122222222222222222222234434443101333210235652389628856331---10356-9999998631111
Q gi|254780166|r   80 RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD---SDVVD-WQSLIDSFLLPSI  155 (261)
Q Consensus        80 s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~---~~~~~-~~~~~~~~~~~~~  155 (261)
                      .....++++.++++++++++++|+||||||.+|+.+|.+||++|++||++++......   +.... ..........+..
T Consensus        83 ~~~~~a~~~~~lld~L~i~~~~lvG~S~GG~iA~~~A~~~P~rV~~LvL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (282)
T TIGR03343        83 RGLVNARAVKGLMDALDIEKAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSLFAPMPMEGIKLLFKLYAEPSY  162 (282)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHCHHHHHEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCH
T ss_conf             24799999999999749983799973737999999999786862478998887666212465708899999997515789


Q ss_pred             CHHHHHHH----------HHHCCCCCCCCCCCHHHHHH-----HHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--H
Q ss_conf             00001110----------00000003476654135677-----7654101220012100357606998478887880--7
Q gi|254780166|r  156 DEVQNPLG----------KKFRKFADLDPGNDLKALAS-----CLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--P  218 (261)
Q Consensus       156 ~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~  218 (261)
                      +.....+.          ..............+..+..     ........+..+.+.+|++|||+++|++|.++|.  .
T Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~i~~PtLvi~G~~D~~~p~~~~  242 (282)
T TIGR03343       163 ETLKQMLNVFLFDQSLITEELLQGRWENIQRQPEHLKNFLISSQKAPLSTWDVTARLGEIKAKTLVTWGRDDRFVPLDHG  242 (282)
T ss_pred             HHHHHHHHHHCCCHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCHHHHHHCCCCCEEEEEECCCCCCCHHHH
T ss_conf             99999999853480006899999999998729788999999976401202344788721898779998378874589999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             999996799799998888738434848-999999999875
Q gi|254780166|r  219 QELMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYAN  257 (261)
Q Consensus       219 ~~l~~~~p~~~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~~  257 (261)
                      +++++.+|++++++++++||++++|+| +|++.|++||++
T Consensus       243 ~~l~~~ip~a~l~~i~~aGH~~~~E~P~~fn~~l~~FLk~  282 (282)
T TIGR03343       243 LKLLWNMPDAQLHVFSRCGHWAQWEHADAFNRLVIDFLRN  282 (282)
T ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             9999868998899989999954886499999999998486


No 2  
>PRK00870 haloalkane dehalogenase; Provisional
Probab=100.00  E-value=8.4e-45  Score=285.59  Aligned_cols=249  Identities=22%  Similarity=0.292  Sum_probs=172.6

Q ss_pred             EEEEECCC----CEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             79993499----49999996489987899998788880012217999999986898999964765542222222222221
Q gi|254780166|r    6 KFFRSWRK----YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL   81 (261)
Q Consensus         6 ~~~~~~dG----~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~   81 (261)
                      .|..+.++    .+|||.+.|++++|+|||||||+++.   +.|..+++.|+++|||||++|+||||.|++|....+|++
T Consensus        22 ~~~~~~~~~~~~lr~hY~e~G~~~GppvvLlHG~p~~~---~~Wr~~i~~La~~GyRVIapDlrG~G~SdkP~~~~~Yt~   98 (302)
T PRK00870         22 HYVDVDDGDGGPLRMHYVDEGPADGEPVLLLHGEPSWS---YLYRKMIPILAAAGHRVIAPDLIGFGRSDKPTRREDYTY   98 (302)
T ss_pred             CEEEECCCCCCEEEEEEEECCCCCCCEEEEECCCCCCH---HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCH
T ss_conf             04883477776378999853789998899989999987---899999999986899899936899899999998788799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC-CCHHHHHHHHHHHH-CCCC--CH
Q ss_conf             22222222222222222222234434443101333210235652389628856331-10356999999863-1111--00
Q gi|254780166|r   82 VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD-SDVVDWQSLIDSFL-LPSI--DE  157 (261)
Q Consensus        82 ~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~-~~~~~~~~~~~~~~-~~~~--~~  157 (261)
                      +.+++|+.++++++++++++|+||||||.+++.+|.++|++|++||++++...... .....+........ .+..  ..
T Consensus        99 ~~~a~~l~~lld~Lgl~~~~LVGhs~GG~vA~~~A~~~PerV~~LVl~~~~~p~~~~~~~~~~~~~~~~~~~~p~~~~~~  178 (302)
T PRK00870         99 ARHVEWMRSWFEQLDLTGVTLVCQDWGGLIGLRLAAEHPDRFARLVVANTGLPTGDGPMPDAFWAWRAFSQESPVLPVGR  178 (302)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHCHHHHCEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHH
T ss_conf             99999999999984998579999731608999999969787148999888776665545189999999986283014999


Q ss_pred             H-----HHHHHHH-HCCCCCCCCCCCHHHHHHHHHHH-----------CCCCCHHHHHCCCCCEEEEEECCCCCCCC-HH
Q ss_conf             0-----0111000-00000347665413567776541-----------01220012100357606998478887880-79
Q gi|254780166|r  158 V-----QNPLGKK-FRKFADLDPGNDLKALASCLSMI-----------RKPFCQDDLYRIDVPVLIAVGSQDDLAGS-PQ  219 (261)
Q Consensus       158 ~-----~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~~l~~i~~P~l~i~G~~D~~~~~-~~  219 (261)
                      .     ...+... ...+....+......-...+...           ......+.+.++++|+|+++|++|.+.+. .+
T Consensus       179 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~P~Lvi~G~~D~~~~~~~~  258 (302)
T PRK00870        179 LVNGGTVRDLSDAVRAAYDAPFPDESYKAGARAFPLLVPTSPDDPAVAANRAAWEVLERWDKPFLTAFSDSDPITGGGDA  258 (302)
T ss_pred             HHHCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHH
T ss_conf             97424434489999987407898678999999878755578433357988999998723799879998278876652679


Q ss_pred             HHHHHCCCCE---EEEECCCCCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             9999679979---9998888738434848-999999999875
Q gi|254780166|r  220 ELMSFIPSSQ---YLNICRRDHLLAVGDK-QFKQGVVNFYAN  257 (261)
Q Consensus       220 ~l~~~~p~~~---~~~i~~~gH~~~~e~p-~~~~~i~~Fl~~  257 (261)
                      .+.+.+|+++   .++|+++||+++.|+| ++++.|++||++
T Consensus       259 ~~~~~ip~a~~~~~~~i~~aGH~~~~E~Pe~~~~~i~~FLr~  300 (302)
T PRK00870        259 ILQKRIPGAAGQPHTTIKGGGHFLQEDSGEELAEAIVSFIRA  300 (302)
T ss_pred             HHHHHCCCCCCCCEEEECCCCCCHHHCCHHHHHHHHHHHHHH
T ss_conf             999967888788658979998805875999999999999975


No 3  
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein. Members of this family belong to the alpha/beta fold family hydrolases (pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity.
Probab=100.00  E-value=8.4e-45  Score=285.47  Aligned_cols=248  Identities=21%  Similarity=0.250  Sum_probs=178.1

Q ss_pred             CEEEEEECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             40799934994999999648998789999878888001221799999998689899996476554222222222222122
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF   83 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~   83 (261)
                      +.+=|++.+|.++||.+.|++++|+|||+||++++..   .|..+++.|++ +|+||++|+||||.|+.+. ...|+++.
T Consensus         6 ~~s~~v~v~g~~~hy~~~G~~~gp~lvllHG~~~~~~---~w~~~~~~L~~-~~rvi~~Dl~G~G~S~~p~-~~~~~~~~   80 (278)
T TIGR03056         6 DCSRRVTVGPFHWHVQDMGPTAGPLLLLLHGTGASTH---SWRDLMPPLAR-SFRVVAPDLPGHGFTRAPF-RFRFTLPS   80 (278)
T ss_pred             CCCEEEEECCEEEEEEEECCCCCCEEEEECCCCCCHH---HHHHHHHHHHC-CCEEEEEECCCCCCCCCCC-CCCCCHHH
T ss_conf             7666999899899998558899983899899987688---99999999846-9989999679988889998-89999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHC--CCCCHH---
Q ss_conf             222222222222222222234434443101333210235652389628856331103569999998631--111000---
Q gi|254780166|r   84 MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLL--PSIDEV---  158 (261)
Q Consensus        84 ~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~---  158 (261)
                      +++|+.++++++++++++|+||||||.+++.+|..+|+++++||++++.....+...............  +.....   
T Consensus        81 ~a~dl~~ll~~l~i~~~~lvGhS~Gg~vA~~~A~~~P~~v~~lv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (278)
T TIGR03056        81 MAEDLSALCAAEGLSPDGVIGHSAGAAIALRLALDGPVTPRMVVGINAALMPFEGMAGTLFPYMARVLACNPFTPPMMSR  160 (278)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             99999998986299865999454179999999996875255899976666774210123448899887637222688876


Q ss_pred             ----HHHHHHHHCCCCCCCC----------CCCHH---HHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HH
Q ss_conf             ----0111000000003476----------65413---56777654101220012100357606998478887880--79
Q gi|254780166|r  159 ----QNPLGKKFRKFADLDP----------GNDLK---ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQ  219 (261)
Q Consensus       159 ----~~~~~~~~~~~~~~~~----------~~~~~---~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~  219 (261)
                          .......+........          .....   .....+..+......+.++++++|||+++|++|.++++  .+
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~lvi~G~~D~~~~~~~~~  240 (278)
T TIGR03056       161 GAADQQRVERLIRDTGSLLDKAGMTYYGRLIRSPAHVDGALSMMAQWDLAPLNRDLPRITIPLHLIAGEEDKAVPPDESK  240 (278)
T ss_pred             HHCCHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHCCHHHHHHHHHCCCCEEEEEECCCCCCCHHHHH
T ss_conf             30128999999852111136789999999854966678999999840113788778757898899985789997999999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHHHH
Q ss_conf             99996799799998888738434848-99999999987
Q gi|254780166|r  220 ELMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYA  256 (261)
Q Consensus       220 ~l~~~~p~~~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~  256 (261)
                      ++++.+|++++++++++||++++|+| ++++.|++||.
T Consensus       241 ~l~~~~p~a~~~~i~~aGH~~~~E~Pe~v~~~i~~fle  278 (278)
T TIGR03056       241 RAATRVPTATLHVVPGGGHLVHEEQADGVVGLILQAAE  278 (278)
T ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             99986899889998999850689759999999999859


No 4  
>TIGR03611 RutD pyrimidine utilization protein D. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the hydrolase, alpha/beta fold family defined by pfam00067.
Probab=100.00  E-value=5.6e-45  Score=286.78  Aligned_cols=237  Identities=23%  Similarity=0.340  Sum_probs=177.4

Q ss_pred             EEEEEECCC--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999996489--987899998788880012217999999986898999964765542222222222221222222222222
Q gi|254780166|r   16 FAFYDVGDK--DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLE   93 (261)
Q Consensus        16 l~y~~~g~~--~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~   93 (261)
                      |||...|++  ++|+|||+||++++..   .|..+++.|+++ |+||++|+||||.|+.+. ..+|+++++++|+.++++
T Consensus         1 ~~y~~~g~~~~~~P~lvllHG~~~~~~---~w~~~~~~L~~~-~rvi~~Dl~G~G~S~~~~-~~~ys~~~~a~dl~~~l~   75 (257)
T TIGR03611         1 MHYELHGPPDADAPTVVLSSGLGGSGS---YWAPQLDVLTQR-FHVVTYDHRGTGRSPEEL-PPGYSIAHMADDVLQLLD   75 (257)
T ss_pred             CEEEEECCCCCCCCEEEEECCCCCCHH---HHHHHHHHHHCC-CEEEEECCCCCCCCCCCC-CCCCCHHHHHHHHHHHHH
T ss_conf             979995899999995999799866888---999999998269-869997899999999999-999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHH----------HH
Q ss_conf             22222222234434443101333210235652389628856331103569999998631111000011----------10
Q gi|254780166|r   94 HLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP----------LG  163 (261)
Q Consensus        94 ~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~  163 (261)
                      ++++++++|+||||||++++.+|.++|++|++||++++.....+.....+..................          ..
T Consensus        76 ~l~~~~~~lvG~S~Gg~va~~~a~~~P~~V~~lil~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (257)
T TIGR03611        76 ALGIERFHFVGHALGGLIGLQLALRYPERLLSLVLINAWSRPDPHTRRCFDVRIALLQHAGPEAYVHAQALFLYPADWIS  155 (257)
T ss_pred             HCCCCCCEEEEECCCHHHHHHHHHHCHHHEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCHHHHH
T ss_conf             76998726998477289999999969565408889888666883566678999999983277889987677516745442


Q ss_pred             HHHCCCC-----CCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEECCC
Q ss_conf             0000000-----34766541356777654101220012100357606998478887880--7999996799799998888
Q gi|254780166|r  164 KKFRKFA-----DLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNICRR  236 (261)
Q Consensus       164 ~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~~  236 (261)
                      .......     ..........+...+......+....+++|++|||+++|++|.+++.  .+++.+.+|++++++++++
T Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~i~~P~Lii~G~~D~~~p~~~~~~~~~~ip~~~~~~i~~~  235 (257)
T TIGR03611       156 ENAARLAADEAHALAHFPGKANVLRRINALEAFDVSARLDRIQHPVLLIANRDDMLVPYTQSLRLAAALPNAQLKLLPYG  235 (257)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEEECCC
T ss_conf             30467768999998737768899999998862584888854899779996268876899999999987899889998999


Q ss_pred             CCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             738434848-999999999875
Q gi|254780166|r  237 DHLLAVGDK-QFKQGVVNFYAN  257 (261)
Q Consensus       237 gH~~~~e~p-~~~~~i~~Fl~~  257 (261)
                      ||++++|+| ++++.+.+||++
T Consensus       236 GH~~~~e~P~~~~~~l~~FLks  257 (257)
T TIGR03611       236 GHASNVTDPETFNRALLDFLKT  257 (257)
T ss_pred             CCCHHHHCHHHHHHHHHHHHCC
T ss_conf             9710786999999999999675


No 5  
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase; InterPro: IPR012790    These proteins are 3-oxoadipate enol-lactonases (also called beta-ketoadipate enol-lactone hydrolase), which catalyse the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate can all be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this entry were chosen from within protocatechuate degradation operons of at least three genes of the pathway, and from genomes with the complete pathway through beta-ketoadipate.; GO: 0047570 3-oxoadipate enol-lactonase activity, 0019614 catechol catabolic process.
Probab=100.00  E-value=1.4e-45  Score=289.37  Aligned_cols=234  Identities=25%  Similarity=0.460  Sum_probs=207.6

Q ss_pred             EEEEEEE-CCC-CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCC
Q ss_conf             9999996-489-9878999987888800122179999999868989999647655422--22222222221222222222
Q gi|254780166|r   15 QFAFYDV-GDK-DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS--DKSYIENDYRLVFMAADAVS   90 (261)
Q Consensus        15 ~l~y~~~-g~~-~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S--~~~~~~~~~s~~~~~~di~~   90 (261)
                      +|||... |+. ++|++||+...|++..   +|+++++.|.. +|+|+.||.||||.|  +-+  +.+||+++.++|+.+
T Consensus         1 ~LHy~~~~G~~~~~P~Lvf~NSLGTDl~---~Wd~v~~~L~~-~f~~lryD~RGHG~Srad~~--~~pYsi~dLa~Dv~a   74 (256)
T TIGR02427         1 RLHYRLDDGAAAGAPVLVFINSLGTDLR---MWDPVLPALTA-DFRVLRYDKRGHGLSRADVP--EGPYSIEDLADDVLA   74 (256)
T ss_pred             CEEEEEECCCCCCCCEEEECCCHHCCHH---HHHHHHHHCCC-CCEEEEEECCCCCCCCCCCC--CCCCCHHHHHHHHHH
T ss_conf             9023320477888867887174104465---56899862027-91799885088987557788--888678778999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCC--CCHHHHHHHH----
Q ss_conf             2222222222223443444310133321023565238962885633110356999999863111--1000011100----
Q gi|254780166|r   91 LLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPS--IDEVQNPLGK----  164 (261)
Q Consensus        91 ~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~----  164 (261)
                      ++|.+++++++++|-|+||+|++.+++++||||++|||+++...+..+  .-|+.+++.....+  +..+.+..++    
T Consensus        75 LlD~l~i~~a~~cGLS~GGliaq~La~~~pdrV~~lvl~nTAakIG~~--~~W~~Ri~~v~~~Gqal~al~Dav~~RWFt  152 (256)
T TIGR02427        75 LLDHLGIEKAVFCGLSLGGLIAQGLAARRPDRVRALVLSNTAAKIGTP--ESWNARIAAVRAEGQALAALADAVLERWFT  152 (256)
T ss_pred             HHHHHHHHHHEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--CCHHHHHHHHHHCCCHHHHHHHHHCCCCCC
T ss_conf             987872524112443378899999862006777798876224315797--504899999997172346777421112368


Q ss_pred             -HH--------CCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCCEEEEE
Q ss_conf             -00--------0000347665413567776541012200121003576069984788878807--999996799799998
Q gi|254780166|r  165 -KF--------RKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNI  233 (261)
Q Consensus       165 -~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~~~~i  233 (261)
                       .|        ..+.+.....+..+|..++.+.+..|+++++++|.+|||+|.|++|..+||.  ++++..+|++++.+|
T Consensus       153 ~~F~~~~~~~~~~~~~Ml~~q~~~GYag~CaAirdaDf~~~~~~I~VPtL~iaG~~D~sTPP~~~r~iA~~vpGa~~~~i  232 (256)
T TIGR02427       153 PGFREAHPARLDLYRNMLVRQPPDGYAGCCAAIRDADFRDRLGAIAVPTLVIAGDEDGSTPPELVREIADLVPGARFAEI  232 (256)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             55532108999999999860898687899999960688877621444414763677888986789999973699716877


Q ss_pred             CCCCCCCCCCCHH-HHHHHHHHHH
Q ss_conf             8887384348489-9999999987
Q gi|254780166|r  234 CRRDHLLAVGDKQ-FKQGVVNFYA  256 (261)
Q Consensus       234 ~~~gH~~~~e~p~-~~~~i~~Fl~  256 (261)
                      +++||.+.+|+|+ |++.+..||.
T Consensus       233 ~~agHlp~~E~P~A~~~~l~~FL~  256 (256)
T TIGR02427       233 RGAGHLPCVEQPEAFNAALRDFLR  256 (256)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             788888850465899999999709


No 6  
>PRK03592 haloalkane dehalogenase; Provisional
Probab=100.00  E-value=5.7e-43  Score=274.54  Aligned_cols=247  Identities=17%  Similarity=0.192  Sum_probs=172.1

Q ss_pred             CEEEEEECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             40799934994999999648998789999878888001221799999998689899996476554222222222222122
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF   83 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~   83 (261)
                      +|+|.. .||.+|||.+.|+  +||||||||++++..   .|..+++.|+++ |+||++|+||||.|++|  ..+|++++
T Consensus         8 ~~~~v~-v~G~~l~y~~~G~--G~plvllHG~~~~~~---~W~~~~~~L~~~-~rvia~Dl~G~G~S~~p--~~~y~~~~   78 (294)
T PRK03592          8 EMKRVE-ILGSRMAYIETGQ--GDPIVFLHGNPTSSY---LWRNIIPHLAGL-GRCLAPDLIGMGASDKP--DIDYTFAD   78 (294)
T ss_pred             CCCEEE-ECCEEEEEEEECC--CCEEEEECCCCCCHH---HHHHHHHHHHHC-CEEEEECCCCCCCCCCC--CCCCCHHH
T ss_conf             787599-9998999999846--880899899998789---999999998309-88999738999988899--99888999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCC-C-HHHHHHHHHHHHCCCCCHH---
Q ss_conf             2222222222222222222344344431013332102356523896288563311-0-3569999998631111000---
Q gi|254780166|r   84 MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS-D-VVDWQSLIDSFLLPSIDEV---  158 (261)
Q Consensus        84 ~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~-~-~~~~~~~~~~~~~~~~~~~---  158 (261)
                      +++|+.++++++++++++|+||||||.+++.+|.++|++|++||++++....... . ..........+..+.....   
T Consensus        79 ~a~dl~~ll~~Lg~~~~~lvGhS~Gg~va~~~A~~~P~rv~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (294)
T PRK03592         79 HRRYLDAFFDALDLRNVVLVLHDWGSALGFDWARRHPDRVRGIAFMEAIVRPMTWADFPPAVRELFRALRSPGAGERMVL  158 (294)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHCCHHHHHHHHHHHCCCCCHHHHH
T ss_conf             99999999997699987999868884999999996843346268971567875534307789999999648772067887


Q ss_pred             ------HHHHHH---------HHCCCCC-CCCCCCHHHHHHHHHHH-----------CCCCCHHHHHCCCCCEEEEEECC
Q ss_conf             ------011100---------0000003-47665413567776541-----------01220012100357606998478
Q gi|254780166|r  159 ------QNPLGK---------KFRKFAD-LDPGNDLKALASCLSMI-----------RKPFCQDDLYRIDVPVLIAVGSQ  211 (261)
Q Consensus       159 ------~~~~~~---------~~~~~~~-~~~~~~~~~~~~~~~~~-----------~~~~~~~~l~~i~~P~l~i~G~~  211 (261)
                            ...+..         .+..+.. ...........++....           ...+....+.++++|+|+++|++
T Consensus       159 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~P~L~i~G~~  238 (294)
T PRK03592        159 EQNVFVEKVLPGSILRKLSDEEMAVYRRPFPTPESRRPTLSWPRELPIDGEPADVVALIEEYAQWLSASDQPKLLINAEP  238 (294)
T ss_pred             HHHHHHHHHCHHHHCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             66578987540432035899999998700488677899999998563368805789999999998743799879997078


Q ss_pred             CCCCCC--HHHHHHHCCCCEEEEECCCCCCCCCCCHH-HHHHHHHHHHHHCC
Q ss_conf             887880--79999967997999988887384348489-99999999875168
Q gi|254780166|r  212 DDLAGS--PQELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYANELR  260 (261)
Q Consensus       212 D~~~~~--~~~l~~~~p~~~~~~i~~~gH~~~~e~p~-~~~~i~~Fl~~~~~  260 (261)
                      |.++++  .+++++.+|++++++++++||+++.|+|+ +++.|.+||.+ ++
T Consensus       239 d~~~~~~~~~~~~~~~p~~~~~~i~~aGH~~~~E~Pe~v~~~i~~FL~~-l~  289 (294)
T PRK03592        239 GAILTTGRIRDFARSWPNQTEITVPGGLHFLQEDSPDEIGAAIAAWLRR-LR  289 (294)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEECCCCCCHHHCCHHHHHHHHHHHHHH-CH
T ss_conf             8766999999999868998799989982222752999999999999974-65


No 7  
>PRK03204 haloalkane dehalogenase; Provisional
Probab=100.00  E-value=1.2e-42  Score=272.61  Aligned_cols=240  Identities=20%  Similarity=0.280  Sum_probs=163.2

Q ss_pred             EEECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99349949999996489987899998788880012217999999986898999964765542222222222221222222
Q gi|254780166|r    8 FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD   87 (261)
Q Consensus         8 ~~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~d   87 (261)
                      |...+|.+|||.+.|+  +|+|||+||++++..   .|..+++.|+++ ||||++|+||||.|++|.. .+|+++.+++|
T Consensus        18 ~~~~~g~rlhY~~~G~--GppvvLlHG~~~~~~---~w~~~~~~La~~-~rVIa~Dl~G~G~S~~P~~-~~y~~~~~a~~   90 (286)
T PRK03204         18 WFDSSRGRIHYVDEGT--GPPILLCHGNPTWSF---LYRDIIVALRDR-FRCVAPDYLGFGLSERPSG-FGYQIDEHARV   90 (286)
T ss_pred             EEEECCCEEEEEEECC--CCEEEEECCCCCCHH---HHHHHHHHHHCC-CEEEEECCCCCCCCCCCCC-CCCCHHHHHHH
T ss_conf             5986991899999745--876999899997677---999999998319-6899970899898889998-88689999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCH-HHHHHHHHH----------------H
Q ss_conf             22222222222222234434443101333210235652389628856331103-569999998----------------6
Q gi|254780166|r   88 AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV-VDWQSLIDS----------------F  150 (261)
Q Consensus        88 i~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~-~~~~~~~~~----------------~  150 (261)
                      +.++++++++++++++||||||.+++.+|.++|++|++||++++......... ..+......                +
T Consensus        91 l~~lld~Lgl~~~~lvGhs~GG~va~~~A~~~P~rV~~Lvl~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  170 (286)
T PRK03204         91 IGEFVDHLGLDRYLSMGQDWGGPISMAVAVERADRVRGVVLGNTWFWPADTLAMKAFSRVMSSPPVQYAILRRNFFVERL  170 (286)
T ss_pred             HHHHHHHHCCCCEEEEEECCCHHHHHHHHHHCCHHHEEEEEECCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             99999974899749999737789999999969354005899657668762356789999860656789998565689987


Q ss_pred             HCCCCC-HHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCC--C---CCHHHH--HCCCCCEEEEEECCCCCCCC---HH
Q ss_conf             311110-0001110000000034766541356777654101--2---200121--00357606998478887880---79
Q gi|254780166|r  151 LLPSID-EVQNPLGKKFRKFADLDPGNDLKALASCLSMIRK--P---FCQDDL--YRIDVPVLIAVGSQDDLAGS---PQ  219 (261)
Q Consensus       151 ~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~l--~~i~~P~l~i~G~~D~~~~~---~~  219 (261)
                      ...... .........++....  .................  .   .....+  ...++|||+++|++|....+   .+
T Consensus       171 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PtLviwG~~D~~~~p~~~~~  248 (286)
T PRK03204        171 IPAGTEHRPSSAVMAHYRAVQP--NAAARRGVAEMPKQILAARPLLARLAREVPATLGTKPTLLIWGMKDVAFRPKTIIP  248 (286)
T ss_pred             HHHHCCCCCCHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHH
T ss_conf             5510245886999999861078--85778999996888874357899998865765389997999938998789389999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHHHH
Q ss_conf             99996799799998888738434848-99999999987
Q gi|254780166|r  220 ELMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYA  256 (261)
Q Consensus       220 ~l~~~~p~~~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~  256 (261)
                      ++.+.+|++++++++++||+++.|+| +++++|++||.
T Consensus       249 ~~~~~~p~a~lv~ip~aGH~~~~E~Pe~va~aIleffG  286 (286)
T PRK03204        249 RLSATFPDHVLVELPNAKHFIQEDAPDRIAAAIIERFG  286 (286)
T ss_pred             HHHHHCCCCEEEEECCCCCCHHHCCHHHHHHHHHHHCC
T ss_conf             99997899789997999862787599999999998658


No 8  
>PRK10349 carboxylesterase BioH; Provisional
Probab=100.00  E-value=1.3e-42  Score=272.49  Aligned_cols=231  Identities=19%  Similarity=0.265  Sum_probs=164.3

Q ss_pred             EEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999964899878999987888800122179999999868989999647655422222222222212222222222222
Q gi|254780166|r   15 QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH   94 (261)
Q Consensus        15 ~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~   94 (261)
                      +|+|...|++ .+||||+||++++..   .|..+++.|+++ |+||++|+||||+|+..   ..++++++++++..    
T Consensus         3 ~i~Y~~~G~G-~~plvllHG~g~~~~---~W~~~~~~L~~~-~rvi~~DlpG~G~S~~~---~~~~~~~~a~~l~~----   70 (256)
T PRK10349          3 NIWWQTKGQG-NVHLVLLHGWGLNAE---VWRCIDEELSSH-FTLHLVDLPGFGRSRGF---GALSLADMAEAVLK----   70 (256)
T ss_pred             CEEEEEECCC-CCCEEEECCCCCCHH---HHHHHHHHHHCC-CEEEEECCCCCCCCCCC---CCCCHHHHHHHHHH----
T ss_conf             6699966128-997799899987878---999999997347-77999579888889998---84589999999997----


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCH-----HH------------HHHHHHHHHC-CCC-
Q ss_conf             2222222234434443101333210235652389628856331103-----56------------9999998631-111-
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV-----VD------------WQSLIDSFLL-PSI-  155 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~-----~~------------~~~~~~~~~~-~~~-  155 (261)
                      ...++++++||||||++++.+|.+||++|++||++++.+.......     ..            +++....+.. ... 
T Consensus        71 ~~~~~~~lvG~SmGG~iA~~~A~~~P~rV~~Lvlv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  150 (256)
T PRK10349         71 QAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMG  150 (256)
T ss_pred             HCCCCEEEEEECHHHHHHHHHHHHCCHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             38767379998961899999999795555424155777444455455544699999999998888999999998765316


Q ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEE
Q ss_conf             00001110000000034766541356777654101220012100357606998478887880--7999996799799998
Q gi|254780166|r  156 DEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNI  233 (261)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i  233 (261)
                      ........+.++......+......+...+......+.++.+++|++|||+++|++|.++|+  .+.+++.+|+++++++
T Consensus       151 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~d~~~~L~~i~~PtLvi~G~~D~~vp~~~~~~l~~~ip~a~l~ii  230 (256)
T PRK10349        151 TETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIF  230 (256)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             33457899999999980778879999999999980645878731899979998389988799999999986899889997


Q ss_pred             CCCCCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             888738434848-999999999875
Q gi|254780166|r  234 CRRDHLLAVGDK-QFKQGVVNFYAN  257 (261)
Q Consensus       234 ~~~gH~~~~e~p-~~~~~i~~Fl~~  257 (261)
                      +++||++++|+| +|++.+++|+.+
T Consensus       231 ~~~GH~p~~E~P~~f~~~ll~Fl~r  255 (256)
T PRK10349        231 AKAAHAPFISHPAEFCHLLVALKQR  255 (256)
T ss_pred             CCCCCCHHHHCHHHHHHHHHHHHHH
T ss_conf             9999832543999999999999970


No 9  
>PRK10673 hypothetical protein; Provisional
Probab=100.00  E-value=1.5e-42  Score=272.06  Aligned_cols=234  Identities=16%  Similarity=0.240  Sum_probs=163.2

Q ss_pred             EEEEEEE---CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9999996---4899878999987888800122179999999868989999647655422222222222212222222222
Q gi|254780166|r   15 QFAFYDV---GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSL   91 (261)
Q Consensus        15 ~l~y~~~---g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~   91 (261)
                      +|+|+..   |+.+++||||+||++++..   .|..+++.|++ .|+||++|+||||.|+.+.   .++.+++++|+.++
T Consensus         2 ~~~~~~~~~~~P~~~~PlvllHG~~~~~~---~w~~~~~~L~~-~~rVia~DlrGhG~S~~~~---~~~~~~~a~dl~~l   74 (255)
T PRK10673          2 KLNIRAQTAQNPHNNSPIVLVHGLFGSLD---NLGVLARDLVN-DHNIIQVDMRNHGLSPRDP---VMDYPAMAQDLLDT   74 (255)
T ss_pred             EEEEEECCCCCCCCCCCEEEECCCCCCHH---HHHHHHHHHHC-CCCEEEEECCCCCCCCCCC---CCCHHHHHHHHHHH
T ss_conf             01676247889998997788898555988---99999999835-9958998289999997988---78999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHH-HHHHHHHHHHCCCCCHHHH---HHHHH--
Q ss_conf             22222222222344344431013332102356523896288563311035-6999999863111100001---11000--
Q gi|254780166|r   92 LEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV-DWQSLIDSFLLPSIDEVQN---PLGKK--  165 (261)
Q Consensus        92 i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~---~~~~~--  165 (261)
                      ++++++++++|+||||||.+++.+|.++|++|++||++++.|........ ...................   .....  
T Consensus        75 ld~lgi~~~~lvGhSmGG~va~~~A~~~P~rV~~Lvlid~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (255)
T PRK10673         75 LDALQIDKATFIGHSMGGKAVMALTALAPDRIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDATTRQQAAAIMRQHLN  154 (255)
T ss_pred             HHHHCCCCEEEEEECHHHHHHHHHHHHCCHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCC
T ss_conf             99839996478526604899999998561114678998258765341105899999997544125359999999998537


Q ss_pred             --------HCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEECC
Q ss_conf             --------0000034766541356777654101220012100357606998478887880--799999679979999888
Q gi|254780166|r  166 --------FRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNICR  235 (261)
Q Consensus       166 --------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~  235 (261)
                              .+.+.+.....+..   ..+.........+.+.++++|||+|+|++|.+++.  .+++++.+|++++++|++
T Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~---~l~~~~~~~~~~~~l~~~~~P~L~i~G~~d~~~~~~~~~~l~~~~P~a~~~~i~~  231 (255)
T PRK10673        155 EEGVIQFLLKSFVDGEWRFNVP---VLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFPQARAHVIAG  231 (255)
T ss_pred             CHHHHHHHHHHHHCCHHHCCHH---HHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEECC
T ss_conf             1789999998512411331849---9998788752630026778885999507899889999999998789978999799


Q ss_pred             CCCCCCCCCHH-HHHHHHHHHHHH
Q ss_conf             87384348489-999999998751
Q gi|254780166|r  236 RDHLLAVGDKQ-FKQGVVNFYANE  258 (261)
Q Consensus       236 ~gH~~~~e~p~-~~~~i~~Fl~~~  258 (261)
                      +||+++.|+|+ +++.|.+||.|+
T Consensus       232 aGH~~~~E~P~~~~~~i~~FL~~k  255 (255)
T PRK10673        232 AGHWVHAEKPDAVLRAIRRYLNDK  255 (255)
T ss_pred             CCCCCHHHCHHHHHHHHHHHHCCC
T ss_conf             999027879999999999987769


No 10 
>TIGR01250 pro_imino_pep_2 proline-specific peptidases; InterPro: IPR005945   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of serine peptidase belong to MEROPS peptidase family S33 (clan SC). They are proline iminopeptidase (Prolyl aminopeptidase, 3.4.11.5 from EC), which catalyzes the removal of the N-terminal proline from peptides. This family represents one of two related families of proline iminopeptidase containing the alpha/beta fold. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.    One of the members of this family is the tricorn protease (TRI) interacting factor 1 from Thermoplasma acidophilum. Factor 1 (F1) is a 33.5 kDa serine peptidase of the alpha/beta-hydrolase family. Tricorn generates small peptides, which are cleaved by F1 to yield single amino acids , . ; GO: 0016804 prolyl aminopeptidase activity, 0005737 cytoplasm.
Probab=100.00  E-value=1.5e-37  Score=242.26  Aligned_cols=248  Identities=19%  Similarity=0.257  Sum_probs=184.0

Q ss_pred             EEEEECCCCEEEEEEECCCC-CCEEEEECCCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCCCCCCCCCCCCC------C
Q ss_conf             79993499499999964899-87899998788880012217999999986-8989999647655422222222------2
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVGDKD-APTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIE------N   77 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g~~~-~~~vv~iHG~~~~~~~~~~~~~~~~~l~~-~g~~vi~~D~~G~G~S~~~~~~------~   77 (261)
                      .-+.+.+|....|...++++ +++||++||.+|+.+.  .|..+-+.+.+ .|+.|+.||+.|+|.|+.|.+.      .
T Consensus         4 e~~~~~~Gg~~~~~~~~~~g~~~~Ll~lHGGPG~~H~--Yl~~l~~~~~~~~G~~V~~YDQLGcg~Sd~Pd~s~PE~~~k   81 (302)
T TIGR01250         4 EGIITVDGGYVLFTKTGGEGEKIKLLVLHGGPGSSHE--YLENLKELLKEDLGREVIMYDQLGCGYSDQPDDSDPEIAEK   81 (302)
T ss_pred             CEEEEECCCEEEEEEECCCCCCCEEEEEECCCCCCHH--HHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             2057206868999873178989218997088988742--37999999764078279998324577778588877312345


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCHHHHHHHC-CCCCCCEEEECCCCCCCCCCHHHHHHHH-HHHHCC
Q ss_conf             2221222222222222222222--22234434443101333210-2356523896288563311035699999-986311
Q gi|254780166|r   78 DYRLVFMAADAVSLLEHLGISK--VHVMGYSMGARIACSMVLFY-PSYVRSVILGGVGSVLYDSDVVDWQSLI-DSFLLP  153 (261)
Q Consensus        78 ~~s~~~~~~di~~~i~~l~~~~--~~liGhS~Gg~ia~~~a~~~-p~~v~~lvl~~~~~~~~~~~~~~~~~~~-~~~~~~  153 (261)
                      -++++.+|+.+++|.++|++++  ++|+||||||++|+.||.+| |+-++|||+.++...+...... ..+.. +.+...
T Consensus        82 l~t~d~fV~E~e~vR~~L~l~~~nfyllG~SWGG~LA~~Yal~Yh~~~lkglI~ss~~~s~pey~~~-~~r~~~~~Lp~~  160 (302)
T TIGR01250        82 LWTIDYFVDELEEVREKLGLDKKNFYLLGHSWGGLLAQEYALKYHGQHLKGLIISSMLDSAPEYVKE-LNRLRDKKLPPE  160 (302)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHH-HHHHHHHCCCHH
T ss_conf             4200023899999999855786527897026789999999997378982699985565672478999-998776328998


Q ss_pred             CCCHHHHHHH------HH----HCCCC----------------CCCCCCC-HHHHHH--------HHH--HHCCCCCHHH
Q ss_conf             1100001110------00----00000----------------3476654-135677--------765--4101220012
Q gi|254780166|r  154 SIDEVQNPLG------KK----FRKFA----------------DLDPGND-LKALAS--------CLS--MIRKPFCQDD  196 (261)
Q Consensus       154 ~~~~~~~~~~------~~----~~~~~----------------~~~~~~~-~~~~~~--------~~~--~~~~~~~~~~  196 (261)
                      ..+.+.+-..      ..    .+.+.                ....... ...|..        ...  .++++|++++
T Consensus       161 ~~~~i~~~E~~g~~~~~~Y~~~v~~~~~~~~~~~~~~~P~~l~~~~~~~~n~~vY~~m~GpnEF~~~Gda~L~dWD~~D~  240 (302)
T TIGR01250       161 VREAIKRCEASGDYDDPEYQEAVEVFYYQHLICRLRKWPEALKRLKSGMRNTEVYNIMQGPNEFTITGDANLKDWDITDK  240 (302)
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHCCCHHHHHHHHCCCCCCEEECCCEEEECCHHCC
T ss_conf             99999997426898898999999862201242046775478999873155036677442895653513643430201031


Q ss_pred             HHCCCCCEEEEEECCCCCCCC-HHHHHHHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHHHH
Q ss_conf             100357606998478887880-7999996799799998888738434848-99999999987
Q gi|254780166|r  197 LYRIDVPVLIAVGSQDDLAGS-PQELMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYA  256 (261)
Q Consensus       197 l~~i~~P~l~i~G~~D~~~~~-~~~l~~~~p~~~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~  256 (261)
                      |++|++|||++.|+.|.++|. ++.+...++++|+++.|++||+.|+|.| .+.+.+.+||.
T Consensus       241 L~~I~vPTLlt~G~~D~~~p~~~~~m~~~i~~Srl~~f~~g~H~~m~e~~~~y~~~l~~Fl~  302 (302)
T TIGR01250       241 LSEIKVPTLLTVGEFDTMTPEAAREMQELIAKSRLVVFPDGSHMTMIEEPEVYFKLLSDFLR  302 (302)
T ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             54358760033420465788999999876078738984788513753483889999998709


No 11 
>PRK11126 acyl-CoA thioester hydrolase YfbB; Provisional
Probab=100.00  E-value=5.3e-37  Score=239.08  Aligned_cols=218  Identities=19%  Similarity=0.207  Sum_probs=151.2

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98789999878888001221799999998689899996476554222222222222122222222222222222222234
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMG  104 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liG  104 (261)
                      +.|+|||+||++++..   .|..+++.| + +|+||++|+||||+|...   ..++++++++++.++++.+++++++|+|
T Consensus         1 G~P~lVflHG~~~~~~---~W~~~~~~L-~-~~~via~DlpGhG~S~~~---~~~~~~~~a~~l~~~l~~l~~~~~~LvG   72 (242)
T PRK11126          1 GLPWLVFLHGLLGSGQ---DWQPVGEAL-P-DYPRLYIDLPGHGGSAAI---SVDGFADVSQLLSQTLVSYNILPFWLVG   72 (242)
T ss_pred             CCCEEEEECCCCCCHH---HHHHHHHHC-C-CCCEEEEECCCCCCCCCC---CCCCHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             9987999388777979---999999977-9-993799879798999898---9999999999999999985999759998


Q ss_pred             CCCCCCCHHHHHHHCCC-CCCCEEEECCCCCCCCCCHHHHHH-----HHHHHHCCCCCHHHHHHHHHHCC--CCC-----
Q ss_conf             43444310133321023-565238962885633110356999-----99986311110000111000000--003-----
Q gi|254780166|r  105 YSMGARIACSMVLFYPS-YVRSVILGGVGSVLYDSDVVDWQS-----LIDSFLLPSIDEVQNPLGKKFRK--FAD-----  171 (261)
Q Consensus       105 hS~Gg~ia~~~a~~~p~-~v~~lvl~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~--~~~-----  171 (261)
                      |||||.+|+.+|.++|+ .+++++++++.+.+..........     ....+......   ..+.+++..  +..     
T Consensus        73 hSmGG~vAl~~A~~~~~~~~~~lil~~~~~gl~~~~~~~~r~~~~~~~a~~~~~~~~~---~~l~~~~~~~~f~~l~~~~  149 (242)
T PRK11126         73 YSLGGRIAMYYACQGQLPGLCGLIVEGGNPGLQNAEERQARWQSDRQWAQRFRQEPLE---QVLADWYQQPVFASLNAEQ  149 (242)
T ss_pred             ECHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHH---HHHHHHHHHHHCCCCCHHH
T ss_conf             6779999999997459700256674268868799899999997069999999863099---9999998714115799999


Q ss_pred             ------CCCCCCHHHHHHHHH---HHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCC
Q ss_conf             ------476654135677765---41012200121003576069984788878807999996799799998888738434
Q gi|254780166|r  172 ------LDPGNDLKALASCLS---MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV  242 (261)
Q Consensus       172 ------~~~~~~~~~~~~~~~---~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~~~~~~i~~~gH~~~~  242 (261)
                            ....+....+...+.   ...+.+..+.++++++|+|+|+|++|...   +++++.. ++++++||++||++++
T Consensus       150 ~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~P~L~i~Ge~D~~~---~~la~~~-~~~~~~ip~aGH~~~~  225 (242)
T PRK11126        150 RQQLVAKRSNNNGAAVAAMLEATSLAKQPDLLPALQALTFPFYYLCGERDSKF---RALAQES-ALPLHVIPRAGHNAHR  225 (242)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHCCCCEEEEECCCCHHH---HHHHHHC-CCCEEEECCCCCCHHH
T ss_conf             99999998723679999999974321288779999748999799980897588---9999976-9998897999991288


Q ss_pred             CCHH-HHHHHHHHHHH
Q ss_conf             8489-99999999875
Q gi|254780166|r  243 GDKQ-FKQGVVNFYAN  257 (261)
Q Consensus       243 e~p~-~~~~i~~Fl~~  257 (261)
                      |+|+ |++.|.+||++
T Consensus       226 E~P~~f~~~i~~FL~~  241 (242)
T PRK11126        226 ENPAAFAASLAQILRL  241 (242)
T ss_pred             HCHHHHHHHHHHHHHH
T ss_conf             7999999999999710


No 12 
>KOG4178 consensus
Probab=100.00  E-value=1e-36  Score=237.37  Aligned_cols=251  Identities=24%  Similarity=0.333  Sum_probs=181.9

Q ss_pred             EEEEECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             79993499499999964899878999987888800122179999999868989999647655422222222222212222
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA   85 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~   85 (261)
                      ..+.+++|.++||.+.|.+++|.|+|+|||+-+   ++.|..+++.|+.+||+|+++|+||+|+|+.|.....||+..++
T Consensus        24 hk~~~~~gI~~h~~e~g~~~gP~illlHGfPe~---wyswr~q~~~la~~~~rviA~DlrGyG~Sd~P~~~~~Yt~~~l~  100 (322)
T KOG4178          24 HKFVTYKGIRLHYVEGGPGDGPIVLLLHGFPES---WYSWRHQIPGLASRGYRVIAPDLRGYGFSDAPPHISEYTIDELV  100 (322)
T ss_pred             EEEEEECCEEEEEEEECCCCCCEEEEECCCCCC---CHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCEEHHHHH
T ss_conf             246997678999884047899879998069850---04366540466406448996378888888899972301299999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHH--------------H--------
Q ss_conf             222222222222222223443444310133321023565238962885633110356--------------9--------
Q gi|254780166|r   86 ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD--------------W--------  143 (261)
Q Consensus        86 ~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~--------------~--------  143 (261)
                      +|+..+++.++.++++++||+||+++|+.+|..+|++++++|.+++..........+              +        
T Consensus       101 ~di~~lld~Lg~~k~~lvgHDwGaivaw~la~~~Perv~~lv~~nv~~~~p~~~~~~~~~~~f~~~~y~~~fQ~~~~~E~  180 (322)
T KOG4178         101 GDIVALLDHLGLKKAFLVGHDWGAIVAWRLALFYPERVDGLVTLNVPFPNPKLKPLDSSKAIFGKSYYICLFQEPGKPET  180 (322)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHCHHHCCEEEEECCCCCCCCCCHHHHHCCCCCCCCEEEECCCCCCCCH
T ss_conf             89999998736133688952532499999998684233447980468878544411210243675402563125677301


Q ss_pred             -------HHHHHHHHCCCCC---HHH-------HHHHH-HHCCCCCCCCCCCHHHHHHHHHHHCCC--CCHHHHHCCCCC
Q ss_conf             -------9999986311110---000-------11100-000000347665413567776541012--200121003576
Q gi|254780166|r  144 -------QSLIDSFLLPSID---EVQ-------NPLGK-KFRKFADLDPGNDLKALASCLSMIRKP--FCQDDLYRIDVP  203 (261)
Q Consensus       144 -------~~~~~~~~~~~~~---~~~-------~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~l~~i~~P  203 (261)
                             +.....+......   ...       .+.++ ..+.+..........+..++.+.+...  .....+.+|++|
T Consensus       181 ~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~t~edi~~~~~~f~~~g~~gplNyyrn~~r~w~a~~~~~~~i~iP  260 (322)
T KOG4178         181 ELSKDDTEMLVKTFRTRKTPGPLIVPKQPNENPLWLTEEDIAFYVSKFQIDGFTGPLNYYRNFRRNWEAAPWALAKITIP  260 (322)
T ss_pred             HHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCHHCCCCCCCCCCC
T ss_conf             21100257767764203567744457777876100017789988630544330355406677764813204645201042


Q ss_pred             EEEEEECCCCCCCCH---HHHHHHCCCC-EEEEECCCCCCCCCCCH-HHHHHHHHHHHHHC
Q ss_conf             069984788878807---9999967997-99998888738434848-99999999987516
Q gi|254780166|r  204 VLIAVGSQDDLAGSP---QELMSFIPSS-QYLNICRRDHLLAVGDK-QFKQGVVNFYANEL  259 (261)
Q Consensus       204 ~l~i~G~~D~~~~~~---~~l~~~~p~~-~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~~~~  259 (261)
                      +++++|+.|.+.+.+   +.+.+.+|+. +.++++++||+++.|+| ++++.+++|+++-.
T Consensus       261 v~fi~G~~D~v~~~p~~~~~~rk~vp~l~~~vv~~~~gH~vqqe~p~~v~~~i~~f~~~~~  321 (322)
T KOG4178         261 VLFIWGDLDPVLPYPIFGELYRKDVPRLTERVVIEGIGHFVQQEKPQEVNQAILGFINSFS  321 (322)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             6999854754646066778999860134105896587654021387999999999998624


No 13 
>pfam03096 Ndr Ndr family. This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3. Their similarity was previously noted. The precise molecular and cellular function of members of this family is still unknown. Yet, they are known to be involved in cellular differentiation events. The Ndr1 group was the first to be discovered. Their expression is repressed by the proto-oncogenes N-myc and c-myc, and in line with this observation, Ndr1 protein expression is down-regulated in neoplastic cells, and is reactivated when differentiation is induced by chemicals such as retinoic acid. Ndr2 and Ndr3 expression is not under the control of N-myc or c-myc. Ndr1 expression is also activated by several chemicals: tunicamycin and homocysteine induce Ndr1 in human umbilical endothelial cells; nickel induces Ndr1 in several cell types. Members of this family are found in wide variety of multicellular eukaryotes, including an Ndr1 type protein in Helianthus annuus (su
Probab=100.00  E-value=1.2e-32  Score=213.27  Aligned_cols=239  Identities=20%  Similarity=0.242  Sum_probs=164.4

Q ss_pred             ECCCCEEEEEEECCCC--CCEEEEECCCCCCCHHHHHHHH-----HHHHHHHCCCEEEEECCCCCCCCCCCCCC-CCC-C
Q ss_conf             3499499999964899--8789999878888001221799-----99999868989999647655422222222-222-2
Q gi|254780166|r   10 SWRKYQFAFYDVGDKD--APTILLIHGLASSVQTNWLFSG-----WIQLLCDQGFRVIAFDNLGHGKSDKSYIE-NDY-R   80 (261)
Q Consensus        10 ~~dG~~l~y~~~g~~~--~~~vv~iHG~~~~~~~~~~~~~-----~~~~l~~~g~~vi~~D~~G~G~S~~~~~~-~~~-s   80 (261)
                      |..| .+++.-.|+++  +|++|.+|+.|.++.+  +|.+     .+..|.+ .|+|+.+|+||||+++.+.+. ..| |
T Consensus         6 t~~G-~~~v~v~g~~~~~kp~~~t~hdlg~n~~s--~f~~~f~~~~~~~l~~-~f~v~~iD~pGh~~ga~~~~~~~~~ps   81 (285)
T pfam03096         6 TPCG-SVHVTVYGDPEGKKPPILTYHDLGLNHKS--CFQGLFNSESMQEILE-NFCIYHVDAPGQEDGAASFPGGYPYPS   81 (285)
T ss_pred             CCCC-EEEEEEEECCCCCCCEEEEECCCCCCHHH--HHHHHHCCHHHHHHHH-CCEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             7985-18999980678998879985776546287--7565306576899874-267999628987789998998888878


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHH--HHH-HHHCCCC-C
Q ss_conf             12222222222222222222223443444310133321023565238962885633110356999--999-8631111-0
Q gi|254780166|r   81 LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQS--LID-SFLLPSI-D  156 (261)
Q Consensus        81 ~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~--~~~-~~~~~~~-~  156 (261)
                      ++++++++.++++++++++++++|+|+||+|+.++|.+||+++.+|||+++.+..  +.+.+|..  ... .+...++ .
T Consensus        82 ~~~la~~l~~vld~l~i~~~~~~G~s~G~~i~~~fA~~~p~rv~~LvLi~~~~~~--~~w~Ew~~~k~~~~~L~~~Gmt~  159 (285)
T pfam03096        82 MDDLADMLPVVLDHFRLKSVIGMGVGAGAYILARFALKHPERVEGLVLINPTPKA--AGWIEWFYNKLSSKLLYYYGMTD  159 (285)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHCHHHEEEEEEECCCCCC--CCHHHHHHHHHHHHHHHHCCCHH
T ss_conf             9999999999999719876999843678899999998696761057996578777--67789999999887776546437


Q ss_pred             HHHHHH----------------HHHHCCCCCCCCCCCHHHHHHHHHH-HCCCCCHHHHH--CCCCCEEEEEECCCCCCCC
Q ss_conf             000111----------------0000000034766541356777654-10122001210--0357606998478887880
Q gi|254780166|r  157 EVQNPL----------------GKKFRKFADLDPGNDLKALASCLSM-IRKPFCQDDLY--RIDVPVLIAVGSQDDLAGS  217 (261)
Q Consensus       157 ~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~--~i~~P~l~i~G~~D~~~~~  217 (261)
                      ...+.+                ...+|+....  ..++..+..++.+ ..+.+.....+  .++||+|+++|++|+.++.
T Consensus       160 ~~~d~ll~h~Fg~~~~~~n~div~~~R~~l~~--~~n~~nl~~fl~a~~~R~dl~~~~~~~~~~cpvLlv~Gd~sp~~~~  237 (285)
T pfam03096       160 SAKDYLLAHYFGKEELSNNSDIVQEYRKFLKE--RLNPKNLQLYLEAYNSRRDLTIERPGLEEVCPVLLVVGDNSPHVDA  237 (285)
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHH--CCCHHHHHHHHHHHHCCCCCHHHHCCCCCCCCEEEEECCCCCCHHH
T ss_conf             89999998765766445887999999999985--4498999999999847776602204468776669996378820778


Q ss_pred             HHHHHHHC--CCCEEEEECCCCCCCCCCCHH-HHHHHHHHHH
Q ss_conf             79999967--997999988887384348489-9999999987
Q gi|254780166|r  218 PQELMSFI--PSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYA  256 (261)
Q Consensus       218 ~~~l~~~~--p~~~~~~i~~~gH~~~~e~p~-~~~~i~~Fl~  256 (261)
                      ...+...+  .+++++.++++||+++.|+|+ +++.+..||+
T Consensus       238 ~v~~~~~ld~~~stllki~dcG~mv~~EqP~k~~e~i~~FLq  279 (285)
T pfam03096       238 VVECNTKLDPTKTTLLKVADCGGLVQQEQPGKLTESFKLFLQ  279 (285)
T ss_pred             HHHHHHHCCCCCCEEEEECCCCCCHHHCCCHHHHHHHHHHHH
T ss_conf             999986028432259995677886110380999999999985


No 14 
>KOG1454 consensus
Probab=99.97  E-value=5e-31  Score=203.54  Aligned_cols=231  Identities=24%  Similarity=0.297  Sum_probs=161.4

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCC-CEEEEECCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98789999878888001221799999998689-899996476554-2222222222221222222222222222222222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQG-FRVIAFDNLGHG-KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHV  102 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g-~~vi~~D~~G~G-~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~l  102 (261)
                      ++|+||++|||+++..   .|..+++.|.++. ++|+++|++||| .|..+. ...|+..++++.+..++.....+++++
T Consensus        57 ~~~pvlllHGF~~~~~---~w~~~~~~L~~~~~~~v~aiDl~G~g~~s~~~~-~~~y~~~~~v~~i~~~~~~~~~~~~~l  132 (326)
T KOG1454          57 DKPPVLLLHGFGASSF---SWRRVVPLLSKAKGLRVLAIDLPGHGYSSPLPR-GPLYTLRELVELIRRFVKEVFVEPVSL  132 (326)
T ss_pred             CCCCEEEECCCCCCCH---HHHHHCCCCHHHCCEEEEEEECCCCCCCCCCCC-CCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             8997899626557704---464431533133481899997167887788888-987578999999999986322772389


Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCEE---EECCCCCCCCCCHHHHHHHHHHHHCCCC----CHHHHHHHHH----HC----
Q ss_conf             3443444310133321023565238---9628856331103569999998631111----0000111000----00----
Q gi|254780166|r  103 MGYSMGARIACSMVLFYPSYVRSVI---LGGVGSVLYDSDVVDWQSLIDSFLLPSI----DEVQNPLGKK----FR----  167 (261)
Q Consensus       103 iGhS~Gg~ia~~~a~~~p~~v~~lv---l~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~----~~----  167 (261)
                      +|||+||.+|+.+|+.+|+.|++||   +.++.....+.........+..+.....    .....+....    ..    
T Consensus       133 vghS~Gg~va~~~Aa~~P~~V~~lv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~  212 (326)
T KOG1454         133 VGHSLGGIVALKAAAYYPETVDSLVLLDLLGPPVYSTPKGIKGLRRLLDKFLSALELLIPLSLTEPVRLVSEGLLRCLKV  212 (326)
T ss_pred             EEECHHHHHHHHHHHHCHHHHHHHHHHHEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHEE
T ss_conf             85670889999999867465055642210056655666305677777764421555247631101678979876422000


Q ss_pred             ----------CCCCCC-----CCCCHHHHHHHHHHHCC--CCCHHHHHCCC-CCEEEEEECCCCCCCC--HHHHHHHCCC
Q ss_conf             ----------000347-----66541356777654101--22001210035-7606998478887880--7999996799
Q gi|254780166|r  168 ----------KFADLD-----PGNDLKALASCLSMIRK--PFCQDDLYRID-VPVLIAVGSQDDLAGS--PQELMSFIPS  227 (261)
Q Consensus       168 ----------~~~~~~-----~~~~~~~~~~~~~~~~~--~~~~~~l~~i~-~P~l~i~G~~D~~~~~--~~~l~~~~p~  227 (261)
                                ......     .........+.+.....  ......+.++. +|+|+++|+.|++++.  ++.+.+.+||
T Consensus       213 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~pvlii~G~~D~~~p~~~~~~~~~~~pn  292 (326)
T KOG1454         213 VYTDPSRLLEKLLHLLSRPVKEHFHRDARLSLFLELLGFDENLLSLIKKIWKCPVLIIWGDKDQIVPLELAEELKKKLPN  292 (326)
T ss_pred             CCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             14676534544146514654442168889999870255303478752533687559998477872488999999853889


Q ss_pred             CEEEEECCCCCCCCCCCHH-HHHHHHHHHHHHC
Q ss_conf             7999988887384348489-9999999987516
Q gi|254780166|r  228 SQYLNICRRDHLLAVGDKQ-FKQGVVNFYANEL  259 (261)
Q Consensus       228 ~~~~~i~~~gH~~~~e~p~-~~~~i~~Fl~~~~  259 (261)
                      +++++|+++||.+++|.|+ ++..+..|+++..
T Consensus       293 ~~~~~I~~~gH~~h~e~Pe~~~~~i~~Fi~~~~  325 (326)
T KOG1454         293 AELVEIPGAGHLPHLERPEEVAALLRSFIARLR  325 (326)
T ss_pred             CEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             669995899967545888999999999998607


No 15 
>PRK05855 short chain dehydrogenase; Validated
Probab=99.97  E-value=1.7e-30  Score=200.45  Aligned_cols=248  Identities=22%  Similarity=0.318  Sum_probs=174.6

Q ss_pred             CEEEEEECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             40799934994999999648998789999878888001221799999998689899996476554222222222222122
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF   83 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~   83 (261)
                      .-++.++.||.+|+++++|++++|||||+|||+.++.   .|++.++.|+++ |+|++||.||+|.|+.|.....|.++.
T Consensus         3 ~~~~vv~~~gv~lav~~~G~~~~ptvvlvHGyPD~~~---vW~~v~~~La~~-f~vv~yDvRGaG~S~~P~~~~~yrl~~   78 (582)
T PRK05855          3 EARTVVSSGGVRLAVYEWGDPDRPTVVLVHGYPDSHE---VWDGVAPLLAER-FRVVAYDVRGAGLSSAPKRTSAYTLAR   78 (582)
T ss_pred             CCEEEEECCCEEEEEEECCCCCCCEEEEEECCCCCHH---HHHHHHHHHCCC-EEEEEECCCCCCCCCCCCCCCCCCHHH
T ss_conf             6358982399799998527899984899806888366---689999985046-059955577888789998633240999


Q ss_pred             CCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHC--CCCCCCEEEECCCCCCCCCC-----------HHHH------
Q ss_conf             222222222222222-222234434443101333210--23565238962885633110-----------3569------
Q gi|254780166|r   84 MAADAVSLLEHLGIS-KVHVMGYSMGARIACSMVLFY--PSYVRSVILGGVGSVLYDSD-----------VVDW------  143 (261)
Q Consensus        84 ~~~di~~~i~~l~~~-~~~liGhS~Gg~ia~~~a~~~--p~~v~~lvl~~~~~~~~~~~-----------~~~~------  143 (261)
                      +++|+.+++|.+..+ ++||+||.||+..++++...-  .+||.+.+-++. |.+....           ....      
T Consensus        79 l~~D~~AV~dav~p~rpvHlv~HDWGSiq~We~vt~~~~~~RiaS~tSiSG-P~ldh~g~~~r~~~~~~~p~~~~~~~~Q  157 (582)
T PRK05855         79 LADDFAAVIDALSPGRPVHVLAHDWGSIQGWEYVTRPRLAGRIASFTSVSG-PSLDHVGFWLRSRLRRPTPRSLARLLGQ  157 (582)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHCCCCCCCCEEEEEECCC-CCHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             998999999864899834887527543323223248542452356760578-8768899999875127984789999998


Q ss_pred             ---HHHHHHHHCCCCCHHH--HHHHHHHCCC----CCCC----C-----CCCHHHHHHHHHHHCCCCCHHHHHCCCCCEE
Q ss_conf             ---9999986311110000--1110000000----0347----6-----6541356777654101220012100357606
Q gi|254780166|r  144 ---QSLIDSFLLPSIDEVQ--NPLGKKFRKF----ADLD----P-----GNDLKALASCLSMIRKPFCQDDLYRIDVPVL  205 (261)
Q Consensus       144 ---~~~~~~~~~~~~~~~~--~~~~~~~~~~----~~~~----~-----~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l  205 (261)
                         ..++..+..+.+.+..  ....+.|..+    ....    +     .....++.-+-.++.....++.-...++|+.
T Consensus       158 ~~~s~Yi~~f~~P~lpe~~~r~~~~~~~~~~l~~~e~~~~~~~~~~~~~~d~~~g~~lYRAN~~~~~~~pr~r~~~vPVq  237 (582)
T PRK05855        158 LARSWYVYLFHLPVLPELLWRLGLGRAWPRLLRRVEKTPVDQIPSPTQASDGAHGVKLYRANFIRSLLAPRERYTHVPVQ  237 (582)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEE
T ss_conf             99889999985744228887523145679998633688877777831356777336541145764347888877888779


Q ss_pred             EEEECCCCCCCCH--HHHHHHCCCCEEEEECCCCCCCCCCCHH-HHHHHHHHHHH
Q ss_conf             9984788878807--9999967997999988887384348489-99999999875
Q gi|254780166|r  206 IAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYAN  257 (261)
Q Consensus       206 ~i~G~~D~~~~~~--~~l~~~~p~~~~~~i~~~gH~~~~e~p~-~~~~i~~Fl~~  257 (261)
                      +|.+..|.++.+.  +.+.+..|+.....++ +||+....+|+ +++.+.||+..
T Consensus       238 ~iv~~~D~~v~p~l~~~~~~w~~~l~rr~i~-a~HW~p~s~P~~iA~~~~efv~~  291 (582)
T PRK05855        238 LIVPTGDPYVRPALYDDLARWVPRLWRREIK-AGHWLPMSHPQVLAAAVAELIDA  291 (582)
T ss_pred             EEEECCCCCCCHHHHCCHHHCCCCCEEEEEC-CCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             9751788776977744144417860898603-78537667989999999999986


No 16 
>pfam00561 Abhydrolase_1 alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.
Probab=99.97  E-value=4.8e-31  Score=203.67  Aligned_cols=196  Identities=30%  Similarity=0.388  Sum_probs=130.9

Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCC
Q ss_conf             89999647655422222222222212222222222222222222223443444310133321023565238962885633
Q gi|254780166|r   57 FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY  136 (261)
Q Consensus        57 ~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~  136 (261)
                      |+||++|+||||.|+++ ....|+++++++|+.++++++++++++++||||||.+++.+|.++|++++++|++++.....
T Consensus         1 ~~vi~~D~~G~G~S~~~-~~~~~~~~~~~~di~~l~~~l~i~~~~liGhS~Gg~va~~~a~~~p~~v~~lil~~~~~~~~   79 (225)
T pfam00561         1 FDVIAFDLRGFGRSSPP-DLADYRFDDLAEDLEALLQALGLDKVNLVGHSMGGLIALAYAAKYPDRVKALVLVGTVHPAG   79 (225)
T ss_pred             CEEEEECCCCCCCCCCC-CCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCHHHHCEEEEECCCCCCC
T ss_conf             97999758999999698-98998999999999999997699977999972883999999996938602888989886222


Q ss_pred             CCCHHHHHHHH-----HHHHCCCCCHHHHHH---HHHHC------------CC---CCCCCCCCHH---HHHHHHHHHCC
Q ss_conf             11035699999-----986311110000111---00000------------00---0347665413---56777654101
Q gi|254780166|r  137 DSDVVDWQSLI-----DSFLLPSIDEVQNPL---GKKFR------------KF---ADLDPGNDLK---ALASCLSMIRK  190 (261)
Q Consensus       137 ~~~~~~~~~~~-----~~~~~~~~~~~~~~~---~~~~~------------~~---~~~~~~~~~~---~~~~~~~~~~~  190 (261)
                      ...........     ...............   .....            ..   ..........   ...........
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (225)
T pfam00561        80 LSSPLTPRGNLLGLLLDNFFNRLYDSVEALLGRAIKQFQALGRPFVSDFLKQFELSSLIRFSETLALDGLLGVALGYYLV  159 (225)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             32134556776676677788874322678998866666530463212588988888774111335566788887654411


Q ss_pred             CCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEECCCCCCCCCCCHH-HHHHHHH
Q ss_conf             220012100357606998478887880--79999967997999988887384348489-9999999
Q gi|254780166|r  191 PFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN  253 (261)
Q Consensus       191 ~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~~gH~~~~e~p~-~~~~i~~  253 (261)
                      .+....+.++++|+++++|++|.++++  .+++.+.+|++++++++++||++++|+|+ +++.|++
T Consensus       160 ~~~~~~~~~~~~Pvl~i~G~~D~~~~~~~~~~~~~~~~~~~~~~i~~~gH~~~~e~p~~~~~~il~  225 (225)
T pfam00561       160 WDRSAALKDIDVPTLIIWGDDDPLVPPDASEKLAALFPNAQLVVIDDAGHLAQLEKPDEVAELILK  225 (225)
T ss_pred             CCHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCHHHHCHHHHHHHHHC
T ss_conf             345989854899879996079997699999999987899889998999970387299999999719


No 17 
>PRK10749 lysophospholipase L2; Provisional
Probab=99.97  E-value=1.2e-29  Score=195.37  Aligned_cols=248  Identities=15%  Similarity=0.188  Sum_probs=165.6

Q ss_pred             CEEEEEECCCCEEEEEEECCC-CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC--CC-
Q ss_conf             407999349949999996489-98789999878888001221799999998689899996476554222222222--22-
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGDK-DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN--DY-   79 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~~-~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~--~~-   79 (261)
                      +-.+|...||.+|+|..+..+ ...+||++||.+-+.   ..|..++..|..+||.|+++|+||||.|++...+.  .+ 
T Consensus        31 ~~~~f~g~d~~~i~y~~~~~~~~~~~IVI~~Gr~E~~---~KY~E~~~~l~~~Gy~V~~~DhRGqG~S~Rl~~d~~~GhV  107 (330)
T PRK10749         31 EEAEFTGVDNIPVRFVRFRAQHHDRVVVICPGRIESY---VKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLADPHRGHV  107 (330)
T ss_pred             CCCEEECCCCCEEEEEECCCCCCCCEEEECCCCCHHH---HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCEEE
T ss_conf             7506975699869999866888885599828974108---9999999999988998999778888877776789987631


Q ss_pred             -CCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHH-HHHHHHH--
Q ss_conf             -2122222222222222----2222222344344431013332102356523896288563311035699-9999863--
Q gi|254780166|r   80 -RLVFMAADAVSLLEHL----GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ-SLIDSFL--  151 (261)
Q Consensus        80 -s~~~~~~di~~~i~~l----~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~-~~~~~~~--  151 (261)
                       +++++++|+..+++..    ...+.+++||||||.|+++++.++|..++++||++|.-.+..+ ...|. +.+..+.  
T Consensus       108 ~~F~dYv~Dl~~~~~~~~~~~~~~~~~llgHSMGG~Ia~~~l~~~~~~f~aavLSAPMlgI~~~-~p~~la~~ll~~~~~  186 (330)
T PRK10749        108 NKFNDYVDDLAAFWQQEIQPGPWRKRYILAHSMGGAILTLFLQRHPGVFDAIALCAPMFGIVIR-LPSWMARQILNWAEG  186 (330)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCC-CCHHHHHHHHHHHHH
T ss_conf             8888899999999999854568886389973627899999999678655559995775357675-408999999998864


Q ss_pred             CCCCC-----HHHH----H-----HH------HHHCCCCCCCCC-----CCHHHHHHHHHHHCCCCCHHHHHCCCCCEEE
Q ss_conf             11110-----0001----1-----10------000000034766-----5413567776541012200121003576069
Q gi|254780166|r  152 LPSID-----EVQN----P-----LG------KKFRKFADLDPG-----NDLKALASCLSMIRKPFCQDDLYRIDVPVLI  206 (261)
Q Consensus       152 ~~~~~-----~~~~----~-----~~------~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~  206 (261)
                      .+...     ....    +     +.      ..+.......|.     .....+.+.+.+...  .....++|++|+|+
T Consensus       187 ~~~~~~~y~~g~~~~~~~pf~~N~LT~d~~Ry~~~~~~~~~~P~l~lGgpT~~Wv~eal~a~~~--~~~~a~~I~~PvLi  264 (330)
T PRK10749        187 HPRIRDGYAIGTGRWRALPFAINVLTHSRERYRRNLRFYADDPELRVGGPTYHWVRESILAGEQ--VLAGAGDDTTPTLL  264 (330)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHH--HHHHCCCCCCCEEE
T ss_conf             3455544567888777786555745488789999999997496640478659999999999999--98646047999899


Q ss_pred             EEECCCCCCCCH--HHHHHH-------CCCCEEEEECCCCCCCCCCCH----HHHHHHHHHHHH
Q ss_conf             984788878807--999996-------799799998888738434848----999999999875
Q gi|254780166|r  207 AVGSQDDLAGSP--QELMSF-------IPSSQYLNICRRDHLLAVGDK----QFKQGVVNFYAN  257 (261)
Q Consensus       207 i~G~~D~~~~~~--~~l~~~-------~p~~~~~~i~~~gH~~~~e~p----~~~~~i~~Fl~~  257 (261)
                      +.|++|.+|++.  +++++.       ++++++++++|+-|.++.|+.    ++.+.|.+||.+
T Consensus       265 l~a~~D~iVd~~a~~~f~~~~~~~~~~~~~~~l~~i~gArHEil~E~D~~R~~~l~~I~~F~~~  328 (330)
T PRK10749        265 LQAEEERVVDNRMHDRFCELRTAAGHPCEGGRPLVIKGAYHEILFEKDAMRSVALNAIVDFFNR  328 (330)
T ss_pred             EEECCCCEECHHHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             9828981108399999999987525766687088758960167539879999999999999976


No 18 
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH; InterPro: IPR010076   This CoA-binding enzyme is required for the production of pimeloyl-coenzyme A, the substrate of the BioF protein early in the biosynthesis of biotin. Its exact function is unknown. This enzyme belongs to the alpha/beta hydrolase fold family (IPR000073 from INTERPRO). Members of this family are restricted to the proteobacteria.; GO: 0009102 biotin biosynthetic process.
Probab=99.97  E-value=1.1e-30  Score=201.63  Aligned_cols=219  Identities=22%  Similarity=0.302  Sum_probs=166.2

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             87899998788880012217999999986898999964765542-22222222222122222222222222222222234
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK-SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMG  104 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~-S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liG  104 (261)
                      .+.+|||||||.|..   .|..+.+.|.. .|+|...|+||||+ |..   -...++++.++   +++++.. .+.+++|
T Consensus         4 ~~~lvLiHGWg~n~~---vf~~l~~~L~~-hf~l~~VDLPGhG~n~~~---~~p~~l~~~a~---Ai~~~~p-~~A~wLG   72 (248)
T TIGR01738         4 VKKLVLIHGWGMNSE---VFDDLVERLSA-HFTLHLVDLPGHGDNSTT---LRPLSLAEVAD---AIAAQAP-AKAIWLG   72 (248)
T ss_pred             CCEEEEEECHHHHHH---HHHHHHHHCCC-CCEEEEEECCCCCCCCCC---CCCCCHHHHHH---HHHHHCC-CCCEEEE
T ss_conf             741468505343278---88998774226-750688755888875566---78047789999---9997389-9873870


Q ss_pred             CCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCC------------------HHHHHHHHHHHHCCCCCHHH--HHHHH
Q ss_conf             43444310133321023565238962885633110------------------35699999986311110000--11100
Q gi|254780166|r  105 YSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD------------------VVDWQSLIDSFLLPSIDEVQ--NPLGK  164 (261)
Q Consensus       105 hS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~------------------~~~~~~~~~~~~~~~~~~~~--~~~~~  164 (261)
                      +|+||.||+.+|+++|++|++||+.++.|.....+                  ..++++.+++|..=..-..+  +...+
T Consensus        73 WSLGGLvA~~~A~~hP~~V~~Lv~~As~p~f~a~edwP~g~~~~~L~~f~~~L~~dy~~ti~rFLaLq~lGt~~A~~~~~  152 (248)
T TIGR01738        73 WSLGGLVALHLAATHPDKVRSLVTVASSPCFTAREDWPEGIEPDVLTKFVEQLKSDYQKTIERFLALQTLGTPDARQDIR  152 (248)
T ss_pred             CCHHHHHHHHHHHHCCHHHHHHHHHHHCHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             23678999999862527888898886220110367762236702778999999998999999998753038830689999


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCC--CCEEEEECCCCCCC
Q ss_conf             00000034766541356777654101220012100357606998478887880--799999679--97999988887384
Q gi|254780166|r  165 KFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIP--SSQYLNICRRDHLL  240 (261)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p--~~~~~~i~~~gH~~  240 (261)
                      ..++.....+--+.+.+.+-+....+.|.|..+.+|++|+|.+.|..|.++|.  .+.+.+..|  .+|..++++++|.|
T Consensus       153 ~l~~~l~~~~~Pn~~~L~~gL~~l~~~DlR~~l~~i~~P~L~~~G~~D~lvP~~~~~~l~~l~psG~se~~~~~~aaHAP  232 (248)
T TIGR01738       153 RLKQDLLARPTPNTQALQAGLELLARVDLRRALQKISVPVLRLYGQLDGLVPAKVIEALDRLAPSGQSELLVFEKAAHAP  232 (248)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCCC
T ss_conf             99999871789988889999999986314565430688445341765677717899999974678983121240668886


Q ss_pred             CCCCH-HHHHHHHHHH
Q ss_conf             34848-9999999998
Q gi|254780166|r  241 AVGDK-QFKQGVVNFY  255 (261)
Q Consensus       241 ~~e~p-~~~~~i~~Fl  255 (261)
                      ++..+ +|+..+.+|.
T Consensus       233 FlShA~~f~~~l~~f~  248 (248)
T TIGR01738       233 FLSHAEAFCALLRDFV  248 (248)
T ss_pred             CCCCHHHHHHHHHHHC
T ss_conf             0100899999998629


No 19 
>KOG4409 consensus
Probab=99.96  E-value=5.2e-29  Score=191.55  Aligned_cols=248  Identities=19%  Similarity=0.227  Sum_probs=160.1

Q ss_pred             EEEEECCCCEEEEEEEC--CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCC--
Q ss_conf             79993499499999964--89987899998788880012217999999986898999964765542222222222221--
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVG--DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL--   81 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g--~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~--   81 (261)
                      ++....++..+......  +.+++|+|||||+|.+..   .|-.-++.|+. .++|+++|++|+|+|.+|..+.+.+.  
T Consensus        68 ~~v~i~~~~~iw~~~~~~~~~~~~plVliHGyGAg~g---~f~~Nf~~La~-~~~vyaiDllG~G~SSRP~F~~d~~~~e  143 (365)
T KOG4409          68 KYVRIPNGIEIWTITVSNESANKTPLVLIHGYGAGLG---LFFRNFDDLAK-IRNVYAIDLLGFGRSSRPKFSIDPTTAE  143 (365)
T ss_pred             EEEECCCCCEEEEEEECCCCCCCCCEEEEECCCHHHH---HHHHHHHHHHH-CCCEEEECCCCCCCCCCCCCCCCCCCCH
T ss_conf             4400588752688861466567875799715531678---99986666652-3823786266788777998887865111


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCC--------CHHHHHHHHHHHHCC
Q ss_conf             222222222222222222222344344431013332102356523896288563311--------035699999986311
Q gi|254780166|r   82 VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS--------DVVDWQSLIDSFLLP  153 (261)
Q Consensus        82 ~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~--------~~~~~~~~~~~~~~~  153 (261)
                      +.+++-++++....+++|.+|+|||+||+++..||.+||++|..|+|+++.......        ....|.+........
T Consensus       144 ~~fvesiE~WR~~~~L~KmilvGHSfGGYLaa~YAlKyPerV~kLiLvsP~Gf~~~~~~~~~~~~~~~~w~~~~~~~~~~  223 (365)
T KOG4409         144 KEFVESIEQWRKKMGLEKMILVGHSFGGYLAAKYALKYPERVEKLILVSPWGFPEKPDSEPEFTKPPPEWYKALFLVATN  223 (365)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHCHHHHCEEEEECCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHC
T ss_conf             99999999999976982006763150279999999868575433798666566567776453158972888653566606


Q ss_pred             --------CCCHH-----HHHHHHHHCCCCC-------------CCCC--CCHHHHHHHHH--HHCCCCCHHHHHCCC--
Q ss_conf             --------11000-----0111000000003-------------4766--54135677765--410122001210035--
Q gi|254780166|r  154 --------SIDEV-----QNPLGKKFRKFAD-------------LDPG--NDLKALASCLS--MIRKPFCQDDLYRID--  201 (261)
Q Consensus       154 --------~~~~~-----~~~~~~~~~~~~~-------------~~~~--~~~~~~~~~~~--~~~~~~~~~~l~~i~--  201 (261)
                              ....+     .....+.++++..             ....  .....+...+.  .+...-.-+++..++  
T Consensus       224 ~nPl~~LR~~Gp~Gp~Lv~~~~~d~~~k~~~~~~ed~l~~YiY~~n~~~psgE~~fk~l~~~~g~Ar~Pm~~r~~~l~~~  303 (365)
T KOG4409         224 FNPLALLRLMGPLGPKLVSRLRPDRFRKFPSLIEEDFLHEYIYHCNAQNPSGETAFKNLFEPGGWARRPMIQRLRELKKD  303 (365)
T ss_pred             CCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHCCC
T ss_conf             77789998605402677865508899746442216789999998548898278999998752622340699999862668


Q ss_pred             CCEEEEEECCCCCCCC-HHHHHHH--CCCCEEEEECCCCCCCCCCCHH-HHHHHHHHHHH
Q ss_conf             7606998478887880-7999996--7997999988887384348489-99999999875
Q gi|254780166|r  202 VPVLIAVGSQDDLAGS-PQELMSF--IPSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYAN  257 (261)
Q Consensus       202 ~P~l~i~G~~D~~~~~-~~~l~~~--~p~~~~~~i~~~gH~~~~e~p~-~~~~i~~Fl~~  257 (261)
                      +|+++|+|++|.+-.. ..++...  ...+++++|+++||...+++|+ |++.|++++..
T Consensus       304 ~pv~fiyG~~dWmD~~~g~~~~~~~~~~~~~~~~v~~aGHhvylDnp~~Fn~~v~~~~~~  363 (365)
T KOG4409         304 VPVTFIYGDRDWMDKNAGLEVTKSLMKEYVEIIIVPGAGHHVYLDNPEFFNQIVLEECDK  363 (365)
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCEEECCCHHHHHHHHHHHHHC
T ss_conf             977999448410023357989977620555079956997336547989999999998752


No 20 
>TIGR01249 pro_imino_pep_1 proline iminopeptidase; InterPro: IPR005944   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of serine peptidase belong to MEROPS peptidase family S33 (clan SC). They are proline iminopeptidase (Prolyl aminopeptidase, 3.4.11.5 from EC), which catalyzes the removal of the N-terminal proline from peptides. This family represents one of two related families of proline iminopeptidase containing the alpha/beta fold. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.  ; GO: 0016804 prolyl aminopeptidase activity, 0005737 cytoplasm.
Probab=99.96  E-value=2.1e-30  Score=199.82  Aligned_cols=232  Identities=21%  Similarity=0.318  Sum_probs=159.1

Q ss_pred             EEEEECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             79993499499999964899878999987888800122179999999868989999647655422222222222212222
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA   85 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~   85 (261)
                      =+....|-.+|+|.+.|+|+|.|||||||.+|+.....    ....+..+-||+|.+|+||+|+|..-..-.+.++++.|
T Consensus         7 G~L~V~d~H~LYye~~GnP~G~PV~~lHGGPGsGt~~~----~r~fFdpe~~rIvL~DQRGcGkS~p~a~~~eNtTWdLV   82 (310)
T TIGR01249         7 GYLKVSDNHQLYYEQSGNPDGKPVVFLHGGPGSGTDPE----CRRFFDPETYRIVLLDQRGCGKSTPHACLEENTTWDLV   82 (310)
T ss_pred             CCEEECCEEEEEEECCCCCCCCEEEEEECCCCCCCCCC----CCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCHHHH
T ss_conf             44230661354221067989954899756878998834----46453766358999830788898624332247705667


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECC----------------CCCCCCCCHHHHHHHHHH
Q ss_conf             2222222222222222234434443101333210235652389628----------------856331103569999998
Q gi|254780166|r   86 ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV----------------GSVLYDSDVVDWQSLIDS  149 (261)
Q Consensus        86 ~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~----------------~~~~~~~~~~~~~~~~~~  149 (261)
                      .|++-+.+.|+|++..++|=|||+.+|+.||..||++|++|||-+.                +..+++   ..|+++++.
T Consensus        83 ~DiEkLR~~L~I~~W~vFGGSWGStLALaYAq~HP~~v~~lvLRgiFL~R~~e~~w~~~~G~~~~~YP---~~w~~F~d~  159 (310)
T TIGR01249        83 ADIEKLREKLGIKKWLVFGGSWGSTLALAYAQTHPEKVTGLVLRGIFLLREKELSWFYEGGLASMIYP---DAWQRFVDS  159 (310)
T ss_pred             HHHHHHHHHCCCCCEEEECCCHHHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCC---HHHHHHHCC
T ss_conf             43999998628971488538778999999860162465355655676328667899972687023472---556654105


Q ss_pred             HHCCCCCHH------------------HHHHHHHHCCCCC---C--------CCCCCHHHHHH------HHHHHC-----
Q ss_conf             631111000------------------0111000000003---4--------76654135677------765410-----
Q gi|254780166|r  150 FLLPSIDEV------------------QNPLGKKFRKFAD---L--------DPGNDLKALAS------CLSMIR-----  189 (261)
Q Consensus       150 ~~~~~~~~~------------------~~~~~~~~~~~~~---~--------~~~~~~~~~~~------~~~~~~-----  189 (261)
                      .+.......                  +...++.|..+..   .        ....+.....+      .+....     
T Consensus       160 IP~~~r~sY~~lv~ayh~~l~~~De~~~~~aAkAW~~WE~~t~~L~~~~~~~~~aed~~~~la~ArlEnHYfVNkgFl~~  239 (310)
T TIGR01249       160 IPENERNSYEQLVNAYHDRLQSEDEETKLAAAKAWVDWESATTLLRPENEIVSTAEDAKFSLALARLENHYFVNKGFLDS  239 (310)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHH
T ss_conf             87401365789999998740575379999998646667635655134714341114778999998775102204640534


Q ss_pred             CCCCHHHHHCC-CCCEEEEEECCCCCCCCH--HHHHHHCCCCEEEEECCCCCCCCCCCH
Q ss_conf             12200121003-576069984788878807--999996799799998888738434848
Q gi|254780166|r  190 KPFCQDDLYRI-DVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHLLAVGDK  245 (261)
Q Consensus       190 ~~~~~~~l~~i-~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~~~~i~~~gH~~~~e~p  245 (261)
                      +-.+-+.+.+| ++|+.+++|..|-++|..  =.|.+..|.+++.++++|||-. .|++
T Consensus       240 e~~lL~ni~~i~~i~~~iv~GRyDl~cPl~~awaL~kafPea~L~v~~~AGHsa-~dp~  297 (310)
T TIGR01249       240 ENFLLDNISKIRNIPTVIVHGRYDLICPLQSAWALHKAFPEAELKVVNNAGHSA-FDPN  297 (310)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCEEHCCHHCCHHHHHHCCCCCEEEEECCCCCCC-CCHH
T ss_conf             688886677640687379844600002003544675218551466745788665-7654


No 21 
>COG2267 PldB Lysophospholipase [Lipid metabolism]
Probab=99.95  E-value=2.2e-27  Score=181.91  Aligned_cols=253  Identities=19%  Similarity=0.213  Sum_probs=167.0

Q ss_pred             CEEEEEECCCCEEEEEEECCCCC--CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC-CCCCCCCCC
Q ss_conf             40799934994999999648998--789999878888001221799999998689899996476554222-222222222
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD-KSYIENDYR   80 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~~~~--~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~-~~~~~~~~s   80 (261)
                      .-.+|.+.||.++.|..+-.+..  .+||++||++-+..   .|..++..|..+||.|+++|+||||.|. +..... -+
T Consensus        10 ~~~~~~~~d~~~~~~~~~~~~~~~~g~Vvl~HG~~Eh~~---ry~~la~~l~~~G~~V~~~D~RGhG~S~r~~rg~~-~~   85 (298)
T COG2267          10 TEGYFTGADGTRLRYRTWAAPEPPKGVVVLVHGLGEHSG---RYEELADDLAARGFDVYALDLRGHGRSPRGQRGHV-DS   85 (298)
T ss_pred             CCCEEECCCCCEEEEEEECCCCCCCCEEEEECCCHHHHH---HHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCC-HH
T ss_conf             444340479846788852378898878999269506788---99999999985998799836899888997766772-10


Q ss_pred             CCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC-CCHHHHHHHHHHHHC---
Q ss_conf             12222222222222222----2222234434443101333210235652389628856331-103569999998631---
Q gi|254780166|r   81 LVFMAADAVSLLEHLGI----SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD-SDVVDWQSLIDSFLL---  152 (261)
Q Consensus        81 ~~~~~~di~~~i~~l~~----~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~-~~~~~~~~~~~~~~~---  152 (261)
                      +.++.+|+.++++....    .+++++||||||.|++.++.+++.++.++||++|.-.... ...............   
T Consensus        86 f~~~~~dl~~~~~~~~~~~~~~p~~l~gHSmGg~Ia~~~~~~~~~~i~~~vLssP~~~l~~~~~~~~~~~~~~~~~~~~~  165 (298)
T COG2267          86 FADYVDDLDAFVETIAEPDPGLPVFLLGHSMGGLIALLYLARYPPRIDGLVLSSPALGLGGAILRLILARLALKLLGRIR  165 (298)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             89999999999999853489998899995736999999998478565669998864236620345688998765440306


Q ss_pred             CCCCHHH--------HHHHH--HHCCCCCCCCC-----CCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCC-
Q ss_conf             1110000--------11100--00000034766-----54135677765410122001210035760699847888788-
Q gi|254780166|r  153 PSIDEVQ--------NPLGK--KFRKFADLDPG-----NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG-  216 (261)
Q Consensus       153 ~~~~~~~--------~~~~~--~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~-  216 (261)
                      +.+....        ....+  ........++.     .....+...+.... ........++++|+|+++|+.|.+++ 
T Consensus       166 p~~~~~~~~~~~~~~~~~sr~~~~~~~~~~dP~~~~~~~~~~w~~~~~~a~~-~~~~~~~~~~~~PvLll~g~~D~vv~~  244 (298)
T COG2267         166 PKLPVDSNLLEGVLTDDLSRDPAEVAAYEADPLIGVGGPVSRWVDLALLAGR-VPALRDAPAIALPVLLLQGGDDRVVDN  244 (298)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH-HHHHCCCCCCCCCEEEEECCCCCCCCC
T ss_conf             5553356544565534353699999986349520268853799999999743-332033434579858730377836677


Q ss_pred             CH--HHHHHH--CCCCEEEEECCCCCCCCCCCH----HHHHHHHHHHHHHCCC
Q ss_conf             07--999996--799799998888738434848----9999999998751689
Q gi|254780166|r  217 SP--QELMSF--IPSSQYLNICRRDHLLAVGDK----QFKQGVVNFYANELRA  261 (261)
Q Consensus       217 ~~--~~l~~~--~p~~~~~~i~~~gH~~~~e~p----~~~~~i~~Fl~~~~~~  261 (261)
                      ..  .++.+.  .|+.++++++++.|.++.|.+    ++.+.+.+|+.+..++
T Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~g~~He~~~E~~~~r~~~~~~~~~~l~~~~~~  297 (298)
T COG2267         245 VEGLARFFERAGSPDKELKVIPGAYHELLNEPDRAREEVLKDILAWLAEALPS  297 (298)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCCHHHHCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             37899999965999842777689770565277758999999999998750169


No 22 
>KOG1455 consensus
Probab=99.93  E-value=1.7e-24  Score=164.68  Aligned_cols=254  Identities=20%  Similarity=0.233  Sum_probs=169.7

Q ss_pred             CCCEEEEEECCCCEEEEEEECCC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             76407999349949999996489----98789999878888001221799999998689899996476554222222222
Q gi|254780166|r    2 MNEVKFFRSWRKYQFAFYDVGDK----DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN   77 (261)
Q Consensus         2 ~~~~~~~~~~dG~~l~y~~~g~~----~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~   77 (261)
                      +..-+|+++.+|.++.+..+-+.    ..-.|+++||++..  +.+.+...+..|+..||-|+++|++|||.|++-....
T Consensus        26 ~~~~~~~~n~rG~~lft~~W~p~~~~~pr~lv~~~HG~g~~--~s~~~~~~a~~l~~~g~~v~a~D~~GhG~SdGl~~yi  103 (313)
T KOG1455          26 TYSESFFTNPRGAKLFTQSWLPLSGTEPRGLVFLCHGYGEH--SSWRYQSTAKRLAKSGFAVYAIDYEGHGRSDGLHAYV  103 (313)
T ss_pred             CEEEEEEECCCCCEEEEEECCCCCCCCCCEEEEEECCCCCC--CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCC
T ss_conf             00001377477787677743567899874699997477632--1046899999998579748975425777678874467


Q ss_pred             CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC----CCHHHHHHHH
Q ss_conf             222122222222222222------222222234434443101333210235652389628856331----1035699999
Q gi|254780166|r   78 DYRLVFMAADAVSLLEHL------GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD----SDVVDWQSLI  147 (261)
Q Consensus        78 ~~s~~~~~~di~~~i~~l------~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~----~~~~~~~~~~  147 (261)
                       -+++..++|+....+..      .-.+..|+||||||.|++.++.++|+...++|++++.-.+.+    +.....--..
T Consensus       104 -~~~d~~v~D~~~~~~~i~~~~e~~~lp~FL~GeSMGGAV~Ll~~~k~p~~w~G~ilvaPmc~i~~~~kp~p~v~~~l~~  182 (313)
T KOG1455         104 -PSFDLVVDDVISFFDSIKEREENKGLPRFLFGESMGGAVALLIALKDPNFWDGAILVAPMCKISEDTKPHPPVISILTL  182 (313)
T ss_pred             -CCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             -7578889889999988764124589976443057446999999761876102410000412257766898289999999


Q ss_pred             HHHHCCCCCHHHHH--HH-----HHHCCCCCCCCC--CCHHHHHHHHHHH-CCCCCHHHHHCCCCCEEEEEECCCCCCCC
Q ss_conf             98631111000011--10-----000000034766--5413567776541-01220012100357606998478887880
Q gi|254780166|r  148 DSFLLPSIDEVQNP--LG-----KKFRKFADLDPG--NDLKALASCLSMI-RKPFCQDDLYRIDVPVLIAVGSQDDLAGS  217 (261)
Q Consensus       148 ~~~~~~~~~~~~~~--~~-----~~~~~~~~~~~~--~~~~~~~~~~~~~-~~~~~~~~l~~i~~P~l~i~G~~D~~~~~  217 (261)
                      -....+...-....  ..     ..-++....++.  ...-.+...+..+ ...+....+.++++|.++++|+.|.++.+
T Consensus       183 l~~liP~wk~vp~~d~~~~~~kdp~~r~~~~~npl~y~g~pRl~T~~ElLr~~~~le~~l~~vtvPflilHG~dD~VTDp  262 (313)
T KOG1455         183 LSKLIPTWKIVPTKDIIDVAFKDPEKRKILRSDPLCYTGKPRLKTAYELLRVTADLEKNLNEVTVPFLILHGTDDKVTDP  262 (313)
T ss_pred             HHHHCCCEEECCCCCCCCCCCCCHHHHHHHHCCCCEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCC
T ss_conf             98758710005876543200078999987523981533873088999999998999973324543479986588840580


Q ss_pred             --HHHHHHHCC--CCEEEEECCCCCCCCC-CCHH----HHHHHHHHHHHH
Q ss_conf             --799999679--9799998888738434-8489----999999998751
Q gi|254780166|r  218 --PQELMSFIP--SSQYLNICRRDHLLAV-GDKQ----FKQGVVNFYANE  258 (261)
Q Consensus       218 --~~~l~~~~p--~~~~~~i~~~gH~~~~-e~p~----~~~~i~~Fl~~~  258 (261)
                        ++++.+..+  +-++.++||.=|-++. |.++    ++..|++||.+.
T Consensus       263 ~~Sk~Lye~A~S~DKTlKlYpGm~H~Ll~gE~~en~e~Vf~DI~~Wl~~r  312 (313)
T KOG1455         263 KVSKELYEKASSSDKTLKLYPGMWHSLLSGEPDENVEIVFGDIISWLDER  312 (313)
T ss_pred             HHHHHHHHHCCCCCCCEECCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             78899998565778843405447778541798554999999999999733


No 23 
>KOG2382 consensus
Probab=99.91  E-value=1.3e-23  Score=159.41  Aligned_cols=239  Identities=21%  Similarity=0.305  Sum_probs=165.8

Q ss_pred             CEEEEEEE----CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             49999996----4899878999987888800122179999999868-989999647655422222222222212222222
Q gi|254780166|r   14 YQFAFYDV----GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ-GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA   88 (261)
Q Consensus        14 ~~l~y~~~----g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~-g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di   88 (261)
                      .++.|-.+    +-+.+||++++||+.|+.+   .|..+...|+.. +-.+++.|.|-||.|.+.   ..++-+.+++|+
T Consensus        36 ~~l~y~~~~~~~~~~~~Pp~i~lHGl~GS~~---Nw~sv~k~Ls~~l~~~v~~vd~RnHG~Sp~~---~~h~~~~ma~dv  109 (315)
T KOG2382          36 VRLAYDSVYSSENLERAPPAIILHGLLGSKE---NWRSVAKNLSRKLGRDVYAVDVRNHGSSPKI---TVHNYEAMAEDV  109 (315)
T ss_pred             CCCCEEEEECCCCCCCCCCEEEECCCCCCCC---CHHHHHHHHCCCCCCCEEEEECCCCCCCCCC---CCCCHHHHHHHH
T ss_conf             4010013543666677996687122226787---8799999832312673688742247888663---556888889899


Q ss_pred             CCCCCCCC----CCCCCCCCCCCCC-CCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCC-----HH
Q ss_conf             22222222----2222223443444-31013332102356523896288563311035699999986311110-----00
Q gi|254780166|r   89 VSLLEHLG----ISKVHVMGYSMGA-RIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----EV  158 (261)
Q Consensus        89 ~~~i~~l~----~~~~~liGhS~Gg-~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~  158 (261)
                      ..+++..+    ..++.++|||||| .+++..+..+|+++.+++..+..|........+....+.++......     ..
T Consensus       110 ~~Fi~~v~~~~~~~~~~l~GHsmGG~~~~m~~t~~~p~~~~rliv~D~sP~~~~~~~~e~~e~i~~m~~~d~~~~~~~~r  189 (315)
T KOG2382         110 KLFIDGVGGSTRLDPVVLLGHSMGGVKVAMAETLKKPDLIERLIVEDISPGGVGRSYGEYRELIKAMIQLDLSIGVSRGR  189 (315)
T ss_pred             HHHHHHCCCCCCCCCCEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCH
T ss_conf             99999702223337832403576369999999875675211257883487667866245999999997035533455437


Q ss_pred             HHHHHH--------HHCCCC--CC---------CCCCCHHHHHHHHHHHCCCCCHHHH--HCCCCCEEEEEECCCCCCCC
Q ss_conf             011100--------000000--34---------7665413567776541012200121--00357606998478887880
Q gi|254780166|r  159 QNPLGK--------KFRKFA--DL---------DPGNDLKALASCLSMIRKPFCQDDL--YRIDVPVLIAVGSQDDLAGS  217 (261)
Q Consensus       159 ~~~~~~--------~~~~~~--~~---------~~~~~~~~~~~~~~~~~~~~~~~~l--~~i~~P~l~i~G~~D~~~~~  217 (261)
                      +..+..        ..+.|.  ..         ....+.......+........+.++  .....|||++.|.++.+++.
T Consensus       190 ke~~~~l~~~~~d~~~~~fi~~nl~~~~~~~s~~w~~nl~~i~~~~~~~~~~s~~~~l~~~~~~~pvlfi~g~~S~fv~~  269 (315)
T KOG2382         190 KEALKSLIEVGFDNLVRQFILTNLKKSPSDGSFLWRVNLDSIASLLDEYEILSYWADLEDGPYTGPVLFIKGLQSKFVPD  269 (315)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCH
T ss_conf             79999999874105899999975476777870688757899999999877505510002566566436886377887582


Q ss_pred             H--HHHHHHCCCCEEEEECCCCCCCCCCCHH-HHHHHHHHHHHH
Q ss_conf             7--9999967997999988887384348489-999999998751
Q gi|254780166|r  218 P--QELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYANE  258 (261)
Q Consensus       218 ~--~~l~~~~p~~~~~~i~~~gH~~~~e~p~-~~~~i~~Fl~~~  258 (261)
                      .  .++.+..|++++.+++++||+.+.|+|+ +.+.|.+|+.+.
T Consensus       270 ~~~~~~~~~fp~~e~~~ld~aGHwVh~E~P~~~~~~i~~Fl~~~  313 (315)
T KOG2382         270 EHYPRMEKIFPNVEVHELDEAGHWVHLEKPEEFIESISEFLEEP  313 (315)
T ss_pred             HHHHHHHHHCCCHHEEECCCCCCEEECCCHHHHHHHHHHHHCCC
T ss_conf             67799998624111465066784366279799999999974136


No 24 
>COG1647 Esterase/lipase [General function prediction only]
Probab=99.90  E-value=1.5e-23  Score=159.13  Aligned_cols=217  Identities=18%  Similarity=0.291  Sum_probs=145.6

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCC
Q ss_conf             8789999878888001221799999998689899996476554222222222222122222222222222---2222222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL---GISKVHV  102 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l---~~~~~~l  102 (261)
                      +..|+|||||.|+...   .+.+.++|.++||+|++|.+||||..  |..-...+.++|-+++.+..++|   +.+.+.+
T Consensus        15 ~~AVLllHGFTGt~~D---vr~Lgr~L~e~GyTv~aP~ypGHG~~--~e~fl~t~~~DW~~~v~d~Y~~L~~~gy~eI~v   89 (243)
T COG1647          15 NRAVLLLHGFTGTPRD---VRMLGRYLNENGYTVYAPRYPGHGTL--PEDFLKTTPRDWWEDVEDGYRDLKEAGYDEIAV   89 (243)
T ss_pred             CEEEEEEECCCCCCHH---HHHHHHHHHHCCCEEECCCCCCCCCC--HHHHHCCCHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             8799998336898088---99999999878955746888999999--899850799999999999999998757985899


Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHH-CCCCC-HHHHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             3443444310133321023565238962885633110356999999863-11110-000111000000003476654135
Q gi|254780166|r  103 MGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFL-LPSID-EVQNPLGKKFRKFADLDPGNDLKA  180 (261)
Q Consensus       103 iGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~  180 (261)
                      +|.||||.+++.+|..+|  ++++|.++++-........ .+....... ..... .......+.++.+.+. +......
T Consensus        90 ~GlSmGGv~alkla~~~p--~K~iv~m~a~~~~k~~~~i-ie~~l~y~~~~kk~e~k~~e~~~~e~~~~~~~-~~~~~~~  165 (243)
T COG1647          90 VGLSMGGVFALKLAYHYP--PKKIVPMCAPVNVKSWRII-IEGLLEYFRNAKKYEGKDQEQIDKEMKSYKDT-PMTTTAQ  165 (243)
T ss_pred             EEECCHHHHHHHHHHHCC--CCCEEEECCCCCCCCCHHH-HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCC-HHHHHHH
T ss_conf             851203699999985379--5523640477665541034-57899999985651488989999999984136-0779999


Q ss_pred             HHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHC-CC-CEEEEECCCCCCCCCC--CHHHHHHHHHH
Q ss_conf             6777654101220012100357606998478887880--79999967-99-7999988887384348--48999999999
Q gi|254780166|r  181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFI-PS-SQYLNICRRDHLLAVG--DKQFKQGVVNF  254 (261)
Q Consensus       181 ~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~-p~-~~~~~i~~~gH~~~~e--~p~~~~~i~~F  254 (261)
                      +....     .+.+..+..|..|++++.|.+|++++.  ++.+...+ ++ -++..++++||.+..+  ..++.++|+.|
T Consensus       166 ~~~~i-----~~~~~~~~~I~~pt~vvq~~~D~mv~~~sA~~Iy~~v~s~~KeL~~~e~SgHVIt~D~Erd~v~e~V~~F  240 (243)
T COG1647         166 LKKLI-----KDARRSLDKIYSPTLVVQGRQDEMVPAESANFIYDHVESDDKELKWLEGSGHVITLDKERDQVEEDVITF  240 (243)
T ss_pred             HHHHH-----HHHHHHHHHCCCCHHHEECCCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCEEECCHHHHHHHHHHHHH
T ss_conf             99999-----9987436563014420441568888878989999830587502678726881654526589999999998


Q ss_pred             HH
Q ss_conf             87
Q gi|254780166|r  255 YA  256 (261)
Q Consensus       255 l~  256 (261)
                      |.
T Consensus       241 L~  242 (243)
T COG1647         241 LE  242 (243)
T ss_pred             HH
T ss_conf             60


No 25 
>KOG2984 consensus
Probab=99.90  E-value=1.4e-23  Score=159.33  Aligned_cols=238  Identities=20%  Similarity=0.244  Sum_probs=166.6

Q ss_pred             EECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCC-CEEEEECCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             934994999999648998789999878888001221799999998689-899996476554222222222222-122222
Q gi|254780166|r    9 RSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQG-FRVIAFDNLGHGKSDKSYIENDYR-LVFMAA   86 (261)
Q Consensus         9 ~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g-~~vi~~D~~G~G~S~~~~~~~~~s-~~~~~~   86 (261)
                      +..+|.+|+|.++|.++. .|+++.|..++..  ..|.+++..+.+.. ++++++|-||||.|..|.-+.... +..-++
T Consensus        26 v~vng~ql~y~~~G~G~~-~iLlipGalGs~~--tDf~pql~~l~k~l~~TivawDPpGYG~SrPP~Rkf~~~ff~~Da~  102 (277)
T KOG2984          26 VHVNGTQLGYCKYGHGPN-YILLIPGALGSYK--TDFPPQLLSLFKPLQVTIVAWDPPGYGTSRPPERKFEVQFFMKDAE  102 (277)
T ss_pred             EEECCCEEEEEECCCCCC-EEEECCCCCCCCC--CCCCHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             333473311365278985-2576155336666--6688778735887853799878998888899733220789987289


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             22222222222222223443444310133321023565238962885633110356999999863111100001110000
Q gi|254780166|r   87 DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF  166 (261)
Q Consensus        87 di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (261)
                      +...++++++.+++.++|+|-||..++..|+++++.|.++++-+.+......+...++.         +....+|..+.-
T Consensus       103 ~avdLM~aLk~~~fsvlGWSdGgiTalivAak~~e~v~rmiiwga~ayvn~~~~ma~kg---------iRdv~kWs~r~R  173 (277)
T KOG2984         103 YAVDLMEALKLEPFSVLGWSDGGITALIVAAKGKEKVNRMIIWGAAAYVNHLGAMAFKG---------IRDVNKWSARGR  173 (277)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCEEEEEEECCCHHHHHHHEEECCCCEECCHHHHHHHC---------HHHHHHHHHHHC
T ss_conf             99999997277870476314787578875024766543422642212335236778743---------177755525403


Q ss_pred             CCCCCCCCCCCH-HHHHHHH---HHH---C-CCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCCEEEEECCC
Q ss_conf             000034766541-3567776---541---0-12200121003576069984788878807--999996799799998888
Q gi|254780166|r  167 RKFADLDPGNDL-KALASCL---SMI---R-KPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRR  236 (261)
Q Consensus       167 ~~~~~~~~~~~~-~~~~~~~---~~~---~-~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~~~~i~~~  236 (261)
                      .-+.+...-... ...+++.   ..+   . .-..+-.+.+++||+|+++|+.|++++..  ..+..+.+.+++.+.+.+
T Consensus       174 ~P~e~~Yg~e~f~~~wa~wvD~v~qf~~~~dG~fCr~~lp~vkcPtli~hG~kDp~~~~~hv~fi~~~~~~a~~~~~peG  253 (277)
T KOG2984         174 QPYEDHYGPETFRTQWAAWVDVVDQFHSFCDGRFCRLVLPQVKCPTLIMHGGKDPFCGDPHVCFIPVLKSLAKVEIHPEG  253 (277)
T ss_pred             CHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCHHHHCCCCEEEECCCC
T ss_conf             62777418788999999999999998616898467652553458736760786877788776514442555448876677


Q ss_pred             CCCCCCC-CHHHHHHHHHHHHHH
Q ss_conf             7384348-489999999998751
Q gi|254780166|r  237 DHLLAVG-DKQFKQGVVNFYANE  258 (261)
Q Consensus       237 gH~~~~e-~p~~~~~i~~Fl~~~  258 (261)
                      +|-+++. ..+|+..+++||++.
T Consensus       254 kHn~hLrya~eFnklv~dFl~~~  276 (277)
T KOG2984         254 KHNFHLRYAKEFNKLVLDFLKST  276 (277)
T ss_pred             CCCEEEECHHHHHHHHHHHHHCC
T ss_conf             75435642698879999997416


No 26 
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=99.89  E-value=3e-22  Score=151.32  Aligned_cols=239  Identities=26%  Similarity=0.369  Sum_probs=146.3

Q ss_pred             EECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHC--CCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             93499499999964899878999987888800122179999999868--9899996476554222222222222122222
Q gi|254780166|r    9 RSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ--GFRVIAFDNLGHGKSDKSYIENDYRLVFMAA   86 (261)
Q Consensus         9 ~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~--g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~   86 (261)
                      ....+..+.|...+.+ +|+++++||++++...   |......+...  .|+++.+|+||||.|. ..   .++....++
T Consensus         5 ~~~~~~~~~~~~~~~~-~~~i~~~hg~~~~~~~---~~~~~~~~~~~~~~~~~~~~d~~g~g~s~-~~---~~~~~~~~~   76 (282)
T COG0596           5 LAADGVRLAYREAGGG-GPPLVLLHGFPGSSSV---WRPVFKVLPALAARYRVIAPDLRGHGRSD-PA---GYSLSAYAD   76 (282)
T ss_pred             CCCCCCEEEEEECCCC-CCEEEEECCCCCCHHH---HHHHHHHHHHCCCCCEEEEECCCCCCCCC-CC---CCCHHHHHH
T ss_conf             2368734788724899-9728997898751667---77655555540467149996788888886-54---455888999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC--CCH------HHHHHHHHHHHCCCCCHH
Q ss_conf             222222222222222234434443101333210235652389628856331--103------569999998631111000
Q gi|254780166|r   87 DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD--SDV------VDWQSLIDSFLLPSIDEV  158 (261)
Q Consensus        87 di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~--~~~------~~~~~~~~~~~~~~~~~~  158 (261)
                      ++..+++.++.++++++|||+||.+++.++.++|++++++|++++......  ...      ..................
T Consensus        77 ~~~~~~~~~~~~~~~l~G~S~Gg~~~~~~~~~~p~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  156 (282)
T COG0596          77 DLAALLDALGLEKVVLVGHSMGGAVALALALRHPDRVRGLVLIGPAPPPGLLEAALRQPAGAAPLAALADLLLGLDAAAF  156 (282)
T ss_pred             HHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHCHHHCCEEEEECCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99999998288866999988669999999985967626799976765410231111111100344444444342324428


Q ss_pred             HHHHHHH--HCCC--------CCCCCC------------CCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCC
Q ss_conf             0111000--0000--------034766------------54135677765410122001210035760699847888788
Q gi|254780166|r  159 QNPLGKK--FRKF--------ADLDPG------------NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG  216 (261)
Q Consensus       159 ~~~~~~~--~~~~--------~~~~~~------------~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~  216 (261)
                      .......  ...+        ......            .....................+.++++|++++.|++|.+.+
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~i~g~~d~~~~  236 (282)
T COG0596         157 AALLAALGLLAALAAAARAGLAEALRAPLLGAAAAAFARAARADLAAALLALLDRDLRAALARITVPTLIIHGEDDPVVP  236 (282)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             99988600256665544345555414667888776655544577888777542002566764079997999778876788


Q ss_pred             C--HHHHHHHCCC-CEEEEECCCCCCCCCCCHH-HHHHHHHHH
Q ss_conf             0--7999996799-7999988887384348489-999999998
Q gi|254780166|r  217 S--PQELMSFIPS-SQYLNICRRDHLLAVGDKQ-FKQGVVNFY  255 (261)
Q Consensus       217 ~--~~~l~~~~p~-~~~~~i~~~gH~~~~e~p~-~~~~i~~Fl  255 (261)
                      .  ...+.+.+++ +++.+++++||+++.++|+ +.+.+.+|+
T Consensus       237 ~~~~~~~~~~~~~~~~~~~~~~~gH~~~~~~p~~~~~~i~~~~  279 (282)
T COG0596         237 AELARRLAAALPNDARLVVIPGAGHFPHLEAPEAFAAALLAFL  279 (282)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCHHCHHHHHHHHHHHH
T ss_conf             6889999986788856999899875731109999999999987


No 27 
>PRK06489 hypothetical protein; Provisional
Probab=99.88  E-value=5e-22  Score=150.05  Aligned_cols=247  Identities=20%  Similarity=0.230  Sum_probs=159.5

Q ss_pred             CCCEEEEEEECCCC-------CCEEEEECCCCCCCHHH---HHHHHHH---HHHHHCCCEEEEECCCCCCCCCCCCCCC-
Q ss_conf             99499999964899-------87899998788880012---2179999---9998689899996476554222222222-
Q gi|254780166|r   12 RKYQFAFYDVGDKD-------APTILLIHGLASSVQTN---WLFSGWI---QLLCDQGFRVIAFDNLGHGKSDKSYIEN-   77 (261)
Q Consensus        12 dG~~l~y~~~g~~~-------~~~vv~iHG~~~~~~~~---~~~~~~~---~~l~~~g~~vi~~D~~G~G~S~~~~~~~-   77 (261)
                      ...+++|..+|.++       ...|+++||+++++...   ..|..++   ..|....|.||++|..|+|.|..|.+.. 
T Consensus        48 ~~~~l~Y~T~G~~~~~~~~~~~NaVLv~H~~~g~~~~~~~~g~w~~liGpG~~lDt~kyfiI~~n~lG~g~Ss~Ps~~~~  127 (358)
T PRK06489         48 PELKLHYTTLGTPTRGADGEIDNAVLVLHGTGGSGKSFLSPTFAGELFGPGQPLDATKYYIILPDGIGHGKSSKPSDGLR  127 (358)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCC
T ss_conf             78469999667656565667776599982577874436898608864579988788866999835888999999998888


Q ss_pred             ----CCCCCCCCCCCCCCC-CCCCCCCCC-CCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCC-CCCCCHHHHHHHHHHH
Q ss_conf             ----222122222222222-222222222-234434443101333210235652389628856-3311035699999986
Q gi|254780166|r   78 ----DYRLVFMAADAVSLL-EHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSV-LYDSDVVDWQSLIDSF  150 (261)
Q Consensus        78 ----~~s~~~~~~di~~~i-~~l~~~~~~-liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~-~~~~~~~~~~~~~~~~  150 (261)
                          .+++.|+|+--..++ |.++++++. ++|.||||+.+++++..||+++++++-+...+. .......-.+...+.+
T Consensus       128 ~~FP~~ti~D~V~aQ~~Ll~e~lgI~~l~~v~G~SmGgmqa~~Wa~~yPd~v~~~ipia~~p~~~s~~N~~~~e~~~~aI  207 (358)
T PRK06489        128 AKFPRYDYADMVEAQYRLVTEGLGVKHLRLILGTSMGGMHAWVWGERYPDFMDALMPMASQPVEMSGRNWMWRRMLIDAI  207 (358)
T ss_pred             CCCCEEEHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             89983222578999999998762986686563257888999999987968987456310574422087799999999998


Q ss_pred             HC------CCCCH----------------------HH------HHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHH
Q ss_conf             31------11100----------------------00------1110000000034766541356777654101220012
Q gi|254780166|r  151 LL------PSIDE----------------------VQ------NPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD  196 (261)
Q Consensus       151 ~~------~~~~~----------------------~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  196 (261)
                      ..      .....                      .+      ....+.++.........+...+.-.+++...+|....
T Consensus       208 ~~DP~w~~G~Y~~qP~~gl~aa~m~~~~t~~s~~~~q~~~ptr~~~d~~vd~~~~~~~~~DANd~Ly~~kAs~~yDp~~~  287 (358)
T PRK06489        208 RNDPDWNGGNYTTQPRAMKRANTAFGIATGGGTLAYQKQAPTRAAADKAVDERLAAPVTADANDFLYQWDSSRDYNPSPD  287 (358)
T ss_pred             HCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCHHH
T ss_conf             61955458857768266999999999998148999987587166778999998743336781169999875274796355


Q ss_pred             HHCCCCCEEEEEECCCCCCCCH----HHHHHHCCCCEEEEECC----CCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             1003576069984788878807----99999679979999888----87384348489999999998751
Q gi|254780166|r  197 LYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICR----RDHLLAVGDKQFKQGVVNFYANE  258 (261)
Q Consensus       197 l~~i~~P~l~i~G~~D~~~~~~----~~l~~~~p~~~~~~i~~----~gH~~~~e~p~~~~~i~~Fl~~~  258 (261)
                      |++|+.|+|+|....|.+.|+.    +...+.+|++++++||.    .||..+....-..+.+.+||++.
T Consensus       288 L~~IkA~vLvI~~a~D~~fPPE~g~~e~~~~~v~~~~~~~ip~~~~t~GH~t~~~~~~~~~~L~~~L~~~  357 (358)
T PRK06489        288 LEKIKAPVLAVNSADDERNPPELGVMEAALKRVKNGRLVLIPASDETRGHGTTGNAKFWKAYLAELLAQS  357 (358)
T ss_pred             HHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             8647335899856554628820305899997476964999557767467766657678999999998413


No 28 
>PRK07581 hypothetical protein; Validated
Probab=99.87  E-value=3.6e-22  Score=150.91  Aligned_cols=243  Identities=18%  Similarity=0.170  Sum_probs=149.3

Q ss_pred             CCCEEEEEEECCC--CCC-EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC---------CC
Q ss_conf             9949999996489--987-89999878888001221799999998689899996476554222222222---------22
Q gi|254780166|r   12 RKYQFAFYDVGDK--DAP-TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN---------DY   79 (261)
Q Consensus        12 dG~~l~y~~~g~~--~~~-~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~---------~~   79 (261)
                      ...+++|..+|.-  ++. .|++.|++.+++.....+-.--..+....|.|||++..|.|.|..|....         .+
T Consensus        24 ~~~~laY~t~G~Ln~~~~Nailv~h~~tg~~~~~~wliGpg~~iDt~kyfVIc~N~lG~g~ss~p~~~~~~~~~~~FP~~  103 (340)
T PRK07581         24 RDAKLAYATYGTLNAAKDNAILYPTWYSGTHQDNEWLIGPGRALDPEKYFIIVPNMFGNGLSSSPSNTPAPYNAARFPHV  103 (340)
T ss_pred             CCCEEEEEEECCCCCCCCCEEEECCCCCCCCCCCCEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             89569999502438889867997687678887787443289864767659998358788989999899997777889853


Q ss_pred             CCCCCCCCCCCCC-CCCCCCCCCC-CCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHC-CC--
Q ss_conf             2122222222222-2222222222-34434443101333210235652389628856331103569999998631-11--
Q gi|254780166|r   80 RLVFMAADAVSLL-EHLGISKVHV-MGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLL-PS--  154 (261)
Q Consensus        80 s~~~~~~di~~~i-~~l~~~~~~l-iGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~-~~--  154 (261)
                      |+.|+|+--..++ |+|+++++.+ +|.||||+.++++|..||++++++|.+++.+........-.+........ +.  
T Consensus       104 ti~D~V~aq~~Ll~e~LgI~~l~~ViG~SmGGmqaleWa~~yPd~v~~~v~ia~~a~~s~~~ia~~e~~r~AI~~Dp~w~  183 (340)
T PRK07581        104 TIYDNVRAQHRLLTEHFGIERLALVTGWSMGAQQTYHWAVRFPDMVERAAPICGTAKCTPHNFVFLEGLKAALTADPAFK  183 (340)
T ss_pred             EEHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             62799999999999752988688885667899999999986969887562115665689879999999999998393557


Q ss_pred             -----------C--------------C-------------HHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCC-----
Q ss_conf             -----------1--------------0-------------00011100000000347665413567776541012-----
Q gi|254780166|r  155 -----------I--------------D-------------EVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP-----  191 (261)
Q Consensus       155 -----------~--------------~-------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----  191 (261)
                                 +              +             ..++.+...+.++.   ...+...+....+++..+     
T Consensus       184 ~G~Y~~~P~~GLra~ar~~a~~~~s~~~~r~~~~~~~g~~~vEsyL~~~~~~~~---~rfDANsyl~lt~a~~~~Dv~~~  260 (340)
T PRK07581        184 GGWYTEKPERGLRAAARVYAGWGFSQAFYRQEDWRAMGYSSLEDFLVGFWEGNF---LPRDPNNLLAMIWTWQRGDVSRN  260 (340)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---HHCCHHHHHHHHHHHHHCCCCCC
T ss_conf             888888613439999999999865557776454431272148899999998887---61788899999999774564347


Q ss_pred             -----CCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCCEEEEECC-CCCCCCC------CCHHHHHHHHHHHHH
Q ss_conf             -----200121003576069984788878807--99999679979999888-8738434------848999999999875
Q gi|254780166|r  192 -----FCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICR-RDHLLAV------GDKQFKQGVVNFYAN  257 (261)
Q Consensus       192 -----~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~~~~i~~-~gH~~~~------e~p~~~~~i~~Fl~~  257 (261)
                           +..+.|++|++|+|+|-.+.|...|+.  +++++.+|++++.+|+. -||...+      +...+..+|.+||++
T Consensus       261 ~~~~g~l~~AL~~Ika~~Lvi~i~sD~lFPp~e~~~~a~~ip~a~~~~I~S~~GHdAfl~g~~~~d~~~~~~~i~~~La~  340 (340)
T PRK07581        261 TAFGGDLAAALGAIKAKTFVMPGSTDLYFPPEDCAAEQALIPNAELRPIPSIWGHLAGLPGQNPADIAFIDAALKELLAS  340 (340)
T ss_pred             CCCCCCHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             67687599999758999899973765386989999999856797699979996200468899977999999999998539


No 29 
>PRK10985 putative hydrolase; Provisional
Probab=99.87  E-value=4.3e-21  Score=144.51  Aligned_cols=251  Identities=15%  Similarity=0.204  Sum_probs=151.6

Q ss_pred             CEEEEEECCCCEEEEEEEC----CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             4079993499499999964----899878999987888800122179999999868989999647655422222222222
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVG----DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY   79 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g----~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~   79 (261)
                      +.+.+.+.||-.+......    .+++|.||++||+.|+.++.+ ....+..+.++||+|+++++||+|.+... .+..|
T Consensus        32 ~re~l~~~DG~~i~Ldw~~~~~~~~~~p~villHGL~G~s~s~Y-i~~l~~~~~~~G~~~vv~n~RGc~g~~~~-~~r~y  109 (325)
T PRK10985         32 YWQRLELPDGDFVDLAWSEDPAQARHKPRLVLFHGLEGSFNSPY-AHGLLEAAQKRGWLGVVMHFRGCSGEPNR-LHRIY  109 (325)
T ss_pred             EEEEEECCCCCEEEEEECCCCCCCCCCCEEEEECCCCCCCCCHH-HHHHHHHHHHCCCEEEEEECCCCCCCCCC-CCCEE
T ss_conf             26999989999899860578876789888999888889998779-99999999978997999807789999777-76736


Q ss_pred             CCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHCCC--CCCCEEEECCCCCCCCCCHHH---HHHHHHHH
Q ss_conf             2122222222222222----22222223443444310133321023--565238962885633110356---99999986
Q gi|254780166|r   80 RLVFMAADAVSLLEHL----GISKVHVMGYSMGARIACSMVLFYPS--YVRSVILGGVGSVLYDSDVVD---WQSLIDSF  150 (261)
Q Consensus        80 s~~~~~~di~~~i~~l----~~~~~~liGhS~Gg~ia~~~a~~~p~--~v~~lvl~~~~~~~~~~~~~~---~~~~~~~~  150 (261)
                      .. ...+|+..+++++    .-.++.++|+|+||.+.+.|+....+  .+++.+.++++..+.......   +.+.....
T Consensus       110 ~~-g~t~Dl~~~v~~i~~~~p~~~i~~vGfSlGgnillkyLge~g~~~~l~aav~vs~P~dl~~~~~~l~~~~~r~Y~~~  188 (325)
T PRK10985        110 HS-GETEDARFFLRWLQREFGHVPTAAVGYSLGGNMLACYLAKEGNDLPLDAAVIVSAPLMLEACSYRMEQGFSRVYQRY  188 (325)
T ss_pred             CC-CCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHCCCHHHHHHH
T ss_conf             27-85689999999999878998578862015789999998740777770379984685578999999856201679999


Q ss_pred             HCCCCCHHHHHHHHHHCCCCCC--------CCCC-----------CHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECC
Q ss_conf             3111100001110000000034--------7665-----------41356777654101220012100357606998478
Q gi|254780166|r  151 LLPSIDEVQNPLGKKFRKFADL--------DPGN-----------DLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQ  211 (261)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~--------~~~~-----------~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~  211 (261)
                      ...   .+++...+....+.+.        ....           ...++...-...........+++|++|+|+|..++
T Consensus       189 ~~~---~lk~~~~~k~~~~~~~~~~~~~~~~~~~tl~eFD~~~t~p~~Gf~s~~dYY~~~S~~~~l~~I~vP~L~l~A~D  265 (325)
T PRK10985        189 LLN---LLKANATRKLAAYPGTLPINLAQLKSVRRLREFDDLITAKIHGFADAIDYYRQCSALPLLNQIAKPTLIIHAKD  265 (325)
T ss_pred             HHH---HHHHHHHHHHHHCCCCCCCCHHHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHCCCHHHHHCCCCCEEEEECCC
T ss_conf             999---99999999987474412479999861797999998655652598998999985393645402776649997477


Q ss_pred             CCCCCCH--HHHHHHCCCCEEEEECCCCCCCCCCC----HH--HHHHHHHHHHHHCC
Q ss_conf             8878807--99999679979999888873843484----89--99999999875168
Q gi|254780166|r  212 DDLAGSP--QELMSFIPSSQYLNICRRDHLLAVGD----KQ--FKQGVVNFYANELR  260 (261)
Q Consensus       212 D~~~~~~--~~l~~~~p~~~~~~i~~~gH~~~~e~----p~--~~~~i~~Fl~~~~~  260 (261)
                      |++++..  ......-++..+++-+.+||+.++|.    |+  .-+.+++||..-++
T Consensus       266 DP~~~~~~iP~~~~~~~~~~l~~t~~GGHvGF~eg~~~~~~~W~~~~i~~~~~~~l~  322 (325)
T PRK10985        266 DPFMTHEVIPKPESLPPNVEYQLTEHGGHVGFIGGTLLKPQMWLESRIPDWLTTYLE  322 (325)
T ss_pred             CCCCCHHHCCCHHHCCCCEEEEECCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             898991438756765997489827998736537789999884669999999999972


No 30 
>PRK00175 metX homoserine O-acetyltransferase; Provisional
Probab=99.87  E-value=3.1e-21  Score=145.32  Aligned_cols=247  Identities=19%  Similarity=0.239  Sum_probs=155.7

Q ss_pred             CCCEEEEEEECCCC--C-CEEEEECCCCCCCHHHH----------HHHHHH---HHHHHCCCEEEEECCCC--CCCCCCC
Q ss_conf             99499999964899--8-78999987888800122----------179999---99986898999964765--5422222
Q gi|254780166|r   12 RKYQFAFYDVGDKD--A-PTILLIHGLASSVQTNW----------LFSGWI---QLLCDQGFRVIAFDNLG--HGKSDKS   73 (261)
Q Consensus        12 dG~~l~y~~~g~~~--~-~~vv~iHG~~~~~~~~~----------~~~~~~---~~l~~~g~~vi~~D~~G--~G~S~~~   73 (261)
                      ...+|+|..+|.-+  + -.||++|++.++++...          .|..++   ..+....|.|||+|..|  +| |++|
T Consensus        30 ~~~~iaY~t~G~Ln~~~dNaILv~HaltG~~~~~~~~~~~~~~~GWW~~lIGpgkaiDt~kyfVI~~N~lG~c~G-STgP  108 (379)
T PRK00175         30 PDYELAYETYGTLNADRSNAVLICHALTGDHHVAGPHPDDDGKPGWWDNMVGPGKPIDTDRFFVICVNVLGGCKG-STGP  108 (379)
T ss_pred             CCCEEEEEECCCCCCCCCCEEEEECCCCCCHHHCCCCCCCCCCCCCHHHCCCCCCCCCCCCEEEEECCCCCCCCC-CCCC
T ss_conf             996599994243178898789994787874320467766778877277635899764756469994576788878-8998


Q ss_pred             CCC-----CC-------CCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCH
Q ss_conf             222-----22-------22122222222222222222222-234434443101333210235652389628856331103
Q gi|254780166|r   74 YIE-----ND-------YRLVFMAADAVSLLEHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV  140 (261)
Q Consensus        74 ~~~-----~~-------~s~~~~~~di~~~i~~l~~~~~~-liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~  140 (261)
                      ...     .+       +|+.|+|+--..++++|++++++ ++|.||||++++++|..||++++++|.++..........
T Consensus       109 ~s~~p~tg~~yg~~FP~iti~D~V~aq~~Ll~~LGI~~l~aViG~SmGG~qAlewA~~yPd~v~~ii~Ia~~ar~s~~~i  188 (379)
T PRK00175        109 SSINPATGKPYGSDFPVITIRDWVRAQARLLDALGITRLAAVVGGSMGGMQALQWAIDYPDRVRHALVIASSARLSAQNI  188 (379)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHCCHHHHHEEEEECCCCCCHHHH
T ss_conf             88898889956578994529999999999999739897988975580899999999849575330344520202578899


Q ss_pred             HHHHHHHHHHHC-------------------------------CCCCHHHHHHHHHHCCCC-------------------
Q ss_conf             569999998631-------------------------------111000011100000000-------------------
Q gi|254780166|r  141 VDWQSLIDSFLL-------------------------------PSIDEVQNPLGKKFRKFA-------------------  170 (261)
Q Consensus       141 ~~~~~~~~~~~~-------------------------------~~~~~~~~~~~~~~~~~~-------------------  170 (261)
                      ...+.....+..                               .+.+.+...+.+..+...                   
T Consensus       189 a~~~~~r~aI~~Dp~w~~G~Y~~~~~~P~~GL~~AR~~a~ltYrs~~~~~~rFgr~~~~~~~~~~~~~~f~vEsYL~~qg  268 (379)
T PRK00175        189 AFNEVARQAILADPDFHGGDYYEHGVYPKRGLRVARMIGHITYLSDDELDEKFGRDLQRDALEFGFDVEFQVESYLRYQG  268 (379)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCCCCEEHHHHHHHHH
T ss_conf             99999999998592555687554688960689999999997734899999885734356545666444400557987765


Q ss_pred             -CCCCCCCHHHHHHHHHHHCCCC--------CHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCC----CEEEEEC-
Q ss_conf             -3476654135677765410122--------00121003576069984788878807--999996799----7999988-
Q gi|254780166|r  171 -DLDPGNDLKALASCLSMIRKPF--------CQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPS----SQYLNIC-  234 (261)
Q Consensus       171 -~~~~~~~~~~~~~~~~~~~~~~--------~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~----~~~~~i~-  234 (261)
                       ......+...+....+.+..+|        ....+++|++|+|+|..+.|.+.|+.  +++++.+|+    +++.+|+ 
T Consensus       269 ~kf~~rFDaNsyl~l~~a~d~~Di~~~~~gdl~~AL~~I~a~~Lvi~i~sD~lFPp~~~~~~a~~l~~~~~~~~~~eI~S  348 (379)
T PRK00175        269 DKFVERFDANSYLLLTRALDYFDPARGHGGDLAAALAGIKARFLVVSFTTDWLFPPARSREIVDALLAAGADVSYAEIDS  348 (379)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             65540679899999999998548544458789999730899889996075507289999999999986699769999689


Q ss_pred             CCCCC-CCCCCHHHHHHHHHHHHHHC
Q ss_conf             88738-43484899999999987516
Q gi|254780166|r  235 RRDHL-LAVGDKQFKQGVVNFYANEL  259 (261)
Q Consensus       235 ~~gH~-~~~e~p~~~~~i~~Fl~~~~  259 (261)
                      .-||- +.+|.+++.+.|.+||.+..
T Consensus       349 ~~GHDaFLie~~~~~~~i~~FL~~~~  374 (379)
T PRK00175        349 PHGHDAFLLDDPRYGPLVRAFLERAA  374 (379)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             99745015588999999999999999


No 31 
>PRK10566 esterase; Provisional
Probab=99.86  E-value=1.2e-20  Score=141.93  Aligned_cols=217  Identities=21%  Similarity=0.275  Sum_probs=129.3

Q ss_pred             CCCE-EEEEEECCC--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC-CC----CC
Q ss_conf             9949-999996489--9878999987888800122179999999868989999647655422222222222-21----22
Q gi|254780166|r   12 RKYQ-FAFYDVGDK--DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY-RL----VF   83 (261)
Q Consensus        12 dG~~-l~y~~~g~~--~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~-s~----~~   83 (261)
                      .|.. +++...|..  .-|+|||.||++++.+.   |..++..|+++||+|+.+|.+|||.+......... .+    ..
T Consensus        10 ~~ip~l~~~~~~~~~~~lP~Vvf~HG~~~~~e~---~~~~~~~la~~Gy~V~~Pd~~~hG~r~~~~~~~~~~~fw~~~~~   86 (249)
T PRK10566         10 AGIEVLHAYPVGQRDQPLPCVIFYHGFTSSSLV---YSYFAVALAQAGFRVIMPDAPDHGARFSGDEARRLNQFWQILLQ   86 (249)
T ss_pred             CCCCEEEEECCCCCCCCCCEEEEECCCCCCCCC---HHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             781269984687788987789996899664001---15799999978988996368888756677611110246999986


Q ss_pred             CCCCCCCCCCCC------CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCH
Q ss_conf             222222222222------22222223443444310133321023565238962885633110356999999863111100
Q gi|254780166|r   84 MAADAVSLLEHL------GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDE  157 (261)
Q Consensus        84 ~~~di~~~i~~l------~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (261)
                      .++|+..+++.+      +-+++.+.|+||||+.++..++.+|+.-.++.+++++.         +.......... ...
T Consensus        87 ~~~e~~~~v~~l~~~g~vD~~RigI~G~S~GG~tal~ala~~p~i~aav~~~G~~~---------~~~l~~~~~~~-~~~  156 (249)
T PRK10566         87 NMQEFPTLRAAIQQENWLLDDRLAVGGASMGGMTALGIMARHPEVKCAASLMGSGY---------FTSLARTLFPP-LIP  156 (249)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHCCCCCEEEEEEECCHH---------HHHHHHHCCCC-CCC
T ss_conf             29999999999998488775336998238899999999961986059999956635---------99999860745-444


Q ss_pred             HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCC-CCCEEEEEECCCCCCCCH--HHHHHHCC----CCEE
Q ss_conf             0011100000000347665413567776541012200121003-576069984788878807--99999679----9799
Q gi|254780166|r  158 VQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRI-DVPVLIAVGSQDDLAGSP--QELMSFIP----SSQY  230 (261)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i-~~P~l~i~G~~D~~~~~~--~~l~~~~p----~~~~  230 (261)
                      ..               ......+..........+....+.++ +.|+|+++|++|..||..  +++.+.+.    ..++
T Consensus       157 ~~---------------~~~~~~~~~~~~~l~~~d~~~~~~~l~~rPLLl~HG~~D~~VP~~qs~~~~~aLr~~g~~~~l  221 (249)
T PRK10566        157 ET---------------PAQQAEFDNIIAPLAEWEVTHQLEQLADRPLLLWHGEADDVVPAAESLRLQQALRETGLDKNL  221 (249)
T ss_pred             CC---------------CHHHHHHHHHHCCHHCCCHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             77---------------300667875425021048444276536998699835889987989999999999975998007


Q ss_pred             --EEECCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             --99888873843484899999999987516
Q gi|254780166|r  231 --LNICRRDHLLAVGDKQFKQGVVNFYANEL  259 (261)
Q Consensus       231 --~~i~~~gH~~~~e~p~~~~~i~~Fl~~~~  259 (261)
                        ...||.||.+.   ++..++.++||.+.|
T Consensus       222 ~~~~~eg~gH~vs---~~~l~~~v~ff~~hL  249 (249)
T PRK10566        222 TCLWQPGVRHRIT---PEALDATVAFFRQHL  249 (249)
T ss_pred             EEEECCCCCCCCC---HHHHHHHHHHHHHHC
T ss_conf             9997399998578---999999999999749


No 32 
>PRK06765 homoserine O-acetyltransferase; Provisional
Probab=99.85  E-value=9.7e-21  Score=142.40  Aligned_cols=250  Identities=18%  Similarity=0.193  Sum_probs=153.3

Q ss_pred             CCCEEEEEEECCC--CC-CEEEEECCCCCCCHHH----------HHHHHHH---HHHHHCCCEEEEECCCCCCCC-----
Q ss_conf             9949999996489--98-7899998788880012----------2179999---999868989999647655422-----
Q gi|254780166|r   12 RKYQFAFYDVGDK--DA-PTILLIHGLASSVQTN----------WLFSGWI---QLLCDQGFRVIAFDNLGHGKS-----   70 (261)
Q Consensus        12 dG~~l~y~~~g~~--~~-~~vv~iHG~~~~~~~~----------~~~~~~~---~~l~~~g~~vi~~D~~G~G~S-----   70 (261)
                      ...+++|..+|.-  ++ ..||.+|.+.++++..          -.|..++   ..+....|.|||.+.+|.+.+     
T Consensus        35 ~~~~laY~t~G~Ln~~~~NaILv~HaltG~~h~ag~~~~~d~~~gWW~~liG~gk~iDt~kyfVIc~N~lG~~~g~~p~~  114 (387)
T PRK06765         35 PDVQMGYETYGTLNRAKSNVILITHYFSATSHAAGKYTAHDEEAGYWDGLIGPGKAIDTNKYFVISTDTLCNVQVKDPNV  114 (387)
T ss_pred             CCCEEEEEEECCCCCCCCCEEEEECCCCCCHHHCCCCCCCCCCCCCHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCC
T ss_conf             89569998504448999978999488577633226777778887718763589986576766999945777777789887


Q ss_pred             --CCCCCC-----C-------CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             --222222-----2-------222122222222222222222222-2344344431013332102356523896288563
Q gi|254780166|r   71 --DKSYIE-----N-------DYRLVFMAADAVSLLEHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL  135 (261)
Q Consensus        71 --~~~~~~-----~-------~~s~~~~~~di~~~i~~l~~~~~~-liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~  135 (261)
                        .+|...     .       .+|+.|+|+--..++++|++++++ ++|.||||++|+++|..||++++++|.++..+..
T Consensus       115 ~stGP~S~~p~tg~pyg~~FP~vTi~D~V~aq~~LLd~LGI~kl~aViGgSmGGmqAlewa~~~Pd~v~~~i~Ia~sa~~  194 (387)
T PRK06765        115 ITTGPASINPKTGKPYGMDFPVVTILDFVRVQKELLEDLGIARLHAVMGPSMGGMQAQEWAVHYPHMVERMIGVIGNPQN  194 (387)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHCCHHHHHHHHHHHCCCC
T ss_conf             87899999989998665899940328899999999998398857211465818899999999795899889887630148


Q ss_pred             CCCCHHHHHHHHHHHHC------CCC-------CHHHH-------------HHHHHH-CCCCCCC---------------
Q ss_conf             31103569999998631------111-------00001-------------110000-0000347---------------
Q gi|254780166|r  136 YDSDVVDWQSLIDSFLL------PSI-------DEVQN-------------PLGKKF-RKFADLD---------------  173 (261)
Q Consensus       136 ~~~~~~~~~~~~~~~~~------~~~-------~~~~~-------------~~~~~~-~~~~~~~---------------  173 (261)
                      ........+.....+..      +..       ..+..             .....+ +......               
T Consensus       195 s~~~ia~~e~~r~aI~~Dp~w~~G~Y~~~~~P~~GL~~ar~~~~~~y~S~~~~~~~fgr~~~~~~~~~~~~~~~~vesyL  274 (387)
T PRK06765        195 DAWTSVNLAQWAIAIRLDPNWKGGKYYGEEQPLKGLTLANRMMTMNAFDEHFYETTFPRNSIEVEPYEKVSTLTSFEKEI  274 (387)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCHHCCCCHHHHHHHH
T ss_conf             99999999999999850943448877787895225999999999871599999988482345654210023126899999


Q ss_pred             --------CCCCHHHHHHHHHHHCCCC-------CHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHC----CCCEEEE
Q ss_conf             --------6654135677765410122-------00121003576069984788878807--9999967----9979999
Q gi|254780166|r  174 --------PGNDLKALASCLSMIRKPF-------CQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFI----PSSQYLN  232 (261)
Q Consensus       174 --------~~~~~~~~~~~~~~~~~~~-------~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~----p~~~~~~  232 (261)
                              ...+...+....+.+..+|       ..+.+++|++|+|+|..+.|...|+.  +++++.+    +++++.+
T Consensus       275 ~~~g~k~~~rfDaNsyL~l~ra~d~~Di~~~~~~l~~aL~~I~a~~Lvi~i~sD~lFpp~e~~e~~~~l~~~~~~~~~~e  354 (387)
T PRK06765        275 NKATYARAELVDANHWLYLAKAVQLFDAGHGFSSLEEALSNIEANVLMIPCKQDLLQPPRYNYKMVDILQKQGKYAEVYE  354 (387)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99998876535977899999987754655668889999973899889998577317698999999999985599879999


Q ss_pred             ECC-CCCCC-CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             888-87384-348489999999998751689
Q gi|254780166|r  233 ICR-RDHLL-AVGDKQFKQGVVNFYANELRA  261 (261)
Q Consensus       233 i~~-~gH~~-~~e~p~~~~~i~~Fl~~~~~~  261 (261)
                      |+. -||-. .+|.+++.+.|.+||.+++.+
T Consensus       355 I~S~~GHDaFLie~~~~~~~i~~FL~~~~~~  385 (387)
T PRK06765        355 IEGINGHMAGVFDIHLFEKKIYEFLNRKVSS  385 (387)
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             7999983610628999999999999876763


No 33 
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 2, TIGR03101) of the same superfamily.
Probab=99.84  E-value=2.5e-19  Score=134.02  Aligned_cols=239  Identities=16%  Similarity=0.126  Sum_probs=145.6

Q ss_pred             EEEEECCCCEEEEEEE--CCCCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             7999349949999996--48998789999878888001-22179999999868989999647655422222222222212
Q gi|254780166|r    6 KFFRSWRKYQFAFYDV--GDKDAPTILLIHGLASSVQT-NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV   82 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~--g~~~~~~vv~iHG~~~~~~~-~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~   82 (261)
                      -+.-+.+|.++.=.-.  ..+..+.||++||++++... ...+..+++.|+++||.|+.+|++|+|+|++..    .+++
T Consensus         4 ~~~~~~~g~~L~G~l~~p~~~~~~~vli~~~g~~~r~g~~r~~v~la~~la~~g~~~~rfd~~g~g~s~g~~----~~~~   79 (274)
T TIGR03100         4 ALTFSCEGETLVGVLHIPGASHTTGVLIVVGGPQYRVGSHRQFVLLARRLAEAGFPVLRFDYRGMGDSEGEN----LGFE   79 (274)
T ss_pred             EEEEECCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC----CCHH
T ss_conf             699965992899998379988887289988997666676427999999999789879997588887889887----8725


Q ss_pred             CCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHH--HHHHHHHHCCCC
Q ss_conf             2222222222222-----222222234434443101333210235652389628856331103569--999998631111
Q gi|254780166|r   83 FMAADAVSLLEHL-----GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW--QSLIDSFLLPSI  155 (261)
Q Consensus        83 ~~~~di~~~i~~l-----~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~--~~~~~~~~~~~~  155 (261)
                      ...+|+.+.++.+     +.++++++|||+||.+++.+|...| +|+++|+.+|............  ..+..++..+  
T Consensus        80 ~~~~D~~aA~d~~~~~~~~~~~ivl~G~c~Ga~~al~~a~~~~-~v~glvL~nPw~~~~~~~~~~~~~~~y~~rL~~~--  156 (274)
T TIGR03100        80 GIDADIAAAIDAFREAAPHLRRIVAWGLCDAASAALLYAPADL-RVAGLVLLNPWVRTEAAQAASRIRHYYLGQLLSA--  156 (274)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHHHHCCC-CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCH--
T ss_conf             5489999999999863778673799997687999998753278-8437999777446544310145556789885086--


Q ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH-----------HHCCCCCHHHHHCCCCCEEEEEECCCCCCCC-------
Q ss_conf             0000111000000003476654135677765-----------4101220012100357606998478887880-------
Q gi|254780166|r  156 DEVQNPLGKKFRKFADLDPGNDLKALASCLS-----------MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS-------  217 (261)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~-------  217 (261)
                      +.+.+-+...      ...+.....+.....           ........+.+.+.+.|+|+++|.+|..+..       
T Consensus       157 ~~w~kll~g~------v~~~~~~~gl~~~l~~~~~~~~~~~~~~~~~r~~~~l~~~~gpvLiV~g~~D~t~~~f~~~~~~  230 (274)
T TIGR03100       157 DFWRKLLSGE------VNLGSSLRGLGDALLKARQKGDEVAHGGLAERMKAGLERFQGPVLFILSGNDLTAQEFADSVLG  230 (274)
T ss_pred             HHHHHHCCCC------CCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             8776641576------5367776647888764210356654214789999999855998899988986740343666504


Q ss_pred             HHH--HHHHCCCCEEEEECCCCCCCCC-C-CHHHHHHHHHHHHH
Q ss_conf             799--9996799799998888738434-8-48999999999875
Q gi|254780166|r  218 PQE--LMSFIPSSQYLNICRRDHLLAV-G-DKQFKQGVVNFYAN  257 (261)
Q Consensus       218 ~~~--l~~~~p~~~~~~i~~~gH~~~~-e-~p~~~~~i~~Fl~~  257 (261)
                      .+.  .....|+.+.+++++++|.+.- + +.++.+.+.+||++
T Consensus       231 ~~~~~~l~~~p~~~~v~L~~ADHtFS~~~~r~~v~~~t~~Wl~r  274 (274)
T TIGR03100       231 EPAWRGALEDPGIERVEIDGADHTFSDRVWREWVAARTTEWLRR  274 (274)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             89999862089843998189998889889999999999999749


No 34 
>PRK08775 homoserine O-acetyltransferase; Provisional
Probab=99.83  E-value=1.6e-19  Score=135.18  Aligned_cols=241  Identities=16%  Similarity=0.193  Sum_probs=156.4

Q ss_pred             CEEEEEEECCCCCCEEEEECCCCCCCHHHH--------HHHHHH---HHHHHCCCEEEEECCCCC-CCCCCCCCCCCCCC
Q ss_conf             499999964899878999987888800122--------179999---999868989999647655-42222222222221
Q gi|254780166|r   14 YQFAFYDVGDKDAPTILLIHGLASSVQTNW--------LFSGWI---QLLCDQGFRVIAFDNLGH-GKSDKSYIENDYRL   81 (261)
Q Consensus        14 ~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~--------~~~~~~---~~l~~~g~~vi~~D~~G~-G~S~~~~~~~~~s~   81 (261)
                      .++.|..+|+.+.+.|+.+|++.++++..-        .|..++   ..+.-..|.|||.|..|- |-+.     .+.++
T Consensus        46 ~~~~yet~G~~~~navlv~HaLtg~~H~ag~~~~~~~GWWd~liGpGkaiDT~ryfVic~N~lG~~g~~~-----p~it~  120 (343)
T PRK08775         46 LRLRYELIGPANAPVVFVAGGISAHRHVAATANFPEKGWVEGLVGSGRALDPARRRLLAFDFLGADGSLD-----APIDT  120 (343)
T ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCC-----CCCCH
T ss_conf             3777765247899889990786773002589989989785235389988478876999746778887678-----99867


Q ss_pred             CCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHH----------
Q ss_conf             22222222222222222222-2344344431013332102356523896288563311035699999986----------
Q gi|254780166|r   82 VFMAADAVSLLEHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSF----------  150 (261)
Q Consensus        82 ~~~~~di~~~i~~l~~~~~~-liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~----------  150 (261)
                      .|+++-...++|+|++++++ +||.||||++++++|..||++++++|.+++.............-.....          
T Consensus       121 ~D~vraq~~Lld~LGI~~l~AVIGGSmGGMqALeWA~~yPd~V~~~i~IAt~~r~sa~~IA~~~vqR~AI~~d~~~~~g~  200 (343)
T PRK08775        121 ADQADAIAALLDALGIRRLHGFVGYSYGALVGLQFAIRHAARVRTLVVVSGAHRAHPYAAAWRALQRRAVALGQLQCAEH  200 (343)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHCHHHHHCEEEEECCCCCCHHHHHHHHHHHHHHHCCHHCCCCC
T ss_conf             89999999999862988674231578899999999986929663176751475279999999999999997180015864


Q ss_pred             ------------HCCCCCHHHHHHHHHHCCCC----------------CCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             ------------31111000011100000000----------------34766541356777654101220012100357
Q gi|254780166|r  151 ------------LLPSIDEVQNPLGKKFRKFA----------------DLDPGNDLKALASCLSMIRKPFCQDDLYRIDV  202 (261)
Q Consensus       151 ------------~~~~~~~~~~~~~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~  202 (261)
                                  ...+.+.+...+........                .....-+...|....+++..++.  .+++|.+
T Consensus       201 ~GLalARmia~iTYrS~~~~~~RF~~~~~~~~~~~~f~VEsYL~yqG~kf~~RFDaNsYl~LtrAmD~hd~--~~~~i~a  278 (343)
T PRK08775        201 HGLALARQFAMLSYRTPEEFEERFDAPPEVINGRVRVAAEDYLDAAGAQYVARTPVNAYLRLSESIDLHRV--DPAQVTV  278 (343)
T ss_pred             CHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCC--CHHHCCC
T ss_conf             07999999988871699999987588743447653201988999738999875690489999999875355--5654778


Q ss_pred             CEEEEEECCCCCCCCHH--HHHHHC-CCCEEEEEC-CCCC-CCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             60699847888788079--999967-997999988-8873-84348489999999998751689
Q gi|254780166|r  203 PVLIAVGSQDDLAGSPQ--ELMSFI-PSSQYLNIC-RRDH-LLAVGDKQFKQGVVNFYANELRA  261 (261)
Q Consensus       203 P~l~i~G~~D~~~~~~~--~l~~~~-p~~~~~~i~-~~gH-~~~~e~p~~~~~i~~Fl~~~~~~  261 (261)
                      |+|++.-+.|...|+.+  ++.+.+ +++++.+|+ .-|| -+.+|.+++...+.+||++.-++
T Consensus       279 ~~lvi~i~SD~LfP~~e~~~l~~~l~~~~~~~eI~S~~GHDaFLiE~e~v~~il~~fL~~~ge~  342 (343)
T PRK08775        279 PTVVVAVEGDRLVPLADLVALVEGLGPRGSLRVLRSPYGHDAFLKEIDRIDAILTTALRSTGET  342 (343)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             8799995786057999999999865889439998899983720067999999999999853778


No 35 
>KOG4667 consensus
Probab=99.82  E-value=1.9e-19  Score=134.69  Aligned_cols=219  Identities=19%  Similarity=0.236  Sum_probs=149.3

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CC
Q ss_conf             998789999878888001221799999998689899996476554222222222222122222222222222222---22
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGIS---KV  100 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~---~~  100 (261)
                      ++...+|++|||-++.. .-....++..|.+.|+.++.+|++|.|+|.+......|..+  ++|+..+++++.-.   --
T Consensus        31 gs~e~vvlcHGfrS~Kn-~~~~~~vA~~~e~~gis~fRfDF~GnGeS~gsf~~Gn~~~e--adDL~sV~q~~s~~nr~v~  107 (269)
T KOG4667          31 GSTEIVVLCHGFRSHKN-AIIMKNVAKALEKEGISAFRFDFSGNGESEGSFYYGNYNTE--ADDLHSVIQYFSNSNRVVP  107 (269)
T ss_pred             CCCEEEEEEECCCCCCC-HHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCH--HHHHHHHHHHHCCCCEEEE
T ss_conf             88339999504544541-58999999999863724899985578776774046766322--7789999998606766788


Q ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHH--HHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCH
Q ss_conf             2234434443101333210235652389628856331103569--99999863111100001110000000034766541
Q gi|254780166|r  101 HVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW--QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL  178 (261)
Q Consensus       101 ~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  178 (261)
                      +++|||-||.+++.+++++++ ++-+|.|+........ ..+.  +........++.-.....           ......
T Consensus       108 vi~gHSkGg~Vvl~ya~K~~d-~~~viNcsGRydl~~~-I~eRlg~~~l~~ike~Gfid~~~r-----------kG~y~~  174 (269)
T KOG4667         108 VILGHSKGGDVVLLYASKYHD-IRNVINCSGRYDLKNG-INERLGEDYLERIKEQGFIDVGPR-----------KGKYGY  174 (269)
T ss_pred             EEEEECCCCHHHHHHHHHHCC-CHHEEECCCCCCHHCC-HHHHHCCCHHHHHHHCCCEECCCC-----------CCCCCC
T ss_conf             998506752899998876058-0236874564120112-665513328999985884305765-----------698672


Q ss_pred             HHHHHHHHHHCCCCCHHHHHCC--CCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             3567776541012200121003--57606998478887880--7999996799799998888738434848999999999
Q gi|254780166|r  179 KALASCLSMIRKPFCQDDLYRI--DVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF  254 (261)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~l~~i--~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~F  254 (261)
                      ......+......+..+...+|  +||+|-++|..|.++|.  +.++++.+|+-++.+|+|++|.....+.+++...++|
T Consensus       175 rvt~eSlmdrLntd~h~aclkId~~C~VLTvhGs~D~IVPve~AkefAk~i~nH~L~iIEgADHnyt~~q~~l~~lgl~f  254 (269)
T KOG4667         175 RVTEESLMDRLNTDIHEACLKIDKQCRVLTVHGSEDEIVPVEDAKEFAKIIPNHKLEIIEGADHNYTGHQSQLVSLGLEF  254 (269)
T ss_pred             EECHHHHHHHHHCHHHHHHCCCCCCCCEEEEECCCCCEEECHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHCCEE
T ss_conf             64278888787230436634867667169984367836661547999985668845873488767421054676610046


Q ss_pred             HHHH
Q ss_conf             8751
Q gi|254780166|r  255 YANE  258 (261)
Q Consensus       255 l~~~  258 (261)
                      .+-.
T Consensus       255 ~k~r  258 (269)
T KOG4667         255 IKTR  258 (269)
T ss_pred             EEEE
T ss_conf             8753


No 36 
>KOG2564 consensus
Probab=99.80  E-value=1.6e-19  Score=135.14  Aligned_cols=231  Identities=21%  Similarity=0.276  Sum_probs=136.8

Q ss_pred             EEEEEEC--CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9999964--899878999987888800122179999999868-9899996476554222222222222122222222222
Q gi|254780166|r   16 FAFYDVG--DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ-GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLL   92 (261)
Q Consensus        16 l~y~~~g--~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~-g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i   92 (261)
                      +..|..+  ...+|.++++||+|.|+-+   |..++.++..+ .-+|+++|+||||+|.. .+..+.|.+.+++|+.+++
T Consensus        62 ~n~Y~t~~~~t~gpil~l~HG~G~S~LS---fA~~a~el~s~~~~r~~a~DlRgHGeTk~-~~e~dlS~eT~~KD~~~~i  137 (343)
T KOG2564          62 FNVYLTLPSATEGPILLLLHGGGSSALS---FAIFASELKSKIRCRCLALDLRGHGETKV-ENEDDLSLETMSKDFGAVI  137 (343)
T ss_pred             EEEEEECCCCCCCCEEEEEECCCCCCHH---HHHHHHHHHHHCCEEEEEEECCCCCCCCC-CCHHHCCHHHHHHHHHHHH
T ss_conf             7788814788876579996058643020---79999999864140498750345676546-8846527888888999999


Q ss_pred             CCC---CCCCCCCCCCCCCCCCHHHHHHHC--CCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCC---HHHHHHHH
Q ss_conf             222---222222234434443101333210--2356523896288563311035699999986311110---00011100
Q gi|254780166|r   93 EHL---GISKVHVMGYSMGARIACSMVLFY--PSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID---EVQNPLGK  164 (261)
Q Consensus        93 ~~l---~~~~~~liGhS~Gg~ia~~~a~~~--p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~  164 (261)
                      +++   ...+++||||||||.++...|...  |. +.+|+.++....    ...+....+..+......   .+.+...+
T Consensus       138 ~~~fge~~~~iilVGHSmGGaIav~~a~~k~lps-l~Gl~viDVVEg----tAmeAL~~m~~fL~~rP~~F~Si~~Ai~W  212 (343)
T KOG2564         138 KELFGELPPQIILVGHSMGGAIAVHTAASKTLPS-LAGLVVIDVVEG----TAMEALNSMQHFLRNRPKSFKSIEDAIEW  212 (343)
T ss_pred             HHHHCCCCCCEEEEECCCCCHHHHHHHHHHHCHH-HHCEEEEEEECH----HHHHHHHHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             9983568986699842666233230656522223-306389987525----79999887788875598522234667788


Q ss_pred             HHC----------------CCCCCCCC------CCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHH
Q ss_conf             000----------------00034766------54135677765410122001210035760699847888788079999
Q gi|254780166|r  165 KFR----------------KFADLDPG------NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM  222 (261)
Q Consensus       165 ~~~----------------~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~  222 (261)
                      ..+                .+.....+      .+......++..|.. ...+.+-...+|-|+|....|..-..- .+.
T Consensus       213 ~v~sg~~Rn~~SArVsmP~~~~~~~eGh~yvwrtdL~kte~YW~gWF~-gLS~~Fl~~p~~klLilAg~d~LDkdL-tiG  290 (343)
T KOG2564         213 HVRSGQLRNRDSARVSMPSQLKQCEEGHCYVWRTDLEKTEQYWKGWFK-GLSDKFLGLPVPKLLILAGVDRLDKDL-TIG  290 (343)
T ss_pred             HHCCCCCCCCCCCEEECCHHEEECCCCCCEEEEEECCCCCHHHHHHHH-HHHHHHHCCCCCCEEEEECCCCCCCCE-EEE
T ss_conf             860251016564157443230442678737999643132156777774-000675279766246772234467631-566


Q ss_pred             HHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             96799799998888738434848-999999999875
Q gi|254780166|r  223 SFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYAN  257 (261)
Q Consensus       223 ~~~p~~~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~~  257 (261)
                      ..-..-++.+++.+||+.+.+.| ++.+.+..|+.+
T Consensus       291 QMQGk~Q~~vL~~~GH~v~ED~P~kva~~~~~f~~R  326 (343)
T KOG2564         291 QMQGKFQLQVLPLCGHFVHEDSPHKVAECLCVFWIR  326 (343)
T ss_pred             EECCCEEEEEECCCCCEECCCCCCHHHHHHHHHHHH
T ss_conf             532524566300127123147860479988788755


No 37 
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]
Probab=99.80  E-value=2.3e-18  Score=128.27  Aligned_cols=229  Identities=17%  Similarity=0.191  Sum_probs=139.0

Q ss_pred             CEEEEEECCCCEEEEEEECCC--C----CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCC---CCCCCCCC
Q ss_conf             407999349949999996489--9----87899998788880012217999999986898999964765---54222222
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGDK--D----APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG---HGKSDKSY   74 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~~--~----~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G---~G~S~~~~   74 (261)
                      +...+.+.||.+++.+...++  +    -|.||++||.+..... +.+....+.|+.+||-|+.++.||   ||+.-...
T Consensus       366 e~~~~~~~dG~~i~~~l~~P~~~~~~k~yP~i~~~hGGP~~~~~-~~~~~~~q~~~~~G~~V~~~n~RGS~GyG~~F~~~  444 (620)
T COG1506         366 EPVTYKSNDGETIHGWLYKPPGFDPRKKYPLIVYIHGGPSAQVG-YSFNPEIQVLASAGYAVLAPNYRGSTGYGREFADA  444 (620)
T ss_pred             EEEEEECCCCCEEEEEEEECCCCCCCCCCCEEEEECCCCCCCCC-CCCCHHHHHHHHCCEEEEECCCCCCCCCCHHHHHH
T ss_conf             48998679984888999806887866778889997889863654-65058889998599299942688878852333443


Q ss_pred             CCCCCCCCCCCCCCCCCCC---CC---CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEE-EECCCCCCCCCCHHHHHHHH
Q ss_conf             2222221222222222222---22---22222223443444310133321023565238-96288563311035699999
Q gi|254780166|r   75 IENDYRLVFMAADAVSLLE---HL---GISKVHVMGYSMGARIACSMVLFYPSYVRSVI-LGGVGSVLYDSDVVDWQSLI  147 (261)
Q Consensus        75 ~~~~~s~~~~~~di~~~i~---~l---~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lv-l~~~~~~~~~~~~~~~~~~~  147 (261)
                      ...++.. ...+|+.+.++   ..   .-+++.+.|||+||++++..+...| +++..+ ..+...........      
T Consensus       445 ~~~~~g~-~~~~D~~~~~~~l~~~~~~d~~ri~i~G~SyGGymtl~~~~~~~-~f~a~~~~~~~~~~~~~~~~~------  516 (620)
T COG1506         445 IRGDWGG-VDLEDLIAAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGES------  516 (620)
T ss_pred             CCCCCCC-CCHHHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHCCC-CCEEEEEECCCCHHHHHHHCC------
T ss_conf             0366576-75999999999999778866102599820889999999986588-625999915641035664036------


Q ss_pred             HHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHH-
Q ss_conf             9863111100001110000000034766541356777654101220012100357606998478887880--7999996-
Q gi|254780166|r  148 DSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSF-  224 (261)
Q Consensus       148 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~-  224 (261)
                                 .......++......+. +...       ......-....+|++|+|+|||++|..++.  ++++.+. 
T Consensus       517 -----------~~~~~~~~~~~~~~~~~-~~~~-------~~~~sp~~~~~~i~~P~LliHG~~D~~v~~~q~~~~~~aL  577 (620)
T COG1506         517 -----------TEGLRFDPEENGGGPPE-DREK-------YEDRSPIFYADNIKTPLLLIHGEEDDRVPIEQAEQLVDAL  577 (620)
T ss_pred             -----------CHHHCCCHHHHCCCCCC-CHHH-------HHHHCCHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             -----------71431487876468754-4588-------8762956354025798799832788788979999999999


Q ss_pred             ---CCCCEEEEECCCCCCCCC-CC-HHHHHHHHHHHHHHCC
Q ss_conf             ---799799998888738434-84-8999999999875168
Q gi|254780166|r  225 ---IPSSQYLNICRRDHLLAV-GD-KQFKQGVVNFYANELR  260 (261)
Q Consensus       225 ---~p~~~~~~i~~~gH~~~~-e~-p~~~~~i~~Fl~~~~~  260 (261)
                         -...+++++|+.+|.+.- ++ -+..+.+++|+++.++
T Consensus       578 ~~~g~~~~~~~~p~e~H~~~~~~~~~~~~~~~~~~~~~~~~  618 (620)
T COG1506         578 KRKGKPVELVVFPDEGHGFSRPENRVKVLKEILDWFKRHLK  618 (620)
T ss_pred             HHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             97797589999579998878468899999999999998745


No 38 
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism]
Probab=99.77  E-value=3.2e-18  Score=127.44  Aligned_cols=246  Identities=21%  Similarity=0.220  Sum_probs=154.5

Q ss_pred             CCCCEEEEEEECCCCC---CEEEEECCCCCCCHHHH--------HHHHHH---HHHHHCCCEEEEECCCCCC-CCCCCCC
Q ss_conf             4994999999648998---78999987888800122--------179999---9998689899996476554-2222222
Q gi|254780166|r   11 WRKYQFAFYDVGDKDA---PTILLIHGLASSVQTNW--------LFSGWI---QLLCDQGFRVIAFDNLGHG-KSDKSYI   75 (261)
Q Consensus        11 ~dG~~l~y~~~g~~~~---~~vv~iHG~~~~~~~~~--------~~~~~~---~~l~~~g~~vi~~D~~G~G-~S~~~~~   75 (261)
                      -++.++.|..+|..++   ..|+.+||+.++++...        .|..++   ..+....|.||+.|..|.+ -|++|..
T Consensus        33 l~~~~vay~T~Gtln~~~~NaVli~HaLtG~~h~~~~~~~~~~GWW~~liGpG~~iDt~r~fvIc~NvlG~c~GStgP~s  112 (368)
T COG2021          33 LSDARVAYETYGTLNAEKDNAVLICHALTGDSHAAGTADDGEKGWWDDLIGPGKPIDTERFFVICTNVLGGCKGSTGPSS  112 (368)
T ss_pred             CCCCEEEEEECCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCCCCC
T ss_conf             35747899832434666775699935656763124668877776188724899877802169998147788878999887


Q ss_pred             CC-----------CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHH
Q ss_conf             22-----------222122222222222222222222-234434443101333210235652389628856331103569
Q gi|254780166|r   76 EN-----------DYRLVFMAADAVSLLEHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW  143 (261)
Q Consensus        76 ~~-----------~~s~~~~~~di~~~i~~l~~~~~~-liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~  143 (261)
                      ..           .++++|+++--..++++|+++++. +||-||||+.+++++..||++|++++.++.+......... |
T Consensus       113 ~~p~g~~yg~~FP~~ti~D~V~aq~~ll~~LGI~~l~avvGgSmGGMqaleWa~~yPd~V~~~i~ia~~~r~s~~~ia-~  191 (368)
T COG2021         113 INPGGKPYGSDFPVITIRDMVRAQRLLLDALGIKKLAAVVGGSMGGMQALEWAIRYPDRVRRAIPIATAARLSAQNIA-F  191 (368)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCHHHHHHHHEECCCCCCCHHHHH-H
T ss_conf             687778256679833189999999999986294046100245758799999998691987545201344457889999-9


Q ss_pred             HHHHHHHHCCCCCH-------HHHH-----HHHH-----------H-CCCCC---C-----------------------C
Q ss_conf             99999863111100-------0011-----1000-----------0-00003---4-----------------------7
Q gi|254780166|r  144 QSLIDSFLLPSIDE-------VQNP-----LGKK-----------F-RKFAD---L-----------------------D  173 (261)
Q Consensus       144 ~~~~~~~~~~~~~~-------~~~~-----~~~~-----------~-~~~~~---~-----------------------~  173 (261)
                      .....+-.....+.       -..|     ..++           + ++|..   .                       .
T Consensus       192 ~~~~r~AI~~DP~~n~G~Y~~~~~P~~GL~~AR~l~~ltYrS~~~~~~rF~r~~~~~~~~~~~~~f~vESYL~~qg~kf~  271 (368)
T COG2021         192 NEVQRQAIEADPDWNGGDYYEGTQPERGLRLARMLAHLTYRSEEELDERFGRRLQADPLRGGGVRFAVESYLDYQGDKFV  271 (368)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999739875577766887831468999999999746989999884644544556788606899999999877887


Q ss_pred             CCCCHHHHHHHHHHHCCCCCHHH-------HHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCCE-EEEEC-CCCCCCCC
Q ss_conf             66541356777654101220012-------1003576069984788878807--99999679979-99988-88738434
Q gi|254780166|r  174 PGNDLKALASCLSMIRKPFCQDD-------LYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQ-YLNIC-RRDHLLAV  242 (261)
Q Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~-------l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~-~~~i~-~~gH~~~~  242 (261)
                      ..-+...+....+++..+|....       |++|++|+|++-=+.|...|+.  +++++.++.+. +.+|+ ..||-.++
T Consensus       272 ~rfDaNsYL~lt~ald~~D~s~~~~~l~~al~~i~~~~lv~gi~sD~lfp~~~~~~~~~~L~~~~~~~~i~S~~GHDaFL  351 (368)
T COG2021         272 ARFDANSYLYLTRALDYHDVSRGRGDLTAALARIKAPVLVVGITSDWLFPPELQRALAEALPAAGALREIDSPYGHDAFL  351 (368)
T ss_pred             HCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCCHHHH
T ss_conf             60584039999988773188777675888974576677999724455579899999998545567458845888843242


Q ss_pred             -CCHHHHHHHHHHHHH
Q ss_conf             -848999999999875
Q gi|254780166|r  243 -GDKQFKQGVVNFYAN  257 (261)
Q Consensus       243 -e~p~~~~~i~~Fl~~  257 (261)
                       |.+.+...|..||++
T Consensus       352 ~e~~~~~~~i~~fL~~  367 (368)
T COG2021         352 VESEAVGPLIRKFLAL  367 (368)
T ss_pred             CCHHHHHHHHHHHHHC
T ss_conf             0465666999998623


No 39 
>KOG2931 consensus
Probab=99.77  E-value=1.7e-17  Score=123.06  Aligned_cols=235  Identities=18%  Similarity=0.264  Sum_probs=158.6

Q ss_pred             CEEEEEEECCCC--CCEEEEECCCCCCCHHHHHHHH-----HHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC---CCCC
Q ss_conf             499999964899--8789999878888001221799-----99999868989999647655422222222222---2122
Q gi|254780166|r   14 YQFAFYDVGDKD--APTILLIHGLASSVQTNWLFSG-----WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY---RLVF   83 (261)
Q Consensus        14 ~~l~y~~~g~~~--~~~vv~iHG~~~~~~~~~~~~~-----~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~---s~~~   83 (261)
                      --+|+..+|+++  +|.+|=.|..|.++.+  +|..     .+..+.++ |.++.+|-|||-+-+ |..+.+|   |+++
T Consensus        32 G~v~V~V~Gd~~~~kpaiiTyhDlglN~~s--cFq~ff~~p~m~ei~~~-fcv~HV~~PGqe~gA-p~~p~~y~yPsmd~  107 (326)
T KOG2931          32 GVVHVTVYGDPKGNKPAIITYHDLGLNHKS--CFQGFFNFPDMAEILEH-FCVYHVDAPGQEDGA-PSFPEGYPYPSMDD  107 (326)
T ss_pred             CCEEEEEECCCCCCCCEEEEECCCCCCHHH--HHHHHHCCHHHHHHHHH-EEEEECCCCCCCCCC-CCCCCCCCCCCHHH
T ss_conf             637999965787788669983365644476--76776258858999863-189943798431378-66878998888899


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHH--HHHHHHH-CCCCC-HH-
Q ss_conf             2222222222222222222344344431013332102356523896288563311035699--9999863-11110-00-
Q gi|254780166|r   84 MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ--SLIDSFL-LPSID-EV-  158 (261)
Q Consensus        84 ~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~--~~~~~~~-~~~~~-~~-  158 (261)
                      .++++..++++++++.++-+|.--|++|..++|..||+||-+|||+++.+.-  +.+.+|.  +....+. ...+. .. 
T Consensus       108 LAd~l~~VL~~f~lk~vIg~GvGAGAyIL~rFAl~hp~rV~GLvLIn~~~~a--~gwiew~~~K~~s~~l~~~Gmt~~~~  185 (326)
T KOG2931         108 LADMLPEVLDHFGLKSVIGMGVGAGAYILARFALNHPERVLGLVLINCDPCA--KGWIEWAYNKVSSNLLYYYGMTQGVK  185 (326)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCHHHEEEEEEEECCCCC--CHHHHHHHHHHHHHHHHHHCHHHHHH
T ss_conf             9988999987617443799513400999999885294255679998327897--33899999998777877603221189


Q ss_pred             ---------------HHHHHHHHCCCCCCCC-CCCHHHHHHHHHHHCCCCCHHHHH----CCCCCEEEEEECCCCCCCCH
Q ss_conf             ---------------0111000000003476-654135677765410122001210----03576069984788878807
Q gi|254780166|r  159 ---------------QNPLGKKFRKFADLDP-GNDLKALASCLSMIRKPFCQDDLY----RIDVPVLIAVGSQDDLAGSP  218 (261)
Q Consensus       159 ---------------~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~----~i~~P~l~i~G~~D~~~~~~  218 (261)
                                     ....-..+|+...... ..+..-+.+.+.  .+.|......    .++||+|++.|++.+.+...
T Consensus       186 d~ll~H~Fg~e~~~~~~diVq~Yr~~l~~~~N~~Nl~~fl~ayn--~R~DL~~~r~~~~~tlkc~vllvvGd~Sp~~~~v  263 (326)
T KOG2931         186 DYLLAHHFGKEELGNNSDIVQEYRQHLGERLNPKNLALFLNAYN--GRRDLSIERPKLGTTLKCPVLLVVGDNSPHVSAV  263 (326)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHC--CCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHH
T ss_conf             99999883424001547899999999873588267999999861--7877643478757630024799944898015556


Q ss_pred             HHHHHHC--CCCEEEEECCCCCCCCCCCH-HHHHHHHHHHH
Q ss_conf             9999967--99799998888738434848-99999999987
Q gi|254780166|r  219 QELMSFI--PSSQYLNICRRDHLLAVGDK-QFKQGVVNFYA  256 (261)
Q Consensus       219 ~~l~~~~--p~~~~~~i~~~gH~~~~e~p-~~~~~i~~Fl~  256 (261)
                      .++...+  .++.+..+.++|-++..++| .+.+.+.=|++
T Consensus       264 v~~n~~Ldp~~ttllk~~d~g~l~~e~qP~kl~ea~~~Flq  304 (326)
T KOG2931         264 VECNSKLDPTYTTLLKMADCGGLVQEEQPGKLAEAFKYFLQ  304 (326)
T ss_pred             HHHHCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             65421458654408997255785433485679999999974


No 40 
>pfam06342 DUF1057 Alpha/beta hydrolase of unknown function (DUF1057). This family consists of several Caenorhabditis elegans specific proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Probab=99.76  E-value=3.5e-17  Score=121.20  Aligned_cols=238  Identities=14%  Similarity=0.111  Sum_probs=150.3

Q ss_pred             ECCCCEE----EEEEECCCCCC--EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3499499----99996489987--89999878888001221799999998689899996476554222222222222122
Q gi|254780166|r   10 SWRKYQF----AFYDVGDKDAP--TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF   83 (261)
Q Consensus        10 ~~dG~~l----~y~~~g~~~~~--~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~   83 (261)
                      +.+|..+    -|.+..+.+.|  |||.+||.+||+.+   |+-+.+.|.+.|.|+|.+++||+|.++++. ...|+-..
T Consensus        13 ~~~~k~v~v~A~y~D~~~~gs~~GTVV~~HGsPGSH~D---FkYi~~~l~~~~iR~IgiN~PGf~~t~~~~-~~~ytn~~   88 (297)
T pfam06342        13 TELGKTVEVQAVYEDSLTSGSPFGTVVAFHGSPGSHND---FKYIRSKFEDLNIRFIGVNYPGFEFTTGYP-GQSHTNQE   88 (297)
T ss_pred             HHCCCEEEEEEEEEECCCCCCCCEEEEEECCCCCCCCC---HHHHHHHHHHCCEEEEEECCCCCCCCCCCC-CCCCCCHH
T ss_conf             50485688888998448999875279995389997422---677666676639179996689876788974-34557577


Q ss_pred             CCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHH--HHHHHHHHCCCCCHHHH
Q ss_conf             222222222222222-222234434443101333210235652389628856331103569--99999863111100001
Q gi|254780166|r   84 MAADAVSLLEHLGIS-KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW--QSLIDSFLLPSIDEVQN  160 (261)
Q Consensus        84 ~~~di~~~i~~l~~~-~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~  160 (261)
                      ...-+.++++.++++ +++++|||+||-.|++.+..+|  +.+++++++............  -...+.+...-....-+
T Consensus        89 r~~~~~all~~l~i~~~~i~~GHSrGce~al~~~~~~p--~~g~vlin~~G~rpH~gi~P~~r~~~i~~v~~~L~~~l~~  166 (297)
T pfam06342        89 RNSYSKALLEELELKGKLIIMGHSRGCENALQTATTRP--AHGLVMINPTGFRIHKGIRPKSRMETINWVYKLLPLFLGD  166 (297)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHCCC--CCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999997287772599985552477888762587--6148986478766666768178999999999998999999


Q ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHH------HHCCCCCEEEEEECCCCCCCCH--HHHH----------
Q ss_conf             110000000034766541356777654101220012------1003576069984788878807--9999----------
Q gi|254780166|r  161 PLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD------LYRIDVPVLIAVGSQDDLAGSP--QELM----------  222 (261)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------l~~i~~P~l~i~G~~D~~~~~~--~~l~----------  222 (261)
                      .....+.+........ -+.....++.....+...+      +.+-++|+++..|.+|.++...  .+.+          
T Consensus       167 ~i~~~~y~~~GfkV~~-Geea~~air~~~~~~f~~q~~~I~~l~~k~~k~li~fg~~D~LiEeeI~~E~~~~~~~l~h~~  245 (297)
T pfam06342       167 SILYFYYKSVGLKVSD-GEEAAAAMRSMQTFALEEQLESIDKLNEKPTKTFIVFGGKDHLVEEEIVFEALMKFSGLDHFN  245 (297)
T ss_pred             HHHHHHHHHHCCCCCC-HHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCHHHEE
T ss_conf             9999999982700477-489999888773007467788999961889857999747643457899999998518725500


Q ss_pred             --------------HHCC---CCEEEEECCCCCCCCCCCHHHH-HHHHHH
Q ss_conf             --------------9679---9799998888738434848999-999999
Q gi|254780166|r  223 --------------SFIP---SSQYLNICRRDHLLAVGDKQFK-QGVVNF  254 (261)
Q Consensus       223 --------------~~~p---~~~~~~i~~~gH~~~~e~p~~~-~~i~~F  254 (261)
                                    ..+.   ....+.+.+.||+.+=-++++. +.+...
T Consensus       246 ~~~~~~e~~~~kI~~~~~~gq~~~sVf~~~~gHy~qK~~A~~iae~~~~m  295 (297)
T pfam06342       246 IDKEISEEEIKKILKSFTGGQKGASVFVAKDGHFQNKTRAELVAEVVKSI  295 (297)
T ss_pred             ECCCCCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHH
T ss_conf             00147545689999997456761599982687157665389999999985


No 41 
>KOG1838 consensus
Probab=99.76  E-value=4.4e-17  Score=120.63  Aligned_cols=252  Identities=15%  Similarity=0.241  Sum_probs=160.0

Q ss_pred             CEEEEEECCCCEEEEEEE--CC-------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC
Q ss_conf             407999349949999996--48-------998789999878888001221799999998689899996476554222222
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDV--GD-------KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY   74 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~--g~-------~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~   74 (261)
                      +.++++..||-.+.+-..  .+       ++.|+||++||..++.+..+ ...++...+++||+|++++.||+|.|.-. 
T Consensus        94 ~Reii~~~DGG~~~lDW~~~~~~~~~~~~~~~P~vvilpGltg~S~~~Y-Vr~lv~~a~~~G~r~VVfN~RG~~g~~Lt-  171 (409)
T KOG1838          94 TREIIKTSDGGTVTLDWVENPDSRCRTDDGTDPIVVILPGLTGGSHESY-VRHLVHEAQRKGYRVVVFNHRGLGGSKLT-  171 (409)
T ss_pred             EEEEEEECCCCEEEEEECCCCCCCCCCCCCCCCEEEEECCCCCCCHHHH-HHHHHHHHHHCCCEEEEECCCCCCCCCCC-
T ss_conf             4689992799889886224753235777899757999468889871379-99999999867967999878877887467-


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCHHHHHHHCCC---CCCCEEEECCCCCCCCC---CHHHHH
Q ss_conf             22222212222222222222222----222223443444310133321023---56523896288563311---035699
Q gi|254780166|r   75 IENDYRLVFMAADAVSLLEHLGI----SKVHVMGYSMGARIACSMVLFYPS---YVRSVILGGVGSVLYDS---DVVDWQ  144 (261)
Q Consensus        75 ~~~~~s~~~~~~di~~~i~~l~~----~~~~liGhS~Gg~ia~~~a~~~p~---~v~~lvl~~~~~~~~~~---~~~~~~  144 (261)
                      .+.-|+ .-+.+|+.+++++++-    .+...+|.||||.+...|..+..+   .+.++.+|++-......   .....+
T Consensus       172 Tpr~f~-ag~t~Dl~~~v~~i~~~~P~a~l~avG~S~Gg~iL~nYLGE~g~~~~l~~a~~v~~Pwd~~~~~~~~~~~~~~  250 (409)
T KOG1838         172 TPRLFT-AGWTEDLREVVNHIKKRYPQAPLFAVGFSMGGNILTNYLGEEGDNTPLIAAVAVCNPWDLLAASRSIETPLYR  250 (409)
T ss_pred             CCCEEE-CCCHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHCCCCCCCEEEEEEECCCHHHHHHHHHHCCCCH
T ss_conf             876650-4787899999999997489984489985440999999866416778840578972540456666677515206


Q ss_pred             HHHHHHHCCCCCHHHHHHH----------------HHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEE
Q ss_conf             9999863111100001110----------------000000034766541356777654101220012100357606998
Q gi|254780166|r  145 SLIDSFLLPSIDEVQNPLG----------------KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV  208 (261)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~  208 (261)
                      +..++.....+........                +..|.|-+... ...-++..+....+.......+.+|.+|+|+|.
T Consensus       251 ~~y~~~l~~~l~~~~~~~r~~~~~~~vd~d~~~~~~SvreFD~~~t-~~~~gf~~~deYY~~aSs~~~v~~I~VP~L~in  329 (409)
T KOG1838         251 RFYNRALTLNLKRIVLRHRHTLFEDPVDFDVILKSRSVREFDEALT-RPMFGFKSVDEYYKKASSSNYVDKIKVPLLCIN  329 (409)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCHHHHHHHHH-HHHCCCCCHHHHHHHCCHHHHCCCCCCCEEEEE
T ss_conf             7889999876788876313666505113331030183988876553-242688868999860553543455424579985


Q ss_pred             ECCCCCCCC---HHHHHHHCCCCEEEEECCCCCCCCCCC--H---HHHHH-HHHHHHHHC
Q ss_conf             478887880---799999679979999888873843484--8---99999-999987516
Q gi|254780166|r  209 GSQDDLAGS---PQELMSFIPSSQYLNICRRDHLLAVGD--K---QFKQG-VVNFYANEL  259 (261)
Q Consensus       209 G~~D~~~~~---~~~l~~~~p~~~~~~i~~~gH~~~~e~--p---~~~~~-i~~Fl~~~~  259 (261)
                      ..+|+++|+   +...++..|+.=+++-..+||...+|.  |   ...+. +.+|+...+
T Consensus       330 a~DDPv~p~~~ip~~~~~~np~v~l~~T~~GGHlgfleg~~p~~~~w~~~~l~ef~~~~~  389 (409)
T KOG1838         330 AADDPVVPEEAIPIDDIKSNPNVLLVITSHGGHLGFLEGLWPSARTWMDKLLVEFLGNAI  389 (409)
T ss_pred             CCCCCCCCCCCCCHHHHHCCCCEEEEEECCCCEEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             688997880328989984499589999579864665126787654259999999999887


No 42 
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase; InterPro: IPR006296   This family describes homoserine-O-acetyltransferase, an enzyme of methionine biosynthesis. The family does not contain a number of homologs that appear to represent sequences derived from within the family but to have changed substantially.; GO: 0004414 homoserine O-acetyltransferase activity, 0009086 methionine biosynthetic process.
Probab=99.73  E-value=1.5e-17  Score=123.48  Aligned_cols=245  Identities=18%  Similarity=0.254  Sum_probs=155.9

Q ss_pred             ECCCCEEEEEEEC--CCC-CC-EEEEECCCCCCCHHHH----------HHHHHH---HHHHHCCCEEEEECCCC--CCCC
Q ss_conf             3499499999964--899-87-8999987888800122----------179999---99986898999964765--5422
Q gi|254780166|r   10 SWRKYQFAFYDVG--DKD-AP-TILLIHGLASSVQTNW----------LFSGWI---QLLCDQGFRVIAFDNLG--HGKS   70 (261)
Q Consensus        10 ~~dG~~l~y~~~g--~~~-~~-~vv~iHG~~~~~~~~~----------~~~~~~---~~l~~~g~~vi~~D~~G--~G~S   70 (261)
                      +-+..++.|..||  +.+ +- .||.+|...|+++..-          .|..++   ..+-..-|.|||.+-+|  +| |
T Consensus        12 ~L~~~~~aY~TyGtLn~~~rsNavLvCHALTG~aHvag~~~~~~~~pGWW~~l~GPGraiDT~ryFvvc~NvlGgC~G-S   90 (395)
T TIGR01392        12 VLPDVRVAYETYGTLNAEDRSNAVLVCHALTGDAHVAGRADDDDKTPGWWDDLIGPGRAIDTDRYFVVCSNVLGGCYG-S   90 (395)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCC-C
T ss_conf             038850798737621514699779998425788676688755556678876667888746747446887276878886-7


Q ss_pred             CCCCC-------CCC-------CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             22222-------222-------221222222222222222222-222344344431013332102356523896288563
Q gi|254780166|r   71 DKSYI-------END-------YRLVFMAADAVSLLEHLGISK-VHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL  135 (261)
Q Consensus        71 ~~~~~-------~~~-------~s~~~~~~di~~~i~~l~~~~-~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~  135 (261)
                      ++|..       -.+       .|+.|+|+-=..|+|+|||++ ..+||=||||+.++++|..|||+|+++|.+++++..
T Consensus        91 tGP~S~nP~te~G~pYG~~FP~~TirD~V~~q~~llD~LGi~~~aaVvGGSmGGM~aLEWA~~YPe~v~~~~~~A~saR~  170 (395)
T TIGR01392        91 TGPLSINPDTETGKPYGPDFPLITIRDIVRAQRLLLDHLGIERIAAVVGGSMGGMQALEWAISYPERVRAIVVLATSARH  170 (395)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCC
T ss_conf             88788867688887252346864456589999999987597189987516731468999872276688888875142015


Q ss_pred             CCCCHHHHHHHH--------------------------------HHHHCCCCCHHHHHHHHHHCCCC-------------
Q ss_conf             311035699999--------------------------------98631111000011100000000-------------
Q gi|254780166|r  136 YDSDVVDWQSLI--------------------------------DSFLLPSIDEVQNPLGKKFRKFA-------------  170 (261)
Q Consensus       136 ~~~~~~~~~~~~--------------------------------~~~~~~~~~~~~~~~~~~~~~~~-------------  170 (261)
                      -..... |....                                .-+...+.+.+.+.+.+....-.             
T Consensus       171 sa~~Ia-~~~~~RqAI~~DP~w~~G~Y~~~~~~P~~GLa~ARm~ah~TYrs~~~~~~rFgR~~~~~~~~~~~~R~TPT~S  249 (395)
T TIGR01392       171 SAWCIA-FNEVQRQAILADPDWNDGDYYEEGQQPDKGLALARMLAHLTYRSEESLEKRFGRETQSNETALKADRETPTVS  249 (395)
T ss_pred             CHHHHH-HHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
T ss_conf             887778-9999999975170215688798887615689999997302114837898640678877444677777755866


Q ss_pred             --------------------CC-----------------------CCCCCHHHHHHHHHHHCCCC--------CHHHHHC
Q ss_conf             --------------------34-----------------------76654135677765410122--------0012100
Q gi|254780166|r  171 --------------------DL-----------------------DPGNDLKALASCLSMIRKPF--------CQDDLYR  199 (261)
Q Consensus       171 --------------------~~-----------------------~~~~~~~~~~~~~~~~~~~~--------~~~~l~~  199 (261)
                                          ..                       ...-+-..|....+++..+|        ..+.|++
T Consensus       250 ~~~~~~HN~~nS~~~~~~~~~~~~~~R~~~~F~veSYL~YQG~KFv~RFDANSYl~lT~AlD~hD~grg~~~~~~~AL~~  329 (395)
T TIGR01392       250 EASLVVHNEGNSQDAKKEVNSPASGFRADGRFQVESYLRYQGDKFVDRFDANSYLYLTRALDTHDLGRGRRGSLTEALAA  329 (395)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHCCCCCCCEEEEHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHH
T ss_conf             45035640667723456554110024888504431048888888742127200899999861566578889897999983


Q ss_pred             CCCCEEEEEECCCCCCCCH--HHHHHHCCCCE----EEEEC-CCCC-CCCCCC-HHHHHHHHHHHH
Q ss_conf             3576069984788878807--99999679979----99988-8873-843484-899999999987
Q gi|254780166|r  200 IDVPVLIAVGSQDDLAGSP--QELMSFIPSSQ----YLNIC-RRDH-LLAVGD-KQFKQGVVNFYA  256 (261)
Q Consensus       200 i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~----~~~i~-~~gH-~~~~e~-p~~~~~i~~Fl~  256 (261)
                      +++|+|++-=+-|...++.  +++++.+|+++    +.+|+ .-|| .+.+|. +++.+.|.+||.
T Consensus       330 ~~~~~lv~s~~sD~Lfp~~~~~e~~~~l~~~~~~V~Y~ei~S~~GHDAFL~e~d~~~~~~i~~fl~  395 (395)
T TIGR01392       330 IKAPFLVVSITSDWLFPPAESRELAKALPAAGLRVTYAEIESPYGHDAFLVETDEQVEELIREFLR  395 (395)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             798889998606876688999999999850364066888526899860005677899999997529


No 43 
>KOG1552 consensus
Probab=99.70  E-value=3.5e-16  Score=115.26  Aligned_cols=206  Identities=20%  Similarity=0.250  Sum_probs=138.4

Q ss_pred             EEEEECCCCEEEEEEEC-CCC-CCEEEEECCCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             79993499499999964-899-87899998788880012217999999986-8989999647655422222222222212
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVG-DKD-APTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLV   82 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g-~~~-~~~vv~iHG~~~~~~~~~~~~~~~~~l~~-~g~~vi~~D~~G~G~S~~~~~~~~~s~~   82 (261)
                      ....+..|..+--.... +.. .+++++.||...+...  ... +.-.|.. =.++++++|++|+|.|.+....     .
T Consensus        38 ~~~~t~rgn~~~~~y~~~~~~~~~~lly~hGNa~Dlgq--~~~-~~~~l~~~ln~nv~~~DYSGyG~S~G~psE-----~  109 (258)
T KOG1552          38 FKVKTSRGNEIVCMYVRPPEAAHPTLLYSHGNAADLGQ--MVE-LFKELSIFLNCNVVSYDYSGYGRSSGKPSE-----R  109 (258)
T ss_pred             EEEECCCCCEEEEEEECCCCCCCCEEEECCCCCCCHHH--HHH-HHHHHHHCCCEEEEEEECCCCCCCCCCCCC-----C
T ss_conf             88605789888999973764556179974774244688--999-999876404503899834555567897563-----3


Q ss_pred             CCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCH
Q ss_conf             2222222222222-----22222223443444310133321023565238962885633110356999999863111100
Q gi|254780166|r   83 FMAADAVSLLEHL-----GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDE  157 (261)
Q Consensus        83 ~~~~di~~~i~~l-----~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (261)
                      ...+|+.++.+.+     +.++++|.|+|+|+..++.+|++.|  +++|||.++-.....-            ..+..+ 
T Consensus       110 n~y~Di~avye~Lr~~~g~~~~Iil~G~SiGt~~tv~Lasr~~--~~alVL~SPf~S~~rv------------~~~~~~-  174 (258)
T KOG1552         110 NLYADIKAVYEWLRNRYGSPERIILYGQSIGTVPTVDLASRYP--LAAVVLHSPFTSGMRV------------AFPDTK-  174 (258)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHCCC--CCEEEEECCCHHHHHH------------HCCCCC-
T ss_conf             4055499999999975599861899974687235556762188--7259994642332556------------014863-


Q ss_pred             HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCC-EEEEEC
Q ss_conf             001110000000034766541356777654101220012100357606998478887880--79999967997-999988
Q gi|254780166|r  158 VQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSS-QYLNIC  234 (261)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~-~~~~i~  234 (261)
                         .. .++..|..                      -+..+.|++|+|+++|++|++++.  .+++-+..++. +-..++
T Consensus       175 ---~~-~~~d~f~~----------------------i~kI~~i~~PVLiiHgtdDevv~~sHg~~Lye~~k~~~epl~v~  228 (258)
T KOG1552         175 ---TT-YCFDAFPN----------------------IEKISKITCPVLIIHGTDDEVVDFSHGKALYERCKEKVEPLWVK  228 (258)
T ss_pred             ---EE-EEECCCCC----------------------CCCCEEECCCEEEEECCCCCEECCCCCHHHHHHCCCCCCCCEEE
T ss_conf             ---57-86012211----------------------57613503778999456673104543588997543357870786


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             88738434848999999999875168
Q gi|254780166|r  235 RRDHLLAVGDKQFKQGVVNFYANELR  260 (261)
Q Consensus       235 ~~gH~~~~e~p~~~~~i~~Fl~~~~~  260 (261)
                      |+||.-..-.|++.+.+..|+.....
T Consensus       229 g~gH~~~~~~~~yi~~l~~f~~~~~~  254 (258)
T KOG1552         229 GAGHNDIELYPEYIEHLRRFISSVLP  254 (258)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             69876544478999999999987525


No 44 
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=99.70  E-value=4.4e-16  Score=114.68  Aligned_cols=251  Identities=17%  Similarity=0.182  Sum_probs=150.2

Q ss_pred             EEEECCCCEEEEEEEC---CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9993499499999964---8998789999878888001221799999998689899996476554222222222222122
Q gi|254780166|r    7 FFRSWRKYQFAFYDVG---DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF   83 (261)
Q Consensus         7 ~~~~~dG~~l~y~~~g---~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~   83 (261)
                      -..+.||--+-.....   ++.+|.||++||+.|+.++. ....+...+.++||.+++++.|||+.+... .+.-|+.- 
T Consensus        53 ~v~~pdg~~~~ldw~~~p~~~~~P~vVl~HGL~G~s~s~-y~r~L~~~~~~rg~~~Vv~~~Rgcs~~~n~-~p~~yh~G-  129 (345)
T COG0429          53 RLETPDGGFIDLDWSEDPRAAKKPLVVLFHGLEGSSNSP-YARGLMRALSRRGWLVVVFHFRGCSGEANT-SPRLYHSG-  129 (345)
T ss_pred             EEECCCCCEEEEEECCCCCCCCCCEEEEEECCCCCCCCH-HHHHHHHHHHHCCCEEEEEECCCCCCCCCC-CCCEECCC-
T ss_conf             997499997777631486445785499994257888678-999999999966880999865345687666-76144165-


Q ss_pred             CCCCCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHCCC--CCC-CEEEECCCCCC-----CCCCHH--HHHHHHHH
Q ss_conf             2222222222222----2222223443444310133321023--565-23896288563-----311035--69999998
Q gi|254780166|r   84 MAADAVSLLEHLG----ISKVHVMGYSMGARIACSMVLFYPS--YVR-SVILGGVGSVL-----YDSDVV--DWQSLIDS  149 (261)
Q Consensus        84 ~~~di~~~i~~l~----~~~~~liGhS~Gg~ia~~~a~~~p~--~v~-~lvl~~~~~~~-----~~~~~~--~~~~~~~~  149 (261)
                      +.+|+..+++.+.    -.++-.+|.|+||.+...+.....+  .+. +++++++....     ......  .+++....
T Consensus       130 ~t~D~~~~l~~l~~~~~~r~~~avG~SLGgnmLa~ylgeeg~d~~~~aa~~vs~P~Dl~~~~~~l~~~~s~~ly~r~l~~  209 (345)
T COG0429         130 ETEDIRFFLDWLKARFPPRPLYAVGFSLGGNMLANYLGEEGDDLPLDAAVAVSAPFDLEACAYRLDSGFSLRLYSRYLLR  209 (345)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCCCCEEEEEECHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             12689999999998579996699995533999999887615676521014650788899878775186355413999999


Q ss_pred             HH----CCCCCHHH-------HHHHHHHCCCCCCCC--CCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCC
Q ss_conf             63----11110000-------111000000003476--654135677765410122001210035760699847888788
Q gi|254780166|r  150 FL----LPSIDEVQ-------NPLGKKFRKFADLDP--GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG  216 (261)
Q Consensus       150 ~~----~~~~~~~~-------~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~  216 (261)
                      ..    ...++...       ....+..+.+.+.+.  -....++.......+.....+.+.+|.+|+|+|+..+|++.+
T Consensus       210 ~L~~~~~~kl~~l~~~~p~~~~~~ik~~~ti~eFD~~~Tap~~Gf~da~dYYr~aSs~~~L~~Ir~PtLii~A~DDP~~~  289 (345)
T COG0429         210 NLKRNAARKLKELEPSLPGTVLAAIKRCRTIREFDDLLTAPLHGFADAEDYYRQASSLPLLPKIRKPTLIINAKDDPFMP  289 (345)
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHHHHHCHHHHCCCEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCC
T ss_conf             99999998887537536717999998624687503303220258885899998555420135666534898647889878


Q ss_pred             CH---HHHHHHCCCCEEEEECCCCCCCCCC----CHH--HHHHHHHHHHHHCC
Q ss_conf             07---9999967997999988887384348----489--99999999875168
Q gi|254780166|r  217 SP---QELMSFIPSSQYLNICRRDHLLAVG----DKQ--FKQGVVNFYANELR  260 (261)
Q Consensus       217 ~~---~~l~~~~p~~~~~~i~~~gH~~~~e----~p~--~~~~i~~Fl~~~~~  260 (261)
                      +.   +......|+..+.+-+.+||+..+.    +|+  .-+.+++||...++
T Consensus       290 ~~~iP~~~~~~np~v~l~~t~~GGHvGfl~~~~~~~~~W~~~ri~~~l~~~~~  342 (345)
T COG0429         290 PEVIPKLQEMLNPNVLLQLTEHGGHVGFLGGKLLHPQMWLEQRILDWLDPFLE  342 (345)
T ss_pred             HHHCCCCHHCCCCCEEEEEECCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             45488620027986478850678557852685424066699999999987875


No 45 
>KOG4391 consensus
Probab=99.67  E-value=1.4e-15  Score=111.64  Aligned_cols=221  Identities=19%  Similarity=0.208  Sum_probs=147.2

Q ss_pred             CCCCEEEEEECCCCEEEEEEEC-CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             9764079993499499999964-89987899998788880012217999999986-898999964765542222222222
Q gi|254780166|r    1 MMNEVKFFRSWRKYQFAFYDVG-DKDAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIEND   78 (261)
Q Consensus         1 ~~~~~~~~~~~dG~~l~y~~~g-~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~-~g~~vi~~D~~G~G~S~~~~~~~~   78 (261)
                      |..+..-..+.|..+++-+..- +.+.|+++..||..|+...   .-+++.-+-. =+-+|+.++.||||.|++..... 
T Consensus        52 ~pye~i~l~T~D~vtL~a~~~~~E~S~pTlLyfh~NAGNmGh---r~~i~~~fy~~l~mnv~ivsYRGYG~S~GspsE~-  127 (300)
T KOG4391          52 MPYERIELRTRDKVTLDAYLMLSESSRPTLLYFHANAGNMGH---RLPIARVFYVNLKMNVLIVSYRGYGKSEGSPSEE-  127 (300)
T ss_pred             CCCEEEEEECCCCEEEEEEEECCCCCCCEEEEECCCCCCCCC---HHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCC-
T ss_conf             973389987476336764440135788548998368775110---0067899999727319999820345688995410-


Q ss_pred             CCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             22122222222222222------222222234434443101333210235652389628856331103569999998631
Q gi|254780166|r   79 YRLVFMAADAVSLLEHL------GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLL  152 (261)
Q Consensus        79 ~s~~~~~~di~~~i~~l------~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~  152 (261)
                          -..-|-+++++++      .-.|+++.|-|+||.+|..+|++..+++.++++-++-..+....        -.+..
T Consensus       128 ----GL~lDs~avldyl~t~~~~dktkivlfGrSlGGAvai~lask~~~ri~~~ivENTF~SIp~~~--------i~~v~  195 (300)
T KOG4391         128 ----GLKLDSEAVLDYLMTRPDLDKTKIVLFGRSLGGAVAIHLASKNSDRISAIIVENTFLSIPHMA--------IPLVF  195 (300)
T ss_pred             ----CEECCHHHHHHHHHCCCCCCCCEEEEEECCCCCEEEEEEECCCHHHEEEEEEECHHCCCHHHH--------HHEEC
T ss_conf             ----110048999998850766774159998325677268885003401300332311000355442--------00222


Q ss_pred             CCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCC--
Q ss_conf             11100001110000000034766541356777654101220012100357606998478887880--79999967997--
Q gi|254780166|r  153 PSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSS--  228 (261)
Q Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~--  228 (261)
                      +.       .++.+..+.              ..  ..+.....+.+-++|.|++-|..|+++|+  ++++.+..|..  
T Consensus       196 p~-------~~k~i~~lc--------------~k--n~~~S~~ki~~~~~P~LFiSGlkDelVPP~~Mr~Ly~~c~S~~K  252 (300)
T KOG4391         196 PF-------PMKYIPLLC--------------YK--NKWLSYRKIGQCRMPFLFISGLKDELVPPVMMRQLYELCPSRTK  252 (300)
T ss_pred             CC-------HHHHHHHHH--------------HH--HHHCCHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHCCHHHH
T ss_conf             34-------366777898--------------77--56413213224557647850576345895999999876821223


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99998888738434848999999999875168
Q gi|254780166|r  229 QYLNICRRDHLLAVGDKQFKQGVVNFYANELR  260 (261)
Q Consensus       229 ~~~~i~~~gH~~~~e~p~~~~~i~~Fl~~~~~  260 (261)
                      ++.++|++.|--..-...+++++.+||+|...
T Consensus       253 rl~eFP~gtHNDT~i~dGYfq~i~dFlaE~~~  284 (300)
T KOG4391         253 RLAEFPDGTHNDTWICDGYFQAIEDFLAEVVK  284 (300)
T ss_pred             HHEECCCCCCCCEEEECCHHHHHHHHHHHHCC
T ss_conf             22227898668607853589999999998612


No 46 
>pfam00326 Peptidase_S9 Prolyl oligopeptidase family.
Probab=99.65  E-value=3e-16  Score=115.71  Aligned_cols=191  Identities=17%  Similarity=0.167  Sum_probs=112.0

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCHHHH
Q ss_conf             79999999868989999647655---4222222222222122222222222222------22222223443444310133
Q gi|254780166|r   45 FSGWIQLLCDQGFRVIAFDNLGH---GKSDKSYIENDYRLVFMAADAVSLLEHL------GISKVHVMGYSMGARIACSM  115 (261)
Q Consensus        45 ~~~~~~~l~~~g~~vi~~D~~G~---G~S~~~~~~~~~s~~~~~~di~~~i~~l------~~~~~~liGhS~Gg~ia~~~  115 (261)
                      |....+.|+.+||.|+.+|.||.   |.+-......++. ...++|+.+.++.+      +-+++.++|+|+||.+++.+
T Consensus         3 ~~~~~~~~a~~Gy~V~~~n~RGs~g~G~~~~~~~~~~~G-~~~~~D~~~~v~~l~~~~~iD~~RI~v~G~S~GG~la~~~   81 (212)
T pfam00326         3 FSWNLQLLADRGYVVAVANGRGSGGYGRAWHDAGKGDLG-QNEFDDFIAAAEYLIAQGYVDPDRLAIWGGSYGGYLTGAA   81 (212)
T ss_pred             CCHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHCC-CCCHHHHHHHHHHHHHCCCCCHHHEEEEEECCCHHHHHHH
T ss_conf             788999999699489998899996207999998874138-6879999999999998699885574897676220988998


Q ss_pred             HHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHH
Q ss_conf             32102356523896288563311035699999986311110000111000000003476654135677765410122001
Q gi|254780166|r  116 VLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD  195 (261)
Q Consensus       116 a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  195 (261)
                      +..+|++++.+|..++...+...           ....      ......+...  -.+......+..    .......+
T Consensus        82 ~~~~~~~~~a~v~~~~~~d~~~~-----------~~~~------~~~~~~~~~~--~~~~~~~~~~~~----~s~~~~~~  138 (212)
T pfam00326        82 LNQRPDLFKAAVAVVPVVDWLTY-----------MSDT------SPFTERYMEW--GNPWDNEEGYRY----LSPYSPYD  138 (212)
T ss_pred             HCCCCCHHHHHCCCCCCCCHHHH-----------CCCC------CCHHHHHHCC--CCCCCCHHHHHH----HCCCCHHH
T ss_conf             60485133320025773138886-----------4687------5104677417--995339999998----58657455


Q ss_pred             HHHCCCCCEEEEEECCCCCCCCH--HHHHHHC----CCCEEEEECCCCCCCC-CCCH-HHHHHHHHHHHHHCC
Q ss_conf             21003576069984788878807--9999967----9979999888873843-4848-999999999875168
Q gi|254780166|r  196 DLYRIDVPVLIAVGSQDDLAGSP--QELMSFI----PSSQYLNICRRDHLLA-VGDK-QFKQGVVNFYANELR  260 (261)
Q Consensus       196 ~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~----p~~~~~~i~~~gH~~~-~e~p-~~~~~i~~Fl~~~~~  260 (261)
                      . .+++.|+|+++|++|..+|..  .++.+.+    ..+++.++|++||.+. .|.. .+.+.+++||.+.|.
T Consensus       139 ~-~~~~~P~LiihG~~D~~Vp~~~s~~l~~~L~~~g~~~~l~~~p~~gHg~~~~~~~~~~~~~~~~~~~~~l~  210 (212)
T pfam00326       139 N-VKAYPPLLLIHGLHDDRVPPAEALKLVAALQKTGKNVLLLIFPDEGHGGGKPRNKREEYARELAFLLKVLG  210 (212)
T ss_pred             H-HCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             5-06889989996899999898999999999996899989999694897998989999999999999999718


No 47 
>pfam00975 Thioesterase Thioesterase domain. Peptide synthetases are involved in the non-ribosomal synthesis of peptide antibiotics. Next to the operons encoding these enzymes, in almost all cases, are genes that encode proteins that have similarity to the type II fatty acid thioesterases of vertebrates. There are also modules within the peptide synthetases that also share this similarity. With respect to antibiotic production, thioesterases are required for the addition of the last amino acid to the peptide antibiotic, thereby forming a cyclic antibiotic. Thioesterases (non-integrated) have molecular masses of 25-29 kDa.
Probab=99.64  E-value=1.7e-15  Score=111.16  Aligned_cols=211  Identities=12%  Similarity=0.057  Sum_probs=124.5

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             789999878888001221799999998689899996476554222222222222122222222222222-2222222344
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL-GISKVHVMGY  105 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l-~~~~~~liGh  105 (261)
                      +.++|+|+.||+..   .|..+...|.+ +..|+++.+||++.++.    ..-+++.+++++.+.|... ...+++|+||
T Consensus         1 ~~Lfc~p~aGG~~~---~y~~la~~l~~-~~~v~~l~~pG~~~~e~----~~~~~~~~a~~~~~~i~~~~~~gPy~L~Gh   72 (224)
T pfam00975         1 RRLFCFPPAGGSAS---YFRNLARRLPG-TAEFNAVQLPGRERGEP----PLTSIEELAEEYAEALRRIQPEGPYALFGH   72 (224)
T ss_pred             CCEEEECCCCCCHH---HHHHHHHHCCC-CCEEEEEECCCCCCCCC----CCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             95999779987889---99999985899-97799973898899999----999999999999999998679999799964


Q ss_pred             CCCCCCHHHHHHH---CCCCCCCEEEECCCCCCCCCCHHH----HHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCH
Q ss_conf             3444310133321---023565238962885633110356----999999863111100001110000000034766541
Q gi|254780166|r  106 SMGARIACSMVLF---YPSYVRSVILGGVGSVLYDSDVVD----WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL  178 (261)
Q Consensus       106 S~Gg~ia~~~a~~---~p~~v~~lvl~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  178 (261)
                      |+||.+|.++|.+   ....+++|++++..+.........    .......+...  .............+     ..-.
T Consensus        73 S~Gg~lA~evA~~L~~~g~~v~~l~l~d~~~P~~~~~~~~~~~~~~~~~~~l~~~--~~~~~~~~~~~~~~-----~~~~  145 (224)
T pfam00975        73 SMGGLLAFEVARRLERRGEEPAGLILSDAYAPHFGRREASHLLGDDELLAELRRI--GGTPEALLEDEELL-----SLLL  145 (224)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHH--CCCCHHHHCCHHHH-----HHHH
T ss_conf             4456999999999997799930899978899988664333334679999999984--59973440799999-----9999


Q ss_pred             HHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHH---HHHHCC-CCEEEEECCCCCCCCCCCH-HHHHHHHH
Q ss_conf             356777654101220012100357606998478887880799---999679-9799998888738434848-99999999
Q gi|254780166|r  179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIP-SSQYLNICRRDHLLAVGDK-QFKQGVVN  253 (261)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~---l~~~~p-~~~~~~i~~~gH~~~~e~p-~~~~~i~~  253 (261)
                      ..+............  .-....+|++++.|..|+.++....   -.+..+ ..+++.++| +|+.+.+++ ++++.|.+
T Consensus       146 ~~~~~d~~~~~~~~~--~~~~~~~~~~~~~~~~d~~~~~~~~~~~W~~~~~~~~~~~~vpG-~Hf~~~~~~~~va~~i~~  222 (224)
T pfam00975       146 PALRADYRALENYPI--HPIAAPSDATLFYGADDPLNTLDWLAAWWREYTPGEFDTHVLPG-DHFYLNEHAEEVLETIHD  222 (224)
T ss_pred             HHHHHHHHHHHHCCC--CCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEEECC-CCCCCCCCHHHHHHHHHH
T ss_conf             999999999984788--98778999899964589988854788599973889947999768-988226699999999996


Q ss_pred             HH
Q ss_conf             98
Q gi|254780166|r  254 FY  255 (261)
Q Consensus       254 Fl  255 (261)
                      +|
T Consensus       223 ~l  224 (224)
T pfam00975       223 WL  224 (224)
T ss_pred             HC
T ss_conf             59


No 48 
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A); InterPro: IPR006494    These proteins represent a paralogous family of genes found in Plasmodium falciparum and Plasmodium yoelii that are closely related to various phospholipases and lysophospholipases of plants as well as generally being related to the alpha/beta-fold superfamily of hydrolases. These genes are preferentially located in the subtelomeric regions of the chromosomes of both P. falciparum and P. yoelii. .
Probab=99.62  E-value=1e-16  Score=118.52  Aligned_cols=243  Identities=22%  Similarity=0.335  Sum_probs=138.0

Q ss_pred             EEEECCCCEEEEEEECCCCC-CEEEEECCCCCCCHHHHH-----------------------HHHHHHHHHHCCCEEEEE
Q ss_conf             99934994999999648998-789999878888001221-----------------------799999998689899996
Q gi|254780166|r    7 FFRSWRKYQFAFYDVGDKDA-PTILLIHGLASSVQTNWL-----------------------FSGWIQLLCDQGFRVIAF   62 (261)
Q Consensus         7 ~~~~~dG~~l~y~~~g~~~~-~~vv~iHG~~~~~~~~~~-----------------------~~~~~~~l~~~g~~vi~~   62 (261)
                      .|...||..|.=|-|-=+.+ -.||||||+.++++..+.                       =..|++.|-+.||.|++.
T Consensus         1 ~F~NKdGLLlKtYsWiVKkAiGII~LIHGL~sH~Rl~yLk~Na~~~nN~~a~lID~dNYYiY~dSWIE~fN~~GYSVYgL   80 (379)
T TIGR01607         1 SFYNKDGLLLKTYSWIVKKAIGIIVLIHGLKSHLRLQYLKLNAKVVNNDKAVLIDADNYYIYEDSWIEKFNKNGYSVYGL   80 (379)
T ss_pred             CCCCCCCCEEHHHHHHHHHHHHHEEEEEHHHHHHHHHHHHCCCCCCCCCEEEEEECCCEEEECCEEEEECCCCCCEEEEE
T ss_conf             93446633230133422223201102211314665776533773010777799847730686782565116797638753


Q ss_pred             CCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCC---------------------------C---CCCCCCCCCCCCCC
Q ss_conf             47655422222222222--2122222222222222---------------------------2---22222234434443
Q gi|254780166|r   63 DNLGHGKSDKSYIENDY--RLVFMAADAVSLLEHL---------------------------G---ISKVHVMGYSMGAR  110 (261)
Q Consensus        63 D~~G~G~S~~~~~~~~~--s~~~~~~di~~~i~~l---------------------------~---~~~~~liGhS~Gg~  110 (261)
                      ||=|||+|++-..-..+  .++|+|.||.+.+.+.                           .   .-|.-|+||||||.
T Consensus        81 DLQGHGESdG~~nLrgHin~FDDlVyDvIqYmn~I~~si~~E~~dP~~y~~dd~~~~i~~~~~kivrLPmYi~G~SMGGN  160 (379)
T TIGR01607        81 DLQGHGESDGLQNLRGHINDFDDLVYDVIQYMNRINDSIILENEDPKEYKSDDESYDIVNTKEKIVRLPMYIVGLSMGGN  160 (379)
T ss_pred             ECCCCCCCCHHHCCCCCCCCCCCEEHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHCCCCEECCCHHHHHCCCCHH
T ss_conf             43567623203306766564466450378998886332104567830023465434110114320014235432054468


Q ss_pred             CHHHHHHHC---CC---------------------------------------------CCCCEE-EECCCC--------
Q ss_conf             101333210---23---------------------------------------------565238-962885--------
Q gi|254780166|r  111 IACSMVLFY---PS---------------------------------------------YVRSVI-LGGVGS--------  133 (261)
Q Consensus       111 ia~~~a~~~---p~---------------------------------------------~v~~lv-l~~~~~--------  133 (261)
                      +|+|+...=   .+                                             .|+|.| |.|.-.        
T Consensus       161 IaLR~LelL~Ks~EkN~~~~~D~~~~~~~~~~~~D~~N~~D~~~~D~KN~~~YN~~dkLNIKGCiSLsGM~Si~~~~s~~  240 (379)
T TIGR01607       161 IALRVLELLNKSKEKNKIKIEDAEDYKKIDDLVNDFINIYDDAIDDIKNDDKYNLNDKLNIKGCISLSGMISIKEVASPD  240 (379)
T ss_pred             HHHHHHHHHCCCCHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCCCCCCEEEECCCCEEEEECCCCC
T ss_conf             99999997334210001234641122225667755441146521220458842113368600356503425762206788


Q ss_pred             -CCCC---CCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCC--------CCCC---CCCHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             -6331---103569999998631111000011100000000--------3476---654135677765410122001210
Q gi|254780166|r  134 -VLYD---SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFA--------DLDP---GNDLKALASCLSMIRKPFCQDDLY  198 (261)
Q Consensus       134 -~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~---~~~~~~~~~~~~~~~~~~~~~~l~  198 (261)
                       .-+.   -+...+    -+..+|......+  .-.|.++.        +..+   +-..+.....+.++.  ....++.
T Consensus       241 ~~kfKYfylP~~~~----~S~~~Pt~r~~~~--~~~ye~~PYVndl~~~DK~R~~g~IT~~~a~eLikA~~--~L~~di~  312 (379)
T TIGR01607       241 SFKFKYFYLPVMNF----MSRIAPTFRISKK--KLKYEKFPYVNDLIKFDKYRYDGGITFKLAYELIKATD--TLNDDID  312 (379)
T ss_pred             CCCEEEEHHHHHHH----HHHHCCCCCCCCC--CCCCCCCCCCCCHHCCCCEEECCCHHHHHHHHHHHHHH--HHHHHHH
T ss_conf             73111003227888----8750577777877--77510077401111106643477306788999999998--7653243


Q ss_pred             CC--CCCEEEEEECCCCCCCC--HHHHHHH--CCCCEEEEECCCCCCCCCCC--HHHHHHHHHHHHH
Q ss_conf             03--57606998478887880--7999996--79979999888873843484--8999999999875
Q gi|254780166|r  199 RI--DVPVLIAVGSQDDLAGS--PQELMSF--IPSSQYLNICRRDHLLAVGD--KQFKQGVVNFYAN  257 (261)
Q Consensus       199 ~i--~~P~l~i~G~~D~~~~~--~~~l~~~--~p~~~~~~i~~~gH~~~~e~--p~~~~~i~~Fl~~  257 (261)
                      .|  ++|+|+||...|-++..  +.-+...  +-+-|+..+++.+|.+.+|+  .++.+.|++|+.+
T Consensus       313 yIPKdIP~LFiHSk~Dc~C~YeG~~~FyNKl~~~NKEl~t~edMDH~iTiEPGNE~~L~KiIeWI~n  379 (379)
T TIGR01607       313 YIPKDIPILFIHSKDDCICYYEGVVLFYNKLNISNKELYTVEDMDHVITIEPGNEKVLKKIIEWISN  379 (379)
T ss_pred             HCCCCCCEEEEEECCCCEEEECCEEEEEEECCCCCCCCCCEECCCCEEECCCCCCCHHHHHHHHCCC
T ss_conf             2567776467854577434456817764202567741011006762031047875066677631279


No 49 
>KOG2565 consensus
Probab=99.60  E-value=4e-15  Score=108.97  Aligned_cols=244  Identities=22%  Similarity=0.254  Sum_probs=147.2

Q ss_pred             EECCCCEEEEEEECCCC------CCEEEEECCCCCCCHHHHHHHHHHHHHHHC---------CCEEEEECCCCCCCCCCC
Q ss_conf             93499499999964899------878999987888800122179999999868---------989999647655422222
Q gi|254780166|r    9 RSWRKYQFAFYDVGDKD------APTILLIHGLASSVQTNWLFSGWIQLLCDQ---------GFRVIAFDNLGHGKSDKS   73 (261)
Q Consensus         9 ~~~dG~~l~y~~~g~~~------~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~---------g~~vi~~D~~G~G~S~~~   73 (261)
                      +...|.+|||.+...+.      --|++++|||+||-..   |-.+++.|...         -|.||++.+||||.|+++
T Consensus       129 TeIeGL~iHFlhvk~p~~k~~k~v~PlLl~HGwPGsv~E---FykfIPlLT~p~~hg~~~d~~FEVI~PSlPGygwSd~~  205 (469)
T KOG2565         129 TEIEGLKIHFLHVKPPQKKKKKKVKPLLLLHGWPGSVRE---FYKFIPLLTDPKRHGNESDYAFEVIAPSLPGYGWSDAP  205 (469)
T ss_pred             HHHCCEEEEEEEECCCCCCCCCCCCCEEEECCCCCHHHH---HHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCCCC
T ss_conf             441341578898148732357765515895379851888---87640420586546875213699861588876667687


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEE--CCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             22222221222222222222222222222344344431013332102356523896--2885633110356999999863
Q gi|254780166|r   74 YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG--GVGSVLYDSDVVDWQSLIDSFL  151 (261)
Q Consensus        74 ~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~--~~~~~~~~~~~~~~~~~~~~~~  151 (261)
                      . ...++....|.-+..++=.++.+++.+-|-.||+.|+..+|..||++|.++=+.  ...+....-....   +...+.
T Consensus       206 s-k~GFn~~a~ArvmrkLMlRLg~nkffiqGgDwGSiI~snlasLyPenV~GlHlnm~~~~s~~s~l~~~~---~a~~~~  281 (469)
T KOG2565         206 S-KTGFNAAATARVMRKLMLRLGYNKFFIQGGDWGSIIGSNLASLYPENVLGLHLNMCFVNSPFSTLKLLY---YAGFFP  281 (469)
T ss_pred             C-CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCHHHHHHHH---HHHHCC
T ss_conf             6-578549999999999999827641676157367888877776550456676643665588288999999---987544


Q ss_pred             CCCC-----CHHHHHHHH---------------------------------------HHCCCCCCCCCCC----------
Q ss_conf             1111-----000011100---------------------------------------0000003476654----------
Q gi|254780166|r  152 LPSI-----DEVQNPLGK---------------------------------------KFRKFADLDPGND----------  177 (261)
Q Consensus       152 ~~~~-----~~~~~~~~~---------------------------------------~~~~~~~~~~~~~----------  177 (261)
                      ....     .....+..+                                       .|..+....-...          
T Consensus       282 ~~~l~sre~~d~~~p~~~~~~~lmeesgYfhiqaTkpdTiGaAl~dsPvGlAaYIleKfstwTn~~~r~l~dggL~krFt  361 (469)
T KOG2565         282 GQFLPSREFQDFHFPVGKKFDQLMEESGYFHIQATKPDTIGAALNDSPVGLAAYILEKFSTWTNTEFRSLPDGGLNKRFT  361 (469)
T ss_pred             CCCCCCHHHHHHHCHHHHHHHHHHHHCCCEEEECCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHCCCCCHHEEEC
T ss_conf             43576066787506057789999985182688437962355664069337999999987620475554088875120222


Q ss_pred             HHHHH-HHH---------------HHHCCCC-CHHHH--HCCCCCEEEEEECCCCCCCCHHHHHHHCCCC-EEEEECCCC
Q ss_conf             13567-776---------------5410122-00121--0035760699847888788079999967997-999988887
Q gi|254780166|r  178 LKALA-SCL---------------SMIRKPF-CQDDL--YRIDVPVLIAVGSQDDLAGSPQELMSFIPSS-QYLNICRRD  237 (261)
Q Consensus       178 ~~~~~-~~~---------------~~~~~~~-~~~~l--~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~~-~~~~i~~~g  237 (261)
                      ...++ ..|               ....... ....+  ..+.+|+-+.....|..-.+...+....||- .....+++|
T Consensus       362 ~D~lltnvmiYwlT~si~ss~r~y~e~~~~~~r~~~~~r~~v~vPtg~a~f~~el~~~~~~~lrdky~nL~~~s~~~~GG  441 (469)
T KOG2565         362 MDELLTNVMIYWLTNSITSSQRFYDESFNQRQRDLALDRVQVRVPTGCARFKFELWHTSDDVLRDKYPNLTHSSYHPKGG  441 (469)
T ss_pred             HHHHHHHHHHHEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCHHHCCHHHHHHHCCCCEEEEECCCCC
T ss_conf             88986553222004861466999999875778888762215545404422544243285899864334620267536786


Q ss_pred             CCCCCCCH-HHHHHHHHHHHHHC
Q ss_conf             38434848-99999999987516
Q gi|254780166|r  238 HLLAVGDK-QFKQGVVNFYANEL  259 (261)
Q Consensus       238 H~~~~e~p-~~~~~i~~Fl~~~~  259 (261)
                      ||..+|.| .+++.+..|+....
T Consensus       442 hFaalE~p~~La~D~~~FV~~~~  464 (469)
T KOG2565         442 HFAALEDPKKLAQDFFSFVEKLN  464 (469)
T ss_pred             CHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             40654074889999999999987


No 50 
>pfam01738 DLH Dienelactone hydrolase family.
Probab=99.55  E-value=8.3e-14  Score=101.16  Aligned_cols=176  Identities=16%  Similarity=0.221  Sum_probs=111.8

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC-CCCCCCCCCC-CC-------CCCCCCCCCCCCCCC
Q ss_conf             48998789999878888001221799999998689899996476-5542222222-22-------222122222222222
Q gi|254780166|r   22 GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL-GHGKSDKSYI-EN-------DYRLVFMAADAVSLL   92 (261)
Q Consensus        22 g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~-G~G~S~~~~~-~~-------~~s~~~~~~di~~~i   92 (261)
                      |++..|.||++|+..|-..   ....+++.|+++||.|+++|+. |.|.+..... ..       ....+....|+.+.+
T Consensus        10 ~~gp~PaVll~h~~~Gl~~---~~~~~A~~lA~~Gy~v~~pDlf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~aa~   86 (216)
T pfam01738        10 GGGPGPVVVVFQEIFGVNN---FIRDIAARLAEEGYVALCPDLYARQGPDPTDPREAARAMRGLLSKRMEAVVDDLLAAI   86 (216)
T ss_pred             CCCCCCEEEEECCCCCCCH---HHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             9998688999717878998---9999999999779979983123588899898799999999840347888999999999


Q ss_pred             CCC------CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             222------22222223443444310133321023565238962885633110356999999863111100001110000
Q gi|254780166|r   93 EHL------GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF  166 (261)
Q Consensus        93 ~~l------~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (261)
                      +.+      ..+++.++|+|+||.+++.++..  ..++..+..-+...  .                             
T Consensus        87 ~~l~~~~~~~~~rig~~Gfc~GG~~a~~~a~~--~~~~a~v~~yg~~~--~-----------------------------  133 (216)
T pfam01738        87 NYLRGQPYVDTKKVGVVGFCLGGRLAFLLAAR--NGVDAAVSFYGGLP--P-----------------------------  133 (216)
T ss_pred             HHHHHCCCCCCCCEEEEEECCHHHHHHHHHHC--CCCCEEEEEECCCC--C-----------------------------
T ss_conf             99983777788828999866489999999607--89887999606888--8-----------------------------


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HH----HHHHCCCCEEEEECCCCCCC
Q ss_conf             0000347665413567776541012200121003576069984788878807--99----99967997999988887384
Q gi|254780166|r  167 RKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QE----LMSFIPSSQYLNICRRDHLL  240 (261)
Q Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~----l~~~~p~~~~~~i~~~gH~~  240 (261)
                                              ........++++|+|+++|++|+.++..  ++    +.+.-+..++.++|+++|-+
T Consensus       134 ------------------------~~~~~~~~~i~~Pvl~~~g~~D~~~p~~~~~~~~~~l~~~g~~~~~~~ypga~HgF  189 (216)
T pfam01738       134 ------------------------EPPLDEAPAIKAPILAHFGEEDPFVPAEARDLLEEALRAANVDHELHWYPGAGHAF  189 (216)
T ss_pred             ------------------------CCCHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             ------------------------73023202467776765037799999999999999998639988999979898468


Q ss_pred             CCC-----CH----HHHHHHHHHHHH
Q ss_conf             348-----48----999999999875
Q gi|254780166|r  241 AVG-----DK----QFKQGVVNFYAN  257 (261)
Q Consensus       241 ~~e-----~p----~~~~~i~~Fl~~  257 (261)
                      ...     +|    +..+.+++||.+
T Consensus       190 ~~~~~~~y~~~aa~~aw~~~~~ff~~  215 (216)
T pfam01738       190 AADGRESYDAAAAEDAWERTLEFFKQ  215 (216)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             89998778999999999999999855


No 51 
>pfam02230 Abhydrolase_2 Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.
Probab=99.51  E-value=4.4e-13  Score=96.87  Aligned_cols=179  Identities=16%  Similarity=0.190  Sum_probs=111.0

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCCC------CCC---CCCCC---CC-CC---CCCCCC
Q ss_conf             489987899998788880012217999999986-898999964765------542---22222---22-22---221222
Q gi|254780166|r   22 GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLG------HGK---SDKSY---IE-ND---YRLVFM   84 (261)
Q Consensus        22 g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~-~g~~vi~~D~~G------~G~---S~~~~---~~-~~---~s~~~~   84 (261)
                      .++..+.|||+||+|++.++   +..+.+.++. .+++++.+.=|-      .|.   +--+.   ++ ..   -.++..
T Consensus         7 ~~p~~~llilLHG~G~n~~~---l~~l~~~~~~~p~~~~i~p~AP~~~~~~~~g~~~~~Wf~~~~~~~~~~~~~~~~~~s   83 (213)
T pfam02230         7 AKPATALVIFLHGLGDDGHG---WAFAAKCMAPLPNTKFIFPHAPERPVTLNGGRRMPAWFDLVGLSPNGSEDEAGIKNS   83 (213)
T ss_pred             CCCCCCEEEEEECCCCCHHH---HHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCHHHHHHH
T ss_conf             99988789999789999778---899898750389988997069986754578976451443546795201179999999


Q ss_pred             CCCCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             2222222222-----22222222344344431013332102356523896288563311035699999986311110000
Q gi|254780166|r   85 AADAVSLLEH-----LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQ  159 (261)
Q Consensus        85 ~~di~~~i~~-----l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (261)
                      ++.+.++++.     +..+++.++|+|+||++++.++.++|+++.+++..+..-....                      
T Consensus        84 ~~~i~~~i~~~~~~~i~~~ri~l~GFSQGa~~a~~~~l~~~~~~~g~i~lsG~l~~~~----------------------  141 (213)
T pfam02230        84 AELIEELIDAEQKTGIPSSRIILGGFSQGGAVALYTALTLPQPLAGIIALSGALPLPP----------------------  141 (213)
T ss_pred             HHHHHHHHHHHHHHCCCHHHEEEEEECHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC----------------------
T ss_conf             9999999999998199930279999887789999999809401398999748878962----------------------


Q ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHH----HCCCCEEEEE
Q ss_conf             11100000000347665413567776541012200121003576069984788878807--99999----6799799998
Q gi|254780166|r  160 NPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMS----FIPSSQYLNI  233 (261)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~----~~p~~~~~~i  233 (261)
                           .                      .  ......+  -+.|+++.+|+.|+++|..  ++..+    .--+.++.++
T Consensus       142 -----~----------------------~--~~~~~~~--~~~pi~~~HG~~D~vvp~~~~~~~~~~L~~~g~~v~~~~y  190 (213)
T pfam02230       142 -----K----------------------F--PQHPTAL--ADIPILLIHGTEDPVVPLALGKLAKEYLKTLGNTVEFHEY  190 (213)
T ss_pred             -----H----------------------H--HHHHHHC--CCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             -----1----------------------2--3445542--5997894158999821799999999999977998699997


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             88873843484899999999987516
Q gi|254780166|r  234 CRRDHLLAVGDKQFKQGVVNFYANEL  259 (261)
Q Consensus       234 ~~~gH~~~~e~p~~~~~i~~Fl~~~~  259 (261)
                      ++.||.+   .++..+.+.+||.+.+
T Consensus       191 ~~~gH~I---~~~ei~~~~~fL~k~L  213 (213)
T pfam02230       191 PGMGHSI---CPQEMQDIKSFLSKHL  213 (213)
T ss_pred             CCCCCCC---CHHHHHHHHHHHHHHC
T ss_conf             9999968---9999999999999659


No 52 
>pfam05448 AXE1 Acetyl xylan esterase (AXE1). This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyse the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.
Probab=99.43  E-value=2.1e-12  Score=92.88  Aligned_cols=228  Identities=17%  Similarity=0.243  Sum_probs=127.9

Q ss_pred             EEEECCCCEEE-EEEEC---CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCC-C-----
Q ss_conf             99934994999-99964---89987899998788880012217999999986898999964765542222222-2-----
Q gi|254780166|r    7 FFRSWRKYQFA-FYDVG---DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI-E-----   76 (261)
Q Consensus         7 ~~~~~dG~~l~-y~~~g---~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~-~-----   76 (261)
                      .|.+.+|.+|+ |....   .+.-|.||.+||+++....   |... ..++..||-|+++|.||+|....... .     
T Consensus        60 ~f~~~~g~~I~G~l~~P~~~~~k~P~vv~~hGyg~~~~~---~~~~-~~~a~~G~avl~~d~RGqgg~~~d~~~~~~~~~  135 (320)
T pfam05448        60 TFTGFGGARIKAWLVLPKHSEGKHPALVEFHGYNGGRGD---WHDN-LHWAAAGYAVFAMDVRGQGGLSEDPGGVTGPTV  135 (320)
T ss_pred             EEECCCCCEEEEEEEECCCCCCCCCEEEEECCCCCCCCC---HHHC-CCHHCCCCEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             996179976999996068888980089997688888787---1120-101038968998578888877777555578666


Q ss_pred             ------------CCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCC
Q ss_conf             ------------22221222222222222------222222222344344431013332102356523896288563311
Q gi|254780166|r   77 ------------NDYRLVFMAADAVSLLE------HLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS  138 (261)
Q Consensus        77 ------------~~~s~~~~~~di~~~i~------~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~  138 (261)
                                  +.|-...+..|....++      ..+-+++.+.|.|+||.+++..|+..| +|++.+..-  |.+-+ 
T Consensus       136 ~g~~~~G~~d~~e~~yyr~~~ld~~RAvd~l~~lp~vD~~ri~v~G~SQGG~lala~AaL~~-rv~~~~a~v--P~l~D-  211 (320)
T pfam05448       136 KGHMTRGLLDGPDHYYYRRVFLDAVRAVEIVMSLPEVDEERIGVYGASQGGALALAAAALSP-RIKKVVADY--PFLSD-  211 (320)
T ss_pred             CCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCHHHHHHHHHCCC-CCCEEEECC--CCCCC-
T ss_conf             62444287787678789999988999999998188757011799977704798997875284-105798688--84135-


Q ss_pred             CHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH
Q ss_conf             03569999998631111000011100000000347665413567776541012200121003576069984788878807
Q gi|254780166|r  139 DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP  218 (261)
Q Consensus       139 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~  218 (261)
                          +..... +.... .. -......++. .+...    +.....+..+..+|...-.++|++|+++..|-.|.++|+.
T Consensus       212 ----~~~~~~-~~~~~-~~-y~e~~~y~~~-~~~~~----~~~~~~~~tL~YfD~~nfA~ri~~pv~~~~gl~D~vcPPs  279 (320)
T pfam05448       212 ----FKRAVE-LDLAE-EP-YDEIFRYFKF-FDPHH----EREEEVFRTLSYIDIKNLAHRIKGPVLMSVGLMDDVCPPS  279 (320)
T ss_pred             ----HHHHHH-CCCCC-CH-HHHHHHHHHH-CCCCC----CCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             ----354642-47788-81-7889988740-48764----2189998402033688789760776899840478988982


Q ss_pred             HHHH--HHCCC-CEEEEECCCCCCCCCCCHHH-HHHHHHHHHH
Q ss_conf             9999--96799-79999888873843484899-9999999875
Q gi|254780166|r  219 QELM--SFIPS-SQYLNICRRDHLLAVGDKQF-KQGVVNFYAN  257 (261)
Q Consensus       219 ~~l~--~~~p~-~~~~~i~~~gH~~~~e~p~~-~~~i~~Fl~~  257 (261)
                      -.++  ..++. -++++.+..||...   |.+ .+..++||++
T Consensus       280 t~fAayN~i~~~K~l~vyp~~gHe~~---~~~~~~~~~~~l~~  319 (320)
T pfam05448       280 TVFAAYNHLTTEKEIKVYPEYGHEGG---PGFQEDQQYKFLSR  319 (320)
T ss_pred             CHHHHHHCCCCCEEEEECCCCCCCCC---HHHHHHHHHHHHHC
T ss_conf             24998715599737996577787772---56769999999862


No 53 
>PRK11460 esterase YpfH; Provisional
Probab=99.43  E-value=2.1e-12  Score=92.78  Aligned_cols=170  Identities=14%  Similarity=0.146  Sum_probs=109.0

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHC--CCEEEEECCCCCCCCCCCCCCCCCCCC------------CCCCCCCC
Q ss_conf             9878999987888800122179999999868--989999647655422222222222212------------22222222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQ--GFRVIAFDNLGHGKSDKSYIENDYRLV------------FMAADAVS   90 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~--g~~vi~~D~~G~G~S~~~~~~~~~s~~------------~~~~di~~   90 (261)
                      .+..|||+||+|++.++   +..+++.|...  +-.++.++-+..  +..+.....|++.            ..++.+.+
T Consensus        15 ~~~LvILLHG~Gadg~D---L~~La~~l~~~lP~a~fv~~~ap~~--~~~~~G~qWF~l~~~~~~~~~~~~~~~~~~l~~   89 (230)
T PRK11460         15 AQQLLLLFHGVGDNPVA---MGEIGSWFAPAFPDALVVSVGGAEP--SGNPAGRQWFSVQGITEDNRQARVAAIMPTFIE   89 (230)
T ss_pred             HHHEEEEECCCCCCHHH---HHHHHHHHHHHCCCCEEECCCCCCC--CCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             24579998267988777---9999998886589988957999756--789643003026899856788899999999999


Q ss_pred             CC----CCCCC--CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             22----22222--2222234434443101333210235652389628856331103569999998631111000011100
Q gi|254780166|r   91 LL----EHLGI--SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGK  164 (261)
Q Consensus        91 ~i----~~l~~--~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (261)
                      ++    +++++  ++++|+|+|.|+++++..+.++|+.+.++|..+..-.                      .    +. 
T Consensus        90 ~i~~~~~~~gl~~~~i~L~GFSQGamMsL~~~l~~~~~~~giv~~SG~l~----------------------~----l~-  142 (230)
T PRK11460         90 TVRYWQQQSGVGASATALIGFSQGAIMALESVKAEPGLAGRVIAFSGRYA----------------------S----LP-  142 (230)
T ss_pred             HHHHHHHHHCCCHHHEEEEEECHHHHHHHHHHHCCCCCCCEEEEECCCCC----------------------C----CC-
T ss_conf             99999998399977889999750369999888618664656999655325----------------------6----65-


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHH------HHHHHCCCCEEEEECCCCC
Q ss_conf             0000003476654135677765410122001210035760699847888788079------9999679979999888873
Q gi|254780166|r  165 KFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ------ELMSFIPSSQYLNICRRDH  238 (261)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~------~l~~~~p~~~~~~i~~~gH  238 (261)
                                                    +. ..-+.|+++++|+.|+++|...      .+.+.--+++..++++.||
T Consensus       143 ------------------------------~~-~~~~~pV~LiHG~~D~VVP~~~~~~A~~~L~~~G~~v~~~~~~glGH  191 (230)
T PRK11460        143 ------------------------------ET-APTATTIHLIHGGEDPVIDVAHAVAAQEALIALGGDVTLDIAEDLGH  191 (230)
T ss_pred             ------------------------------CC-CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             ------------------------------00-15689889984799986388999999999998799279986289999


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             8434848999999999875168
Q gi|254780166|r  239 LLAVGDKQFKQGVVNFYANELR  260 (261)
Q Consensus       239 ~~~~e~p~~~~~i~~Fl~~~~~  260 (261)
                      -+   +|+-.+..++||++.|.
T Consensus       192 ~I---~~egl~~a~~FLk~~lp  210 (230)
T PRK11460        192 AI---DPRLMQFALDRLRYTVP  210 (230)
T ss_pred             CC---CHHHHHHHHHHHHHHCC
T ss_conf             88---99999999999987372


No 54 
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.41  E-value=2.1e-12  Score=92.84  Aligned_cols=215  Identities=13%  Similarity=0.108  Sum_probs=124.5

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC
Q ss_conf             9987899998788880012217999999986898999964765542222222222221222222222222-222222222
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLE-HLGISKVHV  102 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~-~l~~~~~~l  102 (261)
                      ...+.++++|=-|+++.   .|..|...|.. ...+++..+||+|.  +-..+...+++.+++++..-+. -..-+++.+
T Consensus         5 ~~~~~L~cfP~AGGsa~---~fr~W~~~lp~-~iel~avqlPGR~~--r~~ep~~~di~~Lad~la~el~~~~~d~P~al   78 (244)
T COG3208           5 GARLRLFCFPHAGGSAS---LFRSWSRRLPA-DIELLAVQLPGRGD--RFGEPLLTDIESLADELANELLPPLLDAPFAL   78 (244)
T ss_pred             CCCCEEEEECCCCCCHH---HHHHHHHHCCC-HHHEEEECCCCCCC--CCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             88824998468898778---87777764884-14346312788401--24786110599999999987464367997642


Q ss_pred             CCCCCCCCCHHHHHHHCC---CCCCCEEEECCCCCCCCCC-----HH--HHHHHHHHHHCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             344344431013332102---3565238962885633110-----35--6999999863111100001110000000034
Q gi|254780166|r  103 MGYSMGARIACSMVLFYP---SYVRSVILGGVGSVLYDSD-----VV--DWQSLIDSFLLPSIDEVQNPLGKKFRKFADL  172 (261)
Q Consensus       103 iGhS~Gg~ia~~~a~~~p---~~v~~lvl~~~~~~~~~~~-----~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  172 (261)
                      +||||||++|.++|.+..   .....+.+++..+......     ..  ++...+..+.....+-++++.   ++.+.--
T Consensus        79 fGHSmGa~lAfEvArrl~~~g~~p~~lfisg~~aP~~~~~~~i~~~~D~~~l~~l~~lgG~p~e~led~E---l~~l~LP  155 (244)
T COG3208          79 FGHSMGAMLAFEVARRLERAGLPPRALFISGCRAPHYDRGKQIHHLDDADFLADLVDLGGTPPELLEDPE---LMALFLP  155 (244)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHCCHH---HHHHHHH
T ss_conf             2025047999999999997699853488856779987566776679989999999985799968945999---9999989


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCC-CCEEEEECCCCCCCCCCCH-HHH
Q ss_conf             7665413567776541012200121003576069984788878807--99999679-9799998888738434848-999
Q gi|254780166|r  173 DPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIP-SSQYLNICRRDHLLAVGDK-QFK  248 (261)
Q Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p-~~~~~~i~~~gH~~~~e~p-~~~  248 (261)
                             .+.+-......+...+. ..+++|+.++.|++|..+...  ..-.++.. ..++..++| |||...++. ++.
T Consensus       156 -------ilRAD~~~~e~Y~~~~~-~pl~~pi~~~~G~~D~~vs~~~~~~W~~~t~~~f~l~~fdG-gHFfl~~~~~~v~  226 (244)
T COG3208         156 -------ILRADFRALESYRYPPP-APLACPIHAFGGEKDHEVSRDELGAWREHTKGDFTLRVFDG-GHFFLNQQREEVL  226 (244)
T ss_pred             -------HHHHHHHHHCCCCCCCC-CCCCCCEEEECCCCCHHCCHHHHHHHHHHHCCCCEEEEECC-CCEEHHHHHHHHH
T ss_conf             -------99889998624006899-87676657752576623009999999996567841898069-6201254199999


Q ss_pred             HHHHHHHH
Q ss_conf             99999987
Q gi|254780166|r  249 QGVVNFYA  256 (261)
Q Consensus       249 ~~i~~Fl~  256 (261)
                      +.+.+.+.
T Consensus       227 ~~i~~~l~  234 (244)
T COG3208         227 ARLEQHLA  234 (244)
T ss_pred             HHHHHHHH
T ss_conf             99999842


No 55 
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit; InterPro: IPR010125   This entry represents the PhaC subunit of a heterodimeric form of polyhydroxyalkanoic acid (PHA) synthase. Excepting the PhaC of Bacillus megaterium (which needs PhaR), all members require PhaE (IPR010123 from INTERPRO) for activity and are designated class III. This enzyme builds ester polymers for carbon and energy storage that accumulate in inclusions, and both this enzyme and the depolymerase associate with the inclusions. Class III enzymes polymerise short-chain-length hydroxyalkanoates.; GO: 0008415 acyltransferase activity, 0042619 poly-hydroxybutyrate biosynthetic process.
Probab=99.39  E-value=3.1e-13  Score=97.78  Aligned_cols=241  Identities=15%  Similarity=0.198  Sum_probs=141.7

Q ss_pred             EEEECCCCEEE-EEEE-CC-C-CCCEEEEECCC-----CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             99934994999-9996-48-9-98789999878-----888001221799999998689899996476554222222222
Q gi|254780166|r    7 FFRSWRKYQFA-FYDV-GD-K-DAPTILLIHGL-----ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN   77 (261)
Q Consensus         7 ~~~~~dG~~l~-y~~~-g~-~-~~~~vv~iHG~-----~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~   77 (261)
                      ..-..|...|+ |.-. .+ | -+.|++.+=..     ..+..   .=+.+++.|.++|+.|+.+|+   |--+  ..+.
T Consensus        48 vvy~~~K~~LYRy~p~~~~tP~~k~PlLIVYALvNrPYm~DLQ---~drSlv~~LL~~G~DVYLiDW---GyP~--~~D~  119 (367)
T TIGR01836        48 VVYREDKVVLYRYTPVKDNTPLHKTPLLIVYALVNRPYMLDLQ---EDRSLVRGLLERGQDVYLIDW---GYPD--RADR  119 (367)
T ss_pred             EEEECCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCEEEC---CCCHHHHHHHHCCCCEEEEEC---CCCC--HHHH
T ss_conf             5754287788642586678887456512354200645102324---881688888856984899606---8987--3331


Q ss_pred             CCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCC-CCCEEEECCCCCCCCCCHH----------
Q ss_conf             222122222222-----222222222222234434443101333210235-6523896288563311035----------
Q gi|254780166|r   78 DYRLVFMAADAV-----SLLEHLGISKVHVMGYSMGARIACSMVLFYPSY-VRSVILGGVGSVLYDSDVV----------  141 (261)
Q Consensus        78 ~~s~~~~~~di~-----~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~-v~~lvl~~~~~~~~~~~~~----------  141 (261)
                      ..+++|++.+..     .+++.-+++++.|.|.++||.+++.||+.+|++ |+-||.+.+.-....+...          
T Consensus       120 ~ltLdDY~~~YI~~cV~~i~~~~~~d~i~lLG~CqGGTfsL~yAaL~~~kPiKNLvtMv~PVDF~~p~~~l~~~~GCtlG  199 (367)
T TIGR01836       120 YLTLDDYVNGYIDKCVDYICRTSKLDQISLLGICQGGTFSLCYAALYPDKPIKNLVTMVTPVDFETPGNLLSNWDGCTLG  199 (367)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCHHHHHCCCCEEC
T ss_conf             14046667677899999998650789610431431047899999725047832217872662565873376541673100


Q ss_pred             ----HHHHHHHHHHCCCCCHH-------HHHHHHH-------------------H---CCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             ----69999998631111000-------0111000-------------------0---0000347665413567776541
Q gi|254780166|r  142 ----DWQSLIDSFLLPSIDEV-------QNPLGKK-------------------F---RKFADLDPGNDLKALASCLSMI  188 (261)
Q Consensus       142 ----~~~~~~~~~~~~~~~~~-------~~~~~~~-------------------~---~~~~~~~~~~~~~~~~~~~~~~  188 (261)
                          +....+..+. +...++       -+|+...                   |   ++|--..|...=++|..+.+.+
T Consensus       200 a~~~DiDl~VdtmG-NiP~elln~~flmLKPf~l~~qKY~~L~d~~~D~~~v~nFlRMEKWifDsPd~AGEafRQf~kdF  278 (367)
T TIGR01836       200 ARHVDIDLAVDTMG-NIPGELLNLTFLMLKPFSLGYQKYVNLVDILEDESKVENFLRMEKWIFDSPDQAGEAFRQFVKDF  278 (367)
T ss_pred             HHHCCHHHHHHHCC-CCCHHHHHHHHHHCCCHHCCCCCCCCCHHHCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             11212556775206-87677886575521511206897301021026858986265552232178883213589999999


Q ss_pred             CCCC-----------CHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCC-CEEEE--ECCCCCCCCCC----CHHHH
Q ss_conf             0122-----------00121003576069984788878807--999996799-79999--88887384348----48999
Q gi|254780166|r  189 RKPF-----------CQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPS-SQYLN--ICRRDHLLAVG----DKQFK  248 (261)
Q Consensus       189 ~~~~-----------~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~-~~~~~--i~~~gH~~~~e----~p~~~  248 (261)
                      -+.+           ..=+|++|++|+|=|.++.|++++|+  ..|...++. ..+.+  +++ ||...+=    ++|+.
T Consensus       279 YQ~N~li~G~~~iGg~~vdL~Ni~~PvLNiyA~~DHLV~P~~S~aL~~~v~sn~Dyt~~~F~~-GHiG~yvSgkaQkev~  357 (367)
T TIGR01836       279 YQQNGLINGEVEIGGRKVDLKNIKMPVLNIYAERDHLVPPDASKALNDLVSSNEDYTELSFPG-GHIGIYVSGKAQKEVP  357 (367)
T ss_pred             HHHCCCEECEEEECCEEECCEECCCCHHHHHHCCCCCCCCHHHHHHCCCCCCCCCCEECCCCC-CEEEEEECCEEEECCC
T ss_conf             871661424079865453212256551256433477555169997456754336621004798-4389997785331368


Q ss_pred             HHHHHHHHH
Q ss_conf             999999875
Q gi|254780166|r  249 QGVVNFYAN  257 (261)
Q Consensus       249 ~~i~~Fl~~  257 (261)
                      -+|-.||.+
T Consensus       358 P~Ig~WL~~  366 (367)
T TIGR01836       358 PAIGKWLQE  366 (367)
T ss_pred             HHHHHHHHC
T ss_conf             268888513


No 56 
>KOG2624 consensus
Probab=99.38  E-value=4.2e-11  Score=85.08  Aligned_cols=256  Identities=23%  Similarity=0.257  Sum_probs=146.9

Q ss_pred             CCEEEEEECCCCEEEEEEE--CCCCCCEEEEECCCCCCCHHHHHH---HHHHHHHHHCCCEEEEECCCCCCCCCC-----
Q ss_conf             6407999349949999996--489987899998788880012217---999999986898999964765542222-----
Q gi|254780166|r    3 NEVKFFRSWRKYQFAFYDV--GDKDAPTILLIHGLASSVQTNWLF---SGWIQLLCDQGFRVIAFDNLGHGKSDK-----   72 (261)
Q Consensus         3 ~~~~~~~~~dG~~l~y~~~--g~~~~~~vv~iHG~~~~~~~~~~~---~~~~~~l~~~g~~vi~~D~~G~G~S~~-----   72 (261)
                      .|.-...|.||+-+..+..  +.+.+|+|+|.||..+++..|.+-   ..++-.|+++||+|..-+.||.-.|.+     
T Consensus        48 ~E~h~V~T~DgYiL~lhRIp~~~~~rp~Vll~HGLl~sS~~Wv~n~p~~sLaf~LadaGYDVWLgN~RGn~ySr~h~~l~  127 (403)
T KOG2624          48 VEEHEVTTEDGYILTLHRIPRGKKKRPVVLLQHGLLASSSSWVLNGPEQSLAFLLADAGYDVWLGNNRGNTYSRKHKKLS  127 (403)
T ss_pred             EEEEEEECCCCEEEEEEEECCCCCCCCCEEEEECCCCCCCCCEECCCCCCHHHHHHHCCCCEEEECCCCCCCCHHHEECC
T ss_conf             27999874687499885101788999958996034001560123685435899999768851212375760044325037


Q ss_pred             CC-C--CCCCCCCCCC-CCCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHCCC---CCCCEEEECCCCCCCCCC--
Q ss_conf             22-2--2222212222-2222222222----22222223443444310133321023---565238962885633110--
Q gi|254780166|r   73 SY-I--ENDYRLVFMA-ADAVSLLEHL----GISKVHVMGYSMGARIACSMVLFYPS---YVRSVILGGVGSVLYDSD--  139 (261)
Q Consensus        73 ~~-~--~~~~s~~~~~-~di~~~i~~l----~~~~~~liGhS~Gg~ia~~~a~~~p~---~v~~lvl~~~~~~~~~~~--  139 (261)
                      +. .  --++|+.+++ -|+-+.+|+.    +.++++.+|||.|+......++..|+   +|+..++.+|........  
T Consensus       128 ~~~~~~FW~FS~~Em~~yDLPA~IdyIL~~T~~~kl~yvGHSQGtt~~fv~lS~~p~~~~kI~~~~aLAP~~~~k~~~~~  207 (403)
T KOG2624         128 PSSDKEFWDFSWHEMGTYDLPAMIDYILEKTGQEKLHYVGHSQGTTTFFVMLSERPEYNKKIKSFIALAPAAFPKHIKSL  207 (403)
T ss_pred             CCCCCCEEECCHHHHHHCCHHHHHHHHHHHCCCCCEEEEEEECCCHHHEEHHCCCCHHHHHHHEEEEECCHHHHCCCCCH
T ss_conf             76773524331554122578899999997156560589998756222200100361266444503453643220124468


Q ss_pred             HHHHHH-------HHHHHHCCCCCHHHHH-----H-----------------------H---HHHC------CCCCCCCC
Q ss_conf             356999-------9998631111000011-----1-----------------------0---0000------00034766
Q gi|254780166|r  140 VVDWQS-------LIDSFLLPSIDEVQNP-----L-----------------------G---KKFR------KFADLDPG  175 (261)
Q Consensus       140 ~~~~~~-------~~~~~~~~~~~~~~~~-----~-----------------------~---~~~~------~~~~~~~~  175 (261)
                      ......       ....+. +..+.....     +                       +   ..+.      -++....+
T Consensus       208 ~~~~~~~~~~~~~~~~~~f-g~~~f~p~~~~~~~~~~~~C~~~~~~~~lC~~~~~~~~G~~~~~~n~~~~~~~~~h~pag  286 (403)
T KOG2624         208 LNKFLDPFLGAFSLLPLLF-GRKEFLPSNLFIKKFARKICSGSKIFADLCSNFLFLLVGWNSNNWNTTLLPVYLAHLPAG  286 (403)
T ss_pred             HHHHHHHHHHHHHHHHHHC-CCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHCCCCHHHCCCCCC
T ss_conf             8875565311156788864-872105035679999999843336789999999999809636764200130121047877


Q ss_pred             CCHHHHHHHHHHH-----CCC---------------CCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCCEEEE-
Q ss_conf             5413567776541-----012---------------200121003576069984788878807--99999679979999-
Q gi|254780166|r  176 NDLKALASCLSMI-----RKP---------------FCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLN-  232 (261)
Q Consensus       176 ~~~~~~~~~~~~~-----~~~---------------~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~~~~-  232 (261)
                      ...+...-+....     +.+               ...-.+.++++|+.+..|++|.++.+.  +.+....+++.... 
T Consensus       287 tSvk~~~H~~Q~~~s~~f~~yD~G~~~N~~~Y~q~~pP~Y~l~~i~~P~~l~~g~~D~l~~~~DV~~~~~~~~~~~~~~~  366 (403)
T KOG2624         287 TSVKNIVHWAQIVRSGKFRKYDYGSKRNLKHYGQSTPPEYDLTNIKVPTALYYGDNDWLADPEDVLILLLVLPNSVIKYI  366 (403)
T ss_pred             CCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCC
T ss_conf             40888999998722797214678861137661899999877444766879996687552788999999985545300021


Q ss_pred             --ECCCCCCCCC---CC-HHHHHHHHHHHHHHC
Q ss_conf             --8888738434---84-899999999987516
Q gi|254780166|r  233 --ICRRDHLLAV---GD-KQFKQGVVNFYANEL  259 (261)
Q Consensus       233 --i~~~gH~~~~---e~-p~~~~~i~~Fl~~~~  259 (261)
                        +++-.|+-++   +- .++.+.|++.+....
T Consensus       367 ~~~~~ynHlDFi~g~da~~~vy~~vi~~~~~~~  399 (403)
T KOG2624         367 VPIPEYNHLDFIWGLDAKEEVYDPVIERLRLFE  399 (403)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             257875533322046708999999999987431


No 57 
>pfam08538 DUF1749 Protein of unknown function (DUF1749). This is a plant and fungal family of unknown function. This family contains many hypothetical proteins.
Probab=99.37  E-value=1.4e-11  Score=87.86  Aligned_cols=218  Identities=17%  Similarity=0.146  Sum_probs=121.1

Q ss_pred             CCC-EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----
Q ss_conf             987-8999987888800122179999999868989999647----6554222222222222122222222222222----
Q gi|254780166|r   25 DAP-TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN----LGHGKSDKSYIENDYRLVFMAADAVSLLEHL----   95 (261)
Q Consensus        25 ~~~-~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~----~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l----   95 (261)
                      .+| .+|||.|.+......-+...++..|.+.+|.++-+-+    .|+|-|         +++.-+++|..+++++    
T Consensus        32 ~~p~~llFIGGLtDGl~tvpY~~~La~aL~~~~wsl~q~~lsSSY~GwG~~---------SL~~D~~Ei~~~v~Ylr~~~  102 (303)
T pfam08538        32 TKPNALLFIGGLGDGLLTVPYVQPLADALDESGWSLVQPQLSSSYGGWGTG---------SLDRDDEEIQALVEYLRTTK  102 (303)
T ss_pred             CCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCEEEEEEEECCCCCCCCC---------CHHHHHHHHHHHHHHHHHHC
T ss_conf             899779997877787756645799999855388379999850354674625---------23300999999999998605


Q ss_pred             ----CCCCCCCCCCCCCCCCHHHHHHHCC----CCCCCEEEECCCCCCCCCCH-----HHHHHH---HHHHHCCCCCHHH
Q ss_conf             ----2222222344344431013332102----35652389628856331103-----569999---9986311110000
Q gi|254780166|r   96 ----GISKVHVMGYSMGARIACSMVLFYP----SYVRSVILGGVGSVLYDSDV-----VDWQSL---IDSFLLPSIDEVQ  159 (261)
Q Consensus        96 ----~~~~~~liGhS~Gg~ia~~~a~~~p----~~v~~lvl~~~~~~~~~~~~-----~~~~~~---~~~~~~~~~~~~~  159 (261)
                          +.+|++|+|||-|++-+++|.....    ..|.+.||.++.........     ...+..   ...+.....  ..
T Consensus       103 ~~~~~~~kIVLMGHSTGcQDv~~Yl~~~~~~~~~~vdGaIlQAPVSDREa~~~~~~~~~~~~~~v~~A~~~i~~g~--~~  180 (303)
T pfam08538       103 GGTFGRRKIVLMGHSTGSQDVMHYLTSGNEMGRPKVDGGILQAPVSDREAILTVIEERKKYKDLVAVAKKMVDKGK--GD  180 (303)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHCCC--CC
T ss_conf             6767886289984587704799997178988766410588877746399998504505899999999999996699--98


Q ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHH-------------HHCCCCCHHHHHCCCCCEEEEEECCCCCCCC---HHHHHH
Q ss_conf             111000000003476654135677765-------------4101220012100357606998478887880---799999
Q gi|254780166|r  160 NPLGKKFRKFADLDPGNDLKALASCLS-------------MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS---PQELMS  223 (261)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~---~~~l~~  223 (261)
                      ..+...+......   +.+-.-.+++.             ...+......+.+|+.|+|++.+++|+.+|+   .+.+.+
T Consensus       181 ~ilP~~~~~~~~~---~tPitA~Rf~SL~s~~gdDD~FSSDL~de~L~~tfG~i~~plLvl~sg~DE~VP~~VDke~Ll~  257 (303)
T pfam08538       181 EILPREFAEKMGW---ETPVSAYRFWSLASPRGDDDYFSSDLPDEDLAKTFGKVKEPLLILYSENDEFVPEWVDKEDLLA  257 (303)
T ss_pred             CCCCHHHHHHCCC---CCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHH
T ss_conf             4378524000047---8971499999731899986646567998999998547687369996688772786569999999


Q ss_pred             HCCC--------CEEEEECCCCCCCCCC-CH----HHHHHHHHHHH
Q ss_conf             6799--------7999988887384348-48----99999999987
Q gi|254780166|r  224 FIPS--------SQYLNICRRDHLLAVG-DK----QFKQGVVNFYA  256 (261)
Q Consensus       224 ~~p~--------~~~~~i~~~gH~~~~e-~p----~~~~~i~~Fl~  256 (261)
                      .+.+        -.--+|||+.|-+--+ ++    .+++.|..||+
T Consensus       258 RW~~a~~~~~ws~~SgiIpGAsH~v~~~~q~e~~~~Lv~rV~~flk  303 (303)
T pfam08538       258 RWKRFTKKKYWSSLSGIIPGATHNVGGKSAEEAQKWLVERVLSFLK  303 (303)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             9998658984066667377986778987736899999999999749


No 58 
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.36  E-value=3.8e-11  Score=85.33  Aligned_cols=191  Identities=20%  Similarity=0.223  Sum_probs=123.9

Q ss_pred             ECCCCEEE-EEEE--CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCC-CC---CC---
Q ss_conf             34994999-9996--4899878999987888800122179999999868989999647655-4222222-22---22---
Q gi|254780166|r   10 SWRKYQFA-FYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH-GKSDKSY-IE---ND---   78 (261)
Q Consensus        10 ~~dG~~l~-y~~~--g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~-G~S~~~~-~~---~~---   78 (261)
                      +.| .++. |...  +....|.||++|+..+-..   ......+.|+.+||.++++|+-+. |.+..-. ..   ..   
T Consensus         9 ~~~-~~~~~~~a~P~~~~~~P~VIv~hei~Gl~~---~i~~~a~rlA~~Gy~v~~Pdl~~~~~~~~~~~~~~~~~~~~~~   84 (236)
T COG0412           9 APD-GELPAYLARPAGAGGFPGVIVLHEIFGLNP---HIRDVARRLAKAGYVVLAPDLYGRQGDPTDIEDEPAELETGLV   84 (236)
T ss_pred             CCC-CEEEEEEECCCCCCCCCEEEEEECCCCCCH---HHHHHHHHHHHCCCEEEECHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             798-533358956677899988999833578887---8999999999589869731544468888765641898751232


Q ss_pred             --CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             --221222222222222222------222222344344431013332102356523896288563311035699999986
Q gi|254780166|r   79 --YRLVFMAADAVSLLEHLG------ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSF  150 (261)
Q Consensus        79 --~s~~~~~~di~~~i~~l~------~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~  150 (261)
                        .+......|+.+.++.+.      .+++.++|+||||.+++.++...| .+++.+..-+.......  ..        
T Consensus        85 ~~~~~~~~~~d~~a~~~~L~~~~~~~~~~ig~~GfC~GG~~a~~~a~~~~-~v~a~v~fyg~~~~~~~--~~--------  153 (236)
T COG0412          85 ERVDPAEVLADIDAALDYLARQPQVDPKRIGVVGFCMGGGLALLAATRAP-EVKAAVAFYGGLIADDT--AD--------  153 (236)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCHHHHHHHCCCCC-CCCEEEEECCCCCCCCC--CC--------
T ss_conf             04787886645999999998666888864899998803799997524466-87779984688777663--20--------


Q ss_pred             HCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHH----
Q ss_conf             31111000011100000000347665413567776541012200121003576069984788878807--999996----
Q gi|254780166|r  151 LLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSF----  224 (261)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~----  224 (261)
                                                                    ..++.+|+|+..|+.|..++..  +.+.+.    
T Consensus       154 ----------------------------------------------~~~~~~pvl~~~~~~D~~~p~~~~~~~~~~~~~~  187 (236)
T COG0412         154 ----------------------------------------------APKIKVPVLLHLAGEDPYIPAADVDALAAALEDA  187 (236)
T ss_pred             ----------------------------------------------CCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHC
T ss_conf             ----------------------------------------------0026898999814767767836889999999856


Q ss_pred             CCCCEEEEECCCCCCCCCC---------C---HHHHHHHHHHHHHHCCC
Q ss_conf             7997999988887384348---------4---89999999998751689
Q gi|254780166|r  225 IPSSQYLNICRRDHLLAVG---------D---KQFKQGVVNFYANELRA  261 (261)
Q Consensus       225 ~p~~~~~~i~~~gH~~~~e---------~---p~~~~~i~~Fl~~~~~~  261 (261)
                      ....++++++++.|-.+.+         .   +.-.+.+++||++.+..
T Consensus       188 ~~~~~~~~y~ga~H~F~~~~~~~~~~y~~~aa~~a~~~~~~ff~~~~~~  236 (236)
T COG0412         188 GVKVDLEIYPGAGHGFANDRADYHPGYDAAAAEDAWQRVLAFFKRLLGA  236 (236)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             8862699978986211477765567779789999999999999986069


No 59 
>pfam12146 Hydrolase_4 Putative lysophospholipase. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. Many members are annotated as being lysophospholipases, and others as alpha-beta hydrolase fold-containing proteins.
Probab=99.35  E-value=1.3e-12  Score=94.05  Aligned_cols=77  Identities=19%  Similarity=0.265  Sum_probs=63.2

Q ss_pred             CCEEEEEEECCCCC--CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             94999999648998--7899998788880012217999999986898999964765542222222222221222222222
Q gi|254780166|r   13 KYQFAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVS   90 (261)
Q Consensus        13 G~~l~y~~~g~~~~--~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~   90 (261)
                      |.+|+|+.+.+++.  .+||++||++.+..   .|..+++.|+++||.|+++|+||||.|+++... ..+++++++|+.+
T Consensus         1 G~~l~~~~w~p~~~~~~~vl~~HG~~~~~~---~~~~~a~~l~~~G~~V~~~D~rGhG~S~g~rg~-~~~~~~~v~Dl~~   76 (79)
T pfam12146         1 GLKLFYRRWLPAGPPKAVVVLVHGGGEHSG---RYAELAEELAAQGYAVYAYDHRGHGRSPGKRGH-VPSFDDYVDDLDT   76 (79)
T ss_pred             CCEEEEEECCCCCCCCEEEEEECCCCCHHH---HHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCC-CCCHHHHHHHHHH
T ss_conf             938899964799998749999899953678---999999999969995987012755899996678-7999999999999


Q ss_pred             CCC
Q ss_conf             222
Q gi|254780166|r   91 LLE   93 (261)
Q Consensus        91 ~i~   93 (261)
                      +++
T Consensus        77 ~i~   79 (79)
T pfam12146        77 FVE   79 (79)
T ss_pred             HHC
T ss_conf             869


No 60 
>PRK10252 entF enterobactin synthase subunit F; Provisional
Probab=99.33  E-value=1.2e-11  Score=88.35  Aligned_cols=221  Identities=14%  Similarity=0.128  Sum_probs=123.4

Q ss_pred             ECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             648998789999878888001221799999998689899996476554222222222222122222222222222-2222
Q gi|254780166|r   21 VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL-GISK   99 (261)
Q Consensus        21 ~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l-~~~~   99 (261)
                      ..++++||++|+|+.+|+.   |+|..++.+|. .++.|+.+.-+|.....    ...-|+++++....+.|... ..++
T Consensus      1060 ~~~g~~~plf~vhp~gG~~---~~y~~La~~L~-~~~~vyglq~~~l~~~~----~~~~si~~~a~~y~~~i~~~qp~GP 1131 (1293)
T PRK10252       1060 LREGDGPTLFCFHPASGFA---WQFSVLSRYLD-PQWSIIGIQSPRPDGPM----QTATSLDEVCEDHLATLLEQQPHGP 1131 (1293)
T ss_pred             CCCCCCCCEEEECCCCCCH---HHHHHHHHHCC-CCCCEEEEECCCCCCCC----CCCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             4789999789989998651---25999998528-99857998788778888----8999999999999999998689989


Q ss_pred             CCCCCCCCCCCCHHHHHHH---CCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCC-CCHHHHHHHHHHCCCC-CCCC
Q ss_conf             2223443444310133321---023565238962885633110356999999863111-1000011100000000-3476
Q gi|254780166|r  100 VHVMGYSMGARIACSMVLF---YPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPS-IDEVQNPLGKKFRKFA-DLDP  174 (261)
Q Consensus       100 ~~liGhS~Gg~ia~~~a~~---~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-~~~~  174 (261)
                      ++|.|||+||.+|.++|.+   ..+.|..|++.++.+.....    |+........+. ....... ...+.... ...+
T Consensus      1132 y~L~GwS~GG~vA~e~A~~L~~~G~~v~~l~llDs~~~~~~~----~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~ 1206 (1293)
T PRK10252       1132 YYLLGYSLGGTLAQGIAARLRARGEEVAFLGLLDTWPPETQN----WQEKEANGLDPEVLAEINRE-REAFLAAQQGSLS 1206 (1293)
T ss_pred             EEEEEECHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCC----CCCCCCCCCCHHHHHHHHHH-HHHHHHHHCCCCC
T ss_conf             899987870899999999999779935479998679987655----00034345795666434467-8888764313477


Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCC--CHHHHHHHCCCCEEEEECCCCCCCCCCCHH---HHH
Q ss_conf             654135677765410122001210035760699847888788--079999967997999988887384348489---999
Q gi|254780166|r  175 GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG--SPQELMSFIPSSQYLNICRRDHLLAVGDKQ---FKQ  249 (261)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~--~~~~l~~~~p~~~~~~i~~~gH~~~~e~p~---~~~  249 (261)
                      ......+.+.+....+....-.....+.+++++.++.+....  +...=.....+.+.+.+++ .|.-++.+|.   +.+
T Consensus      1207 ~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~a~~~~~~~~~~~~~W~~~~~~~~~~~v~~-~H~~m~~~~~v~~~~~ 1285 (1293)
T PRK10252       1207 TELFTAIEGNYADAVRLLTTAHSVPFDGKATLFVAERTLQEGMSPEQAWSPWIAELDIYRQDC-AHVDIISPEAFEKIGP 1285 (1293)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHCCCEEEEEECC-CHHHHCCCHHHHHHHH
T ss_conf             899999999999999999737898768737999807876556873103777469839999358-8378788788999999


Q ss_pred             HHHHHH
Q ss_conf             999998
Q gi|254780166|r  250 GVVNFY  255 (261)
Q Consensus       250 ~i~~Fl  255 (261)
                      .+.+-|
T Consensus      1286 ~l~~~L 1291 (1293)
T PRK10252       1286 IIRATL 1291 (1293)
T ss_pred             HHHHHH
T ss_conf             999986


No 61 
>PRK05077 frsA fermentation/respiration switch protein; Reviewed
Probab=99.32  E-value=6.9e-11  Score=83.81  Aligned_cols=232  Identities=19%  Similarity=0.229  Sum_probs=132.7

Q ss_pred             EEECCCCEE-EEEEECCCCCC-EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             993499499-99996489987-8999987888800122179999999868989999647655422222222222212222
Q gi|254780166|r    8 FRSWRKYQF-AFYDVGDKDAP-TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA   85 (261)
Q Consensus         8 ~~~~dG~~l-~y~~~g~~~~~-~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~   85 (261)
                      |.-.+|.++ .|.+..+.++| |+|++.|...+..+ .+|..+-.+|+++|+-.+++|+|+.|.|.+-.-.++-|.=+  
T Consensus       173 f~~~~G~~i~gfLHLP~~~~p~PtViv~GgLDsLQ~-D~~rLF~dylaP~giAMLTlDMPSvG~Ss~w~LtqDsS~LH--  249 (414)
T PRK05077        173 FPVPGGKPITGFLHLPKGDGPFPTVLMCGGLDSLQT-DYYRLFRDYLAPRGIAMLTIDMPSVGFSSKWKLTQDSSLLH--  249 (414)
T ss_pred             EEECCCCEEEEEEECCCCCCCCCEEEEECCHHHHHH-HHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHH--
T ss_conf             872699657899846999998875999567247788-89999998526467337970378776536354443067999--


Q ss_pred             CCCCCCCCCC---CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             2222222222---2222222344344431013332102356523896288563311035699999986311110000111
Q gi|254780166|r   86 ADAVSLLEHL---GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPL  162 (261)
Q Consensus        86 ~di~~~i~~l---~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (261)
                      ..+..-+..+   +-.++.++|.-+||.+|.++|-..|.++++++-.++.--....+.    ...+..+..-++-+.+.+
T Consensus       250 QaVL~~L~~vPWVDh~Rv~~~GfRFG~NvAvRLayLEp~rlKavv~lG~~VH~~~~~~----~~~~~~P~MylDvlASRL  325 (414)
T PRK05077        250 QAVLNALPNVPWVDHTRVAAFGFRFGANVAVRLAYLEPPRLKAVACLGPVVHALLSDP----DRQQQVPEMYLDVLASRL  325 (414)
T ss_pred             HHHHHHCCCCCCCCCCEEEEEEEEECHHHHHHHHHHCCCCEEEEEEECHHHHHHHCCH----HHHHHCCHHHHHHHHHHH
T ss_conf             9999855689863230356776420206999998626200126887262888883688----888768789999999874


Q ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHH--HCCCCCHHHHHCCCCCEEEEEECCCCCCCCHH-HH-HHHCCCCEEEEECCCCC
Q ss_conf             0000000034766541356777654--10122001210035760699847888788079-99-99679979999888873
Q gi|254780166|r  163 GKKFRKFADLDPGNDLKALASCLSM--IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ-EL-MSFIPSSQYLNICRRDH  238 (261)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~-~l-~~~~p~~~~~~i~~~gH  238 (261)
                      +..         ..+...+...+..  ......-.  .+..+|+|-+.-++|++.|..+ ++ +..-.+.+...|+..- 
T Consensus       326 g~~---------~~~~~~L~~~l~~~SLK~QGlLg--Rr~~vPmLa~~~k~Dp~sP~~d~~Lia~sS~~Gk~~~i~~~p-  393 (414)
T PRK05077        326 GMH---------DASDEALRVELNRYSLKVQGLLG--RRCPTPMLSGYWKNDPFSPEEDSRLIASSSADGKLLEIPFKP-  393 (414)
T ss_pred             CCC---------CCCHHHHHHHHHHCCHHHHCCCC--CCCCCCEEEECCCCCCCCCHHHHHHHHHHCCCCCEEECCCCC-
T ss_conf             643---------38889998776330076502256--878976244025899979868899999744588456447863-


Q ss_pred             CCCCCC-HHHHHHHHHHHHHHCC
Q ss_conf             843484-8999999999875168
Q gi|254780166|r  239 LLAVGD-KQFKQGVVNFYANELR  260 (261)
Q Consensus       239 ~~~~e~-p~~~~~i~~Fl~~~~~  260 (261)
                        .++. .+-...+.+||++++.
T Consensus       394 --v~~~~~~aL~~~~~Wl~~~l~  414 (414)
T PRK05077        394 --VYRNFDKALQEIIDWLEDKLC  414 (414)
T ss_pred             --HHHHHHHHHHHHHHHHHHHCC
T ss_conf             --466799999999999986439


No 62 
>smart00824 PKS_TE Thioesterase. Peptide synthetases are involved in the non-ribosomal synthesis of peptide antibiotics. Next to the operons encoding these enzymes, in almost all cases, are genes that encode proteins that have similarity to the type II fatty acid thioesterases of vertebrates. There are also modules within the peptide synthetases that also share this similarity. With respect to antibiotic production, thioesterases are required for the addition of the last amino acid to the peptide antibiotic, thereby forming a cyclic antibiotic. Thioesterases (non-integrated) have molecular masses of 25-29 kDa.
Probab=99.31  E-value=1.1e-11  Score=88.48  Aligned_cols=200  Identities=13%  Similarity=0.071  Sum_probs=113.3

Q ss_pred             EEEC--CCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC
Q ss_conf             9998--7888800122179999999868989999647655422222222222212222222222222-222222223443
Q gi|254780166|r   30 LLIH--GLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH-LGISKVHVMGYS  106 (261)
Q Consensus        30 v~iH--G~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~-l~~~~~~liGhS  106 (261)
                      ||+.  +-+++..   .|..++..|. .+..|++.-.||++..+    +..-|++.+++.+.+.+.. ..-++++|+|||
T Consensus         1 vC~p~~~agg~~~---~Y~~lA~~L~-~~~~v~alq~pG~~~~e----p~p~s~e~lA~~~~~ai~~~~p~gPy~L~GhS   72 (212)
T smart00824        1 ICFPSTAAPSGPH---EYARLAAALR-GRRDVSALPLPGFGPGE----PLPASADALVEAQAEAVLRAAGGRPFVLVGHS   72 (212)
T ss_pred             CCCCCCCCCCCHH---HHHHHHHHCC-CCCCEEEEECCCCCCCC----CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             9898888888899---9999998579-99868985489989999----89889999999999999986799987999976


Q ss_pred             CCCCCHHHHHHH---CCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHH
Q ss_conf             444310133321---02356523896288563311035699999986311110000111000000003476654135677
Q gi|254780166|r  107 MGARIACSMVLF---YPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALAS  183 (261)
Q Consensus       107 ~Gg~ia~~~a~~---~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  183 (261)
                      |||.||.++|.+   ....+..|+++++.+.....................            ...... .......+..
T Consensus        73 ~Gg~vA~E~A~~L~a~G~~v~~L~llD~~~p~~~~~~~~~~~l~~~~~~~~------------~~~~~~-~~~~l~a~~~  139 (212)
T smart00824       73 SGGLLAHAVAARLEARGIPPAAVVLLDTYPPGDPAPEGWLPELLRGVFERE------------DSFVPM-DDARLTAMGA  139 (212)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH------------CCCCCC-CHHHHHHHHH
T ss_conf             858999999999997799942899958889987564420478888999865------------145677-7788998699


Q ss_pred             HHHHHCCCCCHHHHHCCCCCEEEEEECCC-CCCCCH--HHHHHHCC-CCEEEEECCCCCCCCCC-C-HHHHHHHHHHH
Q ss_conf             76541012200121003576069984788-878807--99999679-97999988887384348-4-89999999998
Q gi|254780166|r  184 CLSMIRKPFCQDDLYRIDVPVLIAVGSQD-DLAGSP--QELMSFIP-SSQYLNICRRDHLLAVG-D-KQFKQGVVNFY  255 (261)
Q Consensus       184 ~~~~~~~~~~~~~l~~i~~P~l~i~G~~D-~~~~~~--~~l~~~~p-~~~~~~i~~~gH~~~~e-~-p~~~~~i~~Fl  255 (261)
                      ....+..+    .-..+.+|++++.+.++ ...+..  ..=.+... ..+++.+|| +||-+++ + .++++.|.+||
T Consensus       140 ~~~l~~~~----~p~~~~~p~ll~~a~~~~~~~~~~~~~~W~~~~~~~~~~~~vpG-dHf~ml~e~~~~~A~~i~~wl  212 (212)
T smart00824      140 YLRLFGGW----TPGPVAAPTLLVRASEPLAEWPDEDPDGWRAHWPLPHTVVDVPG-DHFTMMEEHAAATARAVHDWL  212 (212)
T ss_pred             HHHHHHCC----CCCCCCCCEEEEECCCCCCCCCCHHHHHHHHCCCCCCEEEEECC-CCHHHHHHHHHHHHHHHHHHC
T ss_conf             99997357----89888898799980588888882134568745899966999789-772141430999999999769


No 63 
>COG4757 Predicted alpha/beta hydrolase [General function prediction only]
Probab=99.31  E-value=2.1e-11  Score=86.91  Aligned_cols=242  Identities=16%  Similarity=0.186  Sum_probs=138.0

Q ss_pred             EECCCCEEEEEEECCC-CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC-CCCCCCCCC-
Q ss_conf             9349949999996489-9878999987888800122179999999868989999647655422222222-222212222-
Q gi|254780166|r    9 RSWRKYQFAFYDVGDK-DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE-NDYRLVFMA-   85 (261)
Q Consensus         9 ~~~dG~~l~y~~~g~~-~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~-~~~s~~~~~-   85 (261)
                      -..||+.+.-..+... ..+--+++-|..+-.  ...+.+++...+.+||.|+++|+||.|.|..+... ..+...|++ 
T Consensus        11 ~~~DG~~l~~~~~pA~~~~~g~~~va~a~Gv~--~~fYRrfA~~a~~~Gf~Vlt~dyRG~g~S~p~~~~~~~~~~~DwA~   88 (281)
T COG4757          11 PAPDGYSLPGQRFPADGKASGRLVVAGATGVG--QYFYRRFAAAAAKAGFEVLTFDYRGIGQSRPASLSGSQWRYLDWAR   88 (281)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCC--HHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             25888657623136898777747732667730--5675799998630673189875125567773100367653456564


Q ss_pred             CCCCCCCCCCCC----CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHH----HCCCCCH
Q ss_conf             222222222222----22222344344431013332102356523896288563311035699999986----3111100
Q gi|254780166|r   86 ADAVSLLEHLGI----SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSF----LLPSIDE  157 (261)
Q Consensus        86 ~di~~~i~~l~~----~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~  157 (261)
                      .|+-+.++.++-    -+...||||+||.+. -++.+++ +...-...++.+.+... ....+......    ..+-+..
T Consensus        89 ~D~~aal~~~~~~~~~~P~y~vgHS~GGqa~-gL~~~~~-k~~a~~vfG~gagwsg~-m~~~~~l~~~~l~~lv~p~lt~  165 (281)
T COG4757          89 LDFPAALAALKKALPGHPLYFVGHSFGGQAL-GLLGQHP-KYAAFAVFGSGAGWSGW-MGLRERLGAVLLWNLVGPPLTF  165 (281)
T ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCCEEE-CCCCCCC-CCCEEEEECCCCCCCCC-HHHHHCCCCEEECCCCCCCHHH
T ss_conf             1259999998733779963886214452000-1155676-33304674255222330-0011022100241321353211


Q ss_pred             HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCC-------CHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCC
Q ss_conf             00111000000003476654135677765410122-------00121003576069984788878807--9999967997
Q gi|254780166|r  158 VQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF-------CQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSS  228 (261)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~  228 (261)
                      ++....+.+--..+..+....+....+++..+..+       .++..+++++|+..+...+|+.+|++  +.+....+|+
T Consensus       166 w~g~~p~~l~G~G~d~p~~v~RdW~RwcR~p~y~fddp~~~~~~q~yaaVrtPi~~~~~~DD~w~P~As~d~f~~~y~nA  245 (281)
T COG4757         166 WKGYMPKDLLGLGSDLPGTVMRDWARWCRHPRYYFDDPAMRNYRQVYAAVRTPITFSRALDDPWAPPASRDAFASFYRNA  245 (281)
T ss_pred             CCCCCCHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             01228386617886686258889999863864123686575799999885475466326778768878999998762147


Q ss_pred             EEEEE--CC----CCCCCCCCCH--HHHHHHHHHH
Q ss_conf             99998--88----8738434848--9999999998
Q gi|254780166|r  229 QYLNI--CR----RDHLLAVGDK--QFKQGVVNFY  255 (261)
Q Consensus       229 ~~~~i--~~----~gH~~~~e~p--~~~~~i~~Fl  255 (261)
                      .+..+  +.    .||+-..-+|  .+.+.+++++
T Consensus       246 pl~~~~~~~~~~~lGH~gyfR~~~Ealwk~~L~w~  280 (281)
T COG4757         246 PLEMRDLPRAEGPLGHMGYFREPFEALWKEMLGWF  280 (281)
T ss_pred             CCCCEECCCCCCCCCCHHHHCCCHHHHHHHHHHHH
T ss_conf             63002137222755402554062177899998754


No 64 
>pfam06821 DUF1234 Alpha/Beta hydrolase family of unknown function (DUF1234). The Crystal Structure Of The Yden Gene Product from B. Subtilis has been solved. The structure shows an alpha-beta hydrolase fold suggesting an enzymatic function for these proteins.
Probab=99.29  E-value=7.9e-12  Score=89.42  Aligned_cols=154  Identities=13%  Similarity=0.136  Sum_probs=98.6

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99998788880012217999999986898999964765542222222222221222222222222222222222344344
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMG  108 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~G  108 (261)
                      |+++||+++|....  |.++.+.-...   +..++++   +++.|      +.+++.+.+.+.+.... ++++|||||+|
T Consensus         1 VlIvhG~~~s~~~H--Wq~wl~~~~~~---~~~v~~~---d~~~P------~~~~W~~~L~~~l~~~d-~~~ilVaHSLG   65 (171)
T pfam06821         1 ILIVPGYGGSGPGH--WQSWWERRLPA---ARRVEQA---DWLQP------VLDDWVAALSAAVAAAP-GPVVLVAHSLG   65 (171)
T ss_pred             CEEECCCCCCCCHH--HHHHHHHHCCC---CEEECCC---CCCCC------CHHHHHHHHHHHHHHCC-CCEEEEEECHH
T ss_conf             98938989998536--79999987879---8794798---98998------99999999999997368-98599973578


Q ss_pred             CCCHHHHHHH-CCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             4310133321-023565238962885633110356999999863111100001110000000034766541356777654
Q gi|254780166|r  109 ARIACSMVLF-YPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM  187 (261)
Q Consensus       109 g~ia~~~a~~-~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (261)
                      +..+++++.. .+.+|.+++|+++.......                      .....+..+                  
T Consensus        66 c~~~l~~l~~~~~~~i~g~~LVAp~d~~~~~----------------------~~~~~~~~f------------------  105 (171)
T pfam06821        66 CLAVAHWAEPQLRAKVAGALLVAPADVEPSA----------------------PRPAALATF------------------  105 (171)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCCC----------------------CCCHHHHCC------------------
T ss_conf             9999999877414220448997268865566----------------------662332012------------------


Q ss_pred             HCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEECCCCCCCCCC
Q ss_conf             101220012100357606998478887880--79999967997999988887384348
Q gi|254780166|r  188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNICRRDHLLAVG  243 (261)
Q Consensus       188 ~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~~gH~~~~e  243 (261)
                           ..-...++.+|.++|..++|++++.  ++++++.+ +++++.++++||+..-+
T Consensus       106 -----~~~~~~~l~~~~~viaS~nDp~~~~~~a~~lA~~~-ga~~~~~~~~GHfn~~s  157 (171)
T pfam06821       106 -----APLPRDPLPFPSLVVASRNDPYCPFERAESLAQAW-GAEFVDLGHAGHINVDS  157 (171)
T ss_pred             -----CCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHC-CCEEEECCCCCCCCCCC
T ss_conf             -----55765568977799982799988999999999980-99389758988763303


No 65 
>pfam03403 PAF-AH_p_II isoform II. Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.
Probab=99.28  E-value=9.3e-11  Score=83.03  Aligned_cols=176  Identities=20%  Similarity=0.258  Sum_probs=101.9

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC--------CCCCC-------------CCCC---
Q ss_conf             98789999878888001221799999998689899996476554222--------22222-------------2222---
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD--------KSYIE-------------NDYR---   80 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~--------~~~~~-------------~~~s---   80 (261)
                      .-|.|||-||++++..   .+..+++.||.+||-|+++|.+..-.+.        .....             ..+.   
T Consensus        99 ~~PvvIFSHGlgg~R~---~yS~~~eeLAS~GyVV~aidH~d~Sa~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  175 (372)
T pfam03403        99 KYPLIVFSHGLGAFRT---IYSAICIELASHGFVVAAVEHRDRSASATYFFKDKNAAEVEEPSWIYLRDVNAEEEFKIRN  175 (372)
T ss_pred             CCCEEEECCCCCCCHH---HHHHHHHHHHCCCEEEEECCCCCCCCEEEEECCCCCCCCCCCCCEEECCCCCCHHHHHHHH
T ss_conf             8748998899876256---7899999987183299971567886403775477766546654212013556415688888


Q ss_pred             --CCCCCCCCCC--------------------------CCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCC
Q ss_conf             --1222222222--------------------------222222222222344344431013332102356523896288
Q gi|254780166|r   81 --LVFMAADAVS--------------------------LLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG  132 (261)
Q Consensus        81 --~~~~~~di~~--------------------------~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~  132 (261)
                        +...+.|+..                          +-..++.+++.++|||+||.-+...+.. ..|++..|..++.
T Consensus       176 ~qv~~R~~e~~~vl~~l~~l~~g~~~~~~~~~~~~~~~l~g~lD~~~I~~~GHSfGGATa~~~l~~-D~R~~agI~LDgw  254 (372)
T pfam03403       176 EQVGQRAQECSKALSIILQIDLGTPVENVLDSDFDLQQLKGNLDTSKIAVIGHSFGGATVIQSLSE-DTRFRCGIALDAW  254 (372)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHCCCCCCCEEEEEECCCHHHHHHHHHH-CCCCCEEEECCCC
T ss_conf             999999999999999999852588531124665456776054564635798534037999999861-8771379841552


Q ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCC
Q ss_conf             56331103569999998631111000011100000000347665413567776541012200121003576069984788
Q gi|254780166|r  133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD  212 (261)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D  212 (261)
                        +.                                                      ....+...++..|+|+|..+.=
T Consensus       255 --m~------------------------------------------------------Pl~~~~~~~~~~P~l~i~se~f  278 (372)
T pfam03403       255 --MY------------------------------------------------------PVGQDQYSQARQPLLFINSEKF  278 (372)
T ss_pred             --CC------------------------------------------------------CCCCCCCCCCCCCEEEEECCCC
T ss_conf             --36------------------------------------------------------5763200036887799834545


Q ss_pred             CCCCCHHHHHHHC---CCCEEEEECCCCCCCCCC-------------------CHH-----HHHHHHHHHHHHCC
Q ss_conf             8788079999967---997999988887384348-------------------489-----99999999875168
Q gi|254780166|r  213 DLAGSPQELMSFI---PSSQYLNICRRDHLLAVG-------------------DKQ-----FKQGVVNFYANELR  260 (261)
Q Consensus       213 ~~~~~~~~l~~~~---p~~~~~~i~~~gH~~~~e-------------------~p~-----~~~~i~~Fl~~~~~  260 (261)
                      ........+.+.+   +..+..+|+|+.|.-+.+                   +|+     .++.+++||.+.|+
T Consensus       279 ~~~~n~~~~~~~~~~~~~~~~~ti~gs~H~sftD~~~~~p~~~~~~~~~~g~idp~~~~~i~n~~~l~Fl~~hL~  353 (372)
T pfam03403       279 QWNENIFKMKKIYSPDKESKMITLKGSVHQNFSDFPFVTGKIIGKFFKLKGEIDPYEAMDIANRASLAFLQKHLD  353 (372)
T ss_pred             CCCCCHHHHHHHHCCCCCCEEEEECCCCCCCCCCCHHHCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             675568999987347887249997897467866410235187886426776669999999999999999998717


No 66 
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.24  E-value=3.2e-11  Score=85.80  Aligned_cols=210  Identities=20%  Similarity=0.230  Sum_probs=124.8

Q ss_pred             EEEECCCCEEEE----EEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC-----CCC--
Q ss_conf             999349949999----996489987899998788880012217999999986898999964765542222-----222--
Q gi|254780166|r    7 FFRSWRKYQFAF----YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK-----SYI--   75 (261)
Q Consensus         7 ~~~~~dG~~l~y----~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~-----~~~--   75 (261)
                      +|+.++|.+|+=    ...+++.-|.||--||++++...   |..++. ++..||.|+.+|.||.|.|..     |..  
T Consensus        60 Tf~g~~g~rI~gwlvlP~~~~~~~P~vV~fhGY~g~~g~---~~~~l~-wa~~Gyavf~MdvRGQg~~~~dt~~~p~~~s  135 (321)
T COG3458          60 TFTGYGGARIKGWLVLPRHEKGKLPAVVQFHGYGGRGGE---WHDMLH-WAVAGYAVFVMDVRGQGSSSQDTADPPGGPS  135 (321)
T ss_pred             EEECCCCCEEEEEEEEECCCCCCCCEEEEEEECCCCCCC---CCCCCC-CCCCCEEEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             972358835778998413457745569999613678887---320016-4224516999851467776556788989876


Q ss_pred             ------------CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC
Q ss_conf             ------------222221222222222222------22222222234434443101333210235652389628856331
Q gi|254780166|r   76 ------------ENDYRLVFMAADAVSLLE------HLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD  137 (261)
Q Consensus        76 ------------~~~~s~~~~~~di~~~i~------~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~  137 (261)
                                  +.+|-......|+...++      ...-+++.+.|.|.||.+++..++..| ++++++..=  |.+  
T Consensus       136 ~pG~mtrGilD~kd~yyyr~v~~D~~~ave~~~sl~~vde~Ri~v~G~SqGGglalaaaal~~-rik~~~~~~--Pfl--  210 (321)
T COG3458         136 DPGFMTRGILDRKDTYYYRGVFLDAVRAVEILASLDEVDEERIGVTGGSQGGGLALAAAALDP-RIKAVVADY--PFL--  210 (321)
T ss_pred             CCCEEEEECCCCCCCEEEEEEHHHHHHHHHHHHCCCCCCHHHEEEECCCCCCHHHHHHHHCCH-HHHCCCCCC--CCC--
T ss_conf             775167620368873697301377999999982667026314677336667505541010584-653434566--543--


Q ss_pred             CCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC
Q ss_conf             10356999999863111100001110000000034766541356777654101220012100357606998478887880
Q gi|254780166|r  138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS  217 (261)
Q Consensus       138 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~  217 (261)
                         .++++.+.-......+++    -..++...       .. -...+..+..+|...-..+|+.|+|+..|-.|+++++
T Consensus       211 ---~df~r~i~~~~~~~ydei----~~y~k~h~-------~~-e~~v~~TL~yfD~~n~A~RiK~pvL~svgL~D~vcpP  275 (321)
T COG3458         211 ---SDFPRAIELATEGPYDEI----QTYFKRHD-------PK-EAEVFETLSYFDIVNLAARIKVPVLMSVGLMDPVCPP  275 (321)
T ss_pred             ---CCCHHHEEECCCCCHHHH----HHHHHHCC-------CH-HHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             ---565101231464708999----99998528-------46-8899988756666657876066568862125788897


Q ss_pred             HHHHHH--HCCCC-EEEEECCCCCCC
Q ss_conf             799999--67997-999988887384
Q gi|254780166|r  218 PQELMS--FIPSS-QYLNICRRDHLL  240 (261)
Q Consensus       218 ~~~l~~--~~p~~-~~~~i~~~gH~~  240 (261)
                      +-+++.  .++.. ++.+++--+|.-
T Consensus       276 stqFA~yN~l~~~K~i~iy~~~aHe~  301 (321)
T COG3458         276 STQFAAYNALTTSKTIEIYPYFAHEG  301 (321)
T ss_pred             HHHHHHHHCCCCCCEEEEEECCCCCC
T ss_conf             12677753036773278740335444


No 67 
>pfam06500 DUF1100 Alpha/beta hydrolase of unknown function (DUF1100). This family consists of several hypothetical bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Probab=99.24  E-value=3.3e-10  Score=79.77  Aligned_cols=228  Identities=16%  Similarity=0.222  Sum_probs=129.4

Q ss_pred             CCCEE-EEEEECCCCCC-EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99499-99996489987-89999878888001221799999998689899996476554222222222222122222222
Q gi|254780166|r   12 RKYQF-AFYDVGDKDAP-TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAV   89 (261)
Q Consensus        12 dG~~l-~y~~~g~~~~~-~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~   89 (261)
                      +|.++ .|.+..+.++| |+|++.|...+..+ .+|..+-.+|+++|+-.+++|+|+.|.|.+-.-.++-|.=  -.++.
T Consensus       173 ~g~~i~gfLHLP~~~~P~PtViv~ggLDsLQ~-D~~rLF~dyLaP~giAMLTlDMPSvG~Ss~w~LtqDtS~L--HQaVL  249 (411)
T pfam06500       173 QKGKITGFLHLPNTDKPFPVVLVSAGLDSLQT-DMWRLFRDYLAPRDIAMLTIDMPSVGASSKWPLTEDSSCL--HQAVL  249 (411)
T ss_pred             CCCEEEEEEECCCCCCCCCEEEEECCHHHHHH-HHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCHHHH--HHHHH
T ss_conf             69737899856899998886999577257788-8999999853745733797047877754645555514799--99999


Q ss_pred             CCCCCC---CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             222222---22222223443444310133321023565238962885633110356999999863111100001110000
Q gi|254780166|r   90 SLLEHL---GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF  166 (261)
Q Consensus        90 ~~i~~l---~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (261)
                      .-+..+   +-.++.++|.=+||.+|.+++...|+++++++-.++.--....+    ....+..+..-++-+.+.++.. 
T Consensus       250 ~~L~~vPWVDh~Rv~~~GfRFG~NvAvRLayLEp~rlKav~~lG~~VH~ll~~----~~~~~~~P~MylDvlASRLG~~-  324 (411)
T pfam06500       250 NALADVPWVDHHRVGLFGFRFGGNAMVRLAFLESEKVKACVCLGAPVHDLFTS----PKKLQKMPKMYLDVLASRLGKS-  324 (411)
T ss_pred             HHCCCCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCEEEEEEECHHHHHHHCC----HHHHHHCCHHHHHHHHHHHCCC-
T ss_conf             85579986324245787642023699999850601013899837388887358----8877447689999999873764-


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHH--CCCCCHHHHHCCCCCEEEEEECCCCCCCCHH-HHH-HHCCCCEEEEECCCCCCCCC
Q ss_conf             0000347665413567776541--0122001210035760699847888788079-999-96799799998888738434
Q gi|254780166|r  167 RKFADLDPGNDLKALASCLSMI--RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ-ELM-SFIPSSQYLNICRRDHLLAV  242 (261)
Q Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~-~l~-~~~p~~~~~~i~~~gH~~~~  242 (261)
                              ..+...+...+..+  +....-. =.+..+|+|-+.=++|++.|..+ ++. ..-.+.+...|+..-   .+
T Consensus       325 --------~~d~~~L~~el~~~SLK~QGlL~-gRr~~vPmLa~~~~~Dp~sP~~d~~Lia~sS~~Gk~~~i~~~p---v~  392 (411)
T pfam06500       325 --------DVDDESLSGQMNAWSLKVQGFLS-GRRTKTPILAGSLEGDPVSPYSDNQLVASFSADGKAKKIPSKT---IY  392 (411)
T ss_pred             --------CCCHHHHHHHHHHCCHHHHCCCC-CCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCEEECCCCC---HH
T ss_conf             --------37889999875231045521346-7758985154112799989767889999855688456568974---25


Q ss_pred             CC-HHHHHHHHHHHHHHC
Q ss_conf             84-899999999987516
Q gi|254780166|r  243 GD-KQFKQGVVNFYANEL  259 (261)
Q Consensus       243 e~-p~~~~~i~~Fl~~~~  259 (261)
                      +. .+-...+.+||++++
T Consensus       393 ~~~~~aL~~~~~WL~~~l  410 (411)
T pfam06500       393 QGYEQSLDLAIKWLEDEL  410 (411)
T ss_pred             HHHHHHHHHHHHHHHHHC
T ss_conf             579999999999998533


No 68 
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism]
Probab=99.23  E-value=3.5e-11  Score=85.56  Aligned_cols=221  Identities=14%  Similarity=0.134  Sum_probs=122.5

Q ss_pred             CCCEEEEECCCCCCCHH--HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98789999878888001--2217999999986898999964765542222222222221222222222222222222222
Q gi|254780166|r   25 DAPTILLIHGLASSVQT--NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHV  102 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~--~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~l  102 (261)
                      -++|++.+|.+.-..-.  ...-++.+..+.++|+.|..+++++=..+.+...-++|=.+...+-+..+.+..+.+++.+
T Consensus       106 ~~~PlLiVpP~iNk~yI~DL~~~~s~V~~l~~~g~~vfvIsw~nPd~~~~~~~~edYi~e~l~~aid~V~~itg~~dInl  185 (445)
T COG3243         106 LKRPLLIVPPWINKFYILDLSPEKSLVRWLLEQGLDVFVISWRNPDASLAAKNLEDYILEGLSEAIDTVKDITGQKDINL  185 (445)
T ss_pred             CCCCEEEECCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEECCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCE
T ss_conf             78844863443375247867877408999997598368996158607655346999999999999999998747651235


Q ss_pred             CCCCCCCCCHHHHHHHCCCC-CCCEEEECCCCCCCC-------CCHHHHHHHHHHHHCCC-CCHH---------------
Q ss_conf             34434443101333210235-652389628856331-------10356999999863111-1000---------------
Q gi|254780166|r  103 MGYSMGARIACSMVLFYPSY-VRSVILGGVGSVLYD-------SDVVDWQSLIDSFLLPS-IDEV---------------  158 (261)
Q Consensus       103 iGhS~Gg~ia~~~a~~~p~~-v~~lvl~~~~~~~~~-------~~~~~~~~~~~~~~~~~-~~~~---------------  158 (261)
                      +|+|.||+++..+++.++.+ |+++++..+.-....       ......+.........+ +...               
T Consensus       186 iGyC~GGt~~~~a~a~~~~~~I~S~T~~ts~~Df~~~g~l~~f~~~~~~~~~~~~~~~~g~ipg~~ma~~F~mLrp~dli  265 (445)
T COG3243         186 IGYCVGGTLLAAALALMAAKRIKSLTLLTSPVDFSHAGDLGIFANEATIEALDADIVQKGILPGWYMAIVFFLLRPNDLI  265 (445)
T ss_pred             EEECCCHHHHHHHHHHHHHCCCCEEEEEECCHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCHHHH
T ss_conf             54614569999999974431224467773201003575100126878999998642221678808999999863931101


Q ss_pred             -----------HHHHHHHHCCCCC---CCCCCCHHHHH-HHHH-------HHCCCCCHHHHHCCCCCEEEEEECCCCCCC
Q ss_conf             -----------0111000000003---47665413567-7765-------410122001210035760699847888788
Q gi|254780166|r  159 -----------QNPLGKKFRKFAD---LDPGNDLKALA-SCLS-------MIRKPFCQDDLYRIDVPVLIAVGSQDDLAG  216 (261)
Q Consensus       159 -----------~~~~~~~~~~~~~---~~~~~~~~~~~-~~~~-------~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~  216 (261)
                                 +.++.-....+..   ..++.....+. .++.       .+.-....-+|.+|+||++.+.|++|.++|
T Consensus       266 w~~fV~nyl~ge~pl~fdllyWn~Dst~~~~~~~~~~Lrn~y~~N~L~~g~~~v~G~~VdL~~It~pvy~~a~~~DhIaP  345 (445)
T COG3243         266 WNYFVNNYLDGEQPLPFDLLYWNADSTRLPGAAHSEYLRNFYLENRLIRGGLEVSGTMVDLGDITCPVYNLAAEEDHIAP  345 (445)
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHCHHHCCCEEECCEEECHHHCCCCEEEEECCCCCCCC
T ss_conf             68889886178888723678860778657668999999999973744306548888894223266423886303465566


Q ss_pred             CH--HHHHHHCCCCEEEEECCCCCCCCC-CCH
Q ss_conf             07--999996799799998888738434-848
Q gi|254780166|r  217 SP--QELMSFIPSSQYLNICRRDHLLAV-GDK  245 (261)
Q Consensus       217 ~~--~~l~~~~p~~~~~~i~~~gH~~~~-e~p  245 (261)
                      ..  ...++..++-...++-++||+..+ .+|
T Consensus       346 ~~Sv~~g~~l~~g~~~f~l~~sGHIa~vVN~p  377 (445)
T COG3243         346 WSSVYLGARLLGGEVTFVLSRSGHIAGVVNPP  377 (445)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCEEEEEECCC
T ss_conf             89898898754996499983686078885782


No 69 
>pfam07859 Abhydrolase_3 alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.
Probab=99.21  E-value=2.2e-11  Score=86.81  Aligned_cols=190  Identities=18%  Similarity=0.151  Sum_probs=99.4

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------CCCCC--C
Q ss_conf             999987888800122179999999868-9899996476554222222222222122222222222-------22222--2
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQ-GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLL-------EHLGI--S   98 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~-g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i-------~~l~~--~   98 (261)
                      ||++||.+-...+......+...++.+ ||.|+.+|+|=.     |.    ......++|+.+.+       +.+++  +
T Consensus         1 ii~iHGGg~~~g~~~~~~~~~~~la~~~g~~v~~~dYrla-----Pe----~~~p~~~~D~~~a~~~l~~~~~~~~~d~~   71 (209)
T pfam07859         1 LVYFHGGGFVLGSADTHDRLCRRLAARAGAVVVSVDYRLA-----PE----HPFPAAIEDAYAALRWLAEHAAELGADPS   71 (209)
T ss_pred             CEEECCCHHHCCCHHHHHHHHHHHHHHCCCEEEEEECCCC-----CC----CCCCHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             9999381222198688999999999873988999879998-----88----98827999999999999998998099954


Q ss_pred             CCCCCCCCCCCCCHHHHHHHCC----CCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHH-HHHHHCCCCCCC
Q ss_conf             2222344344431013332102----35652389628856331103569999998631111000011-100000000347
Q gi|254780166|r   99 KVHVMGYSMGARIACSMVLFYP----SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-LGKKFRKFADLD  173 (261)
Q Consensus        99 ~~~liGhS~Gg~ia~~~a~~~p----~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  173 (261)
                      ++.++|+|-||.+++.++....    ..++++++.++...............   .. .. ...... .....+.+....
T Consensus        72 ~I~l~G~SAGG~La~~~~~~~~~~~~~~p~~~~~~~p~~d~~~~~~~~~~~~---~~-~~-~~~~~~~~~~~~~~~~~~~  146 (209)
T pfam07859        72 RIAVAGDSAGGNLAAALALRARDRGLPLPAGQVLIYPGLDLRTESESYEARE---YA-DG-PLLTRDDMDWFWRLYLPGA  146 (209)
T ss_pred             EEEEEEECCCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCHHHHC---CC-CC-CCCCHHHHHHHHHHHCCCC
T ss_conf             2699997830779999999976548988566999778227888861122220---36-77-6669999999999727877


Q ss_pred             CCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHC----CCCEEEEECCCCCCCCC
Q ss_conf             6654135677765410122001210035760699847888788079999967----99799998888738434
Q gi|254780166|r  174 PGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFI----PSSQYLNICRRDHLLAV  242 (261)
Q Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~----p~~~~~~i~~~gH~~~~  242 (261)
                      ...++  ..+       .....+++.+ -|+++++|+.|.+.+..+++++.+    -.+++.++++.+|..++
T Consensus       147 ~~~~~--~~s-------P~~~~~~~~~-PP~~i~~G~~D~l~~~s~~f~~~L~~~Gv~~~l~~~~g~~H~F~l  209 (209)
T pfam07859       147 DRDHP--LAS-------PLFAADLSGL-PPALVVVAEFDPLRDEGEAYAERLRAAGVPVELVEYPGMIHGFHL  209 (209)
T ss_pred             CCCCC--CCC-------CCCCCCCCCC-CCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEC
T ss_conf             74573--338-------4437530169-987999668688779999999999987997899998993475369


No 70 
>COG0400 Predicted esterase [General function prediction only]
Probab=99.21  E-value=6.8e-11  Score=83.85  Aligned_cols=171  Identities=24%  Similarity=0.291  Sum_probs=108.5

Q ss_pred             ECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC--------CCCCCCCCCC-------CC
Q ss_conf             64899878999987888800122179999999868989999647655422222--------2222222122-------22
Q gi|254780166|r   21 VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS--------YIENDYRLVF-------MA   85 (261)
Q Consensus        21 ~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~--------~~~~~~s~~~-------~~   85 (261)
                      -+++..|+||++||+|++..+   +.+....+.++ .+++.+  ||  .+..+        .+...|+.++       ++
T Consensus        13 ~~~p~~~~iilLHG~Ggde~~---~~~~~~~~~P~-~~~is~--rG--~v~~~g~~~~f~~~~~~~~d~edl~~~~~~~~   84 (207)
T COG0400          13 PGDPAAPLLILLHGLGGDELD---LVPLPELILPN-ATLVSP--RG--PVAENGGPRFFRRYDEGSFDQEDLDLETEKLA   84 (207)
T ss_pred             CCCCCCCEEEEEECCCCCHHH---HHHHHHHCCCC-CEEECC--CC--CCCCCCCCCCEEECCCCCCCHHHHHHHHHHHH
T ss_conf             899998689998458997555---43116551999-748757--88--74556702360433777633566888799999


Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             222222222222--222223443444310133321023565238962885633110356999999863111100001110
Q gi|254780166|r   86 ADAVSLLEHLGI--SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLG  163 (261)
Q Consensus        86 ~di~~~i~~l~~--~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (261)
                      +-+..+.++.++  ++++++|+|-||.+++....++|+.++++++.++.......                         
T Consensus        85 ~~l~~~~~~~gi~~~~ii~~GfSqGA~ial~~~l~~~~~~~~ail~~g~~~~~~~-------------------------  139 (207)
T COG0400          85 EFLEELAEEYGIDSSRIILIGFSQGANIALSLGLTLPGLFAGAILFSGMLPLEPE-------------------------  139 (207)
T ss_pred             HHHHHHHHHHCCCHHHEEEEECCHHHHHHHHHHHHCCHHHCCCHHCCCCCCCCCC-------------------------
T ss_conf             9999999983998122689851707999999998585000520220786788876-------------------------


Q ss_pred             HHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHH----HCCCCEEEEECCCC
Q ss_conf             0000000347665413567776541012200121003576069984788878807--99999----67997999988887
Q gi|254780166|r  164 KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMS----FIPSSQYLNICRRD  237 (261)
Q Consensus       164 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~----~~p~~~~~~i~~~g  237 (261)
                                                   ...+++  ..|+++++|+.|++++..  +++.+    .--+++...++ .|
T Consensus       140 -----------------------------~~~~~~--~~pill~hG~~Dpvvp~~~~~~l~~~l~~~g~~v~~~~~~-~G  187 (207)
T COG0400         140 -----------------------------LLPDLA--GTPILLSHGTEDPVVPLALAEALAEYLTASGADVEVRWHE-GG  187 (207)
T ss_pred             -----------------------------CCCCCC--CCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC-CC
T ss_conf             -----------------------------653247--9728871467688468889999999999819977999836-88


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             3843484899999999987516
Q gi|254780166|r  238 HLLAVGDKQFKQGVVNFYANEL  259 (261)
Q Consensus       238 H~~~~e~p~~~~~i~~Fl~~~~  259 (261)
                      |-+.   ++..+.+.+|+.+..
T Consensus       188 H~i~---~e~~~~~~~wl~~~~  206 (207)
T COG0400         188 HEIP---PEELEAARSWLANTL  206 (207)
T ss_pred             CCCC---HHHHHHHHHHHHHCC
T ss_conf             8689---999999999998606


No 71 
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]
Probab=99.19  E-value=4e-10  Score=79.28  Aligned_cols=182  Identities=20%  Similarity=0.279  Sum_probs=118.1

Q ss_pred             EEEEEECCCCCCEEEEECCC---CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999648998789999878---888001221799999998689899996476554222222222222122222222222
Q gi|254780166|r   16 FAFYDVGDKDAPTILLIHGL---ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLL   92 (261)
Q Consensus        16 l~y~~~g~~~~~~vv~iHG~---~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i   92 (261)
                      ..|.....+..|..|.+|..   +|+.. +.....++..|.+.||.|+.+|+||-|.|.+..+.   .+-. .+|..+.+
T Consensus        18 ~~~~~~~~~~~~iAli~HPHPl~gGtm~-nkvv~~la~~l~~~G~atlRfNfRgvG~S~G~fD~---GiGE-~~Da~aal   92 (210)
T COG2945          18 GRYEPAKTPAAPIALICHPHPLFGGTMN-NKVVQTLARALVKRGFATLRFNFRGVGRSQGEFDN---GIGE-LEDAAAAL   92 (210)
T ss_pred             ECCCCCCCCCCCEEEECCCCCCCCCCCC-CHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC---CCCH-HHHHHHHH
T ss_conf             0337877887752796389812267667-79999999999868963896403325677786568---8552-88899999


Q ss_pred             CCCCC-----CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHC
Q ss_conf             22222-----2222234434443101333210235652389628856331103569999998631111000011100000
Q gi|254780166|r   93 EHLGI-----SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFR  167 (261)
Q Consensus        93 ~~l~~-----~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  167 (261)
                      +.++.     ..+-+.|+|+|++|++.+|.+.|+--   ++++..+...                            .++
T Consensus        93 dW~~~~hp~s~~~~l~GfSFGa~Ia~~la~r~~e~~---~~is~~p~~~----------------------------~~d  141 (210)
T COG2945          93 DWLQARHPDSASCWLAGFSFGAYIAMQLAMRRPEIL---VFISILPPIN----------------------------AYD  141 (210)
T ss_pred             HHHHHHCCCCHHHHHHCCCHHHHHHHHHHHHCCCCC---EEEECCCCCC----------------------------CCH
T ss_conf             999862888434531035658999999997465555---0354047767----------------------------301


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHC-CCCEEEEECCCCCCCCCCCHH
Q ss_conf             0003476654135677765410122001210035760699847888788079999967-997999988887384348489
Q gi|254780166|r  168 KFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFI-PSSQYLNICRRDHLLAVGDKQ  246 (261)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~-p~~~~~~i~~~gH~~~~e~p~  246 (261)
                       +                         ..+.-..+|.++++|+.|.+++....+.-.- ..-+++++++++||.+-.-.+
T Consensus       142 -f-------------------------s~l~P~P~~~lvi~g~~Ddvv~l~~~l~~~~~~~~~~i~i~~a~HFF~gKl~~  195 (210)
T COG2945         142 -F-------------------------SFLAPCPSPGLVIQGDADDVVDLVAVLKWQESIKITVITIPGADHFFHGKLIE  195 (210)
T ss_pred             -H-------------------------HHCCCCCCCCEEEECCHHHHHCHHHHHHHHCCCCCCEEEECCCCCEECCCHHH
T ss_conf             -3-------------------------22267898730675470322258999876327888558866988321001789


Q ss_pred             HHHHHHHHHH-HHC
Q ss_conf             9999999987-516
Q gi|254780166|r  247 FKQGVVNFYA-NEL  259 (261)
Q Consensus       247 ~~~~i~~Fl~-~~~  259 (261)
                      +.+.+.+|+. +.+
T Consensus       196 l~~~i~d~l~~r~l  209 (210)
T COG2945         196 LRDTIADFLEDRRL  209 (210)
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999987320025


No 72 
>PRK10162 acetyl esterase; Provisional
Probab=99.18  E-value=1.1e-09  Score=76.59  Aligned_cols=224  Identities=18%  Similarity=0.115  Sum_probs=114.1

Q ss_pred             EEEEEEECCC-CC-CEEEEECCCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC---CC
Q ss_conf             9999996489-98-7899998788880012217999999986-89899996476554222222222222122222---22
Q gi|254780166|r   15 QFAFYDVGDK-DA-PTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA---DA   88 (261)
Q Consensus        15 ~l~y~~~g~~-~~-~~vv~iHG~~~~~~~~~~~~~~~~~l~~-~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~---di   88 (261)
                      .+..+.+.+. ++ ++|+++||.|--..+......+...|+. .|..|+.+|+|     -.|+.+.+..+++...   .+
T Consensus        71 ~i~~RiY~p~~~~~~vily~HGGGfv~Gs~~thd~~~r~lA~~~g~~VvsVDYR-----LAPEh~fPaaleD~~aa~~w~  145 (319)
T PRK10162         71 QVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYT-----LSPEARFPQAIEEIVAACCYF  145 (319)
T ss_pred             CEEEEEECCCCCCCEEEEEECCCEEECCCHHHHHHHHHHHHHHHCCEEEEECCC-----CCCCCCCCHHHHHHHHHHHHH
T ss_conf             813899644899981899986981006887898999999999719989991389-----898898857999999999999


Q ss_pred             CCCCCCCCC--CCCCCCCCCCCCCCHHHHHHHCCC------CCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             222222222--222223443444310133321023------565238962885633110356999999863111100001
Q gi|254780166|r   89 VSLLEHLGI--SKVHVMGYSMGARIACSMVLFYPS------YVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQN  160 (261)
Q Consensus        89 ~~~i~~l~~--~~~~liGhS~Gg~ia~~~a~~~p~------~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (261)
                      .+-.+.+++  +++.+.|.|-||.+++..+..-.+      .+.++++.-+..........  .     ........+..
T Consensus       146 ~~~a~~~g~d~~rI~v~GDSAGG~LA~a~al~lrd~~~~~~~~~~~~l~~~~~~~~~~~s~--~-----~~~~~~~~lt~  218 (319)
T PRK10162        146 HQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTR--R-----LLGGVWDGLTQ  218 (319)
T ss_pred             HHHHHHCCCCCHHCEEEECCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCH--H-----HHCCCCCCCCH
T ss_conf             9768870989110456634812689999999866446887763468985676789998146--6-----63566655589


Q ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHH-HCCCCCEEEEEECCCCCCCCHHHHHHHC----CCCEEEEECC
Q ss_conf             1100000000347665413567776541012200121-0035760699847888788079999967----9979999888
Q gi|254780166|r  161 PLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDL-YRIDVPVLIAVGSQDDLAGSPQELMSFI----PSSQYLNICR  235 (261)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~~i~~P~l~i~G~~D~~~~~~~~l~~~~----p~~~~~~i~~  235 (261)
                      ....++....-.........+..        ....++ +.+ -|++++.|+.|......+.+++.+    -.+++.+++|
T Consensus       219 ~~~~~~~~~yl~~~~~~~~P~~~--------~~~~d~~~gl-PPtlI~~a~~DpLrDd~~~ya~~L~~aGv~v~~~~y~G  289 (319)
T PRK10162        219 QDLQMYEEAYLSNDADRESPYYC--------LFNNDLTREV-PPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPG  289 (319)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCC--------CCCCCCCCCC-CCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             99999999855897443464347--------6676001699-98799853767103429999999998699789999799


Q ss_pred             CCCCC-CCC--CH---HHHHHHHHHHHHHC
Q ss_conf             87384-348--48---99999999987516
Q gi|254780166|r  236 RDHLL-AVG--DK---QFKQGVVNFYANEL  259 (261)
Q Consensus       236 ~gH~~-~~e--~p---~~~~~i~~Fl~~~~  259 (261)
                      ..|-+ ++.  -|   +..+.+.+||.++|
T Consensus       290 ~~HgF~~~~~~l~~A~~Al~~~a~F~~~~l  319 (319)
T PRK10162        290 TLHAFLHYSRMMKTADEALRDGAQFFTAQL  319 (319)
T ss_pred             CCEEHHCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             827232264638799999999999999539


No 73 
>pfam06028 DUF915 Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Probab=99.12  E-value=2.8e-09  Score=74.25  Aligned_cols=202  Identities=16%  Similarity=0.139  Sum_probs=112.4

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHH-HCC--CEE--EEECCCCC----CC----CCCCCC------CCCCCCCCC
Q ss_conf             998789999878888001221799999998-689--899--99647655----42----222222------222221222
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLC-DQG--FRV--IAFDNLGH----GK----SDKSYI------ENDYRLVFM   84 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~-~~g--~~v--i~~D~~G~----G~----S~~~~~------~~~~s~~~~   84 (261)
                      ....|.||+||++++..+   +...+..+. ++|  -.+  +..+.-|.    |.    ...|.-      ..+-++...
T Consensus         4 ~~~tPTifihG~~g~~~s---~~~mv~~~~~k~g~~~~~l~v~V~~~G~v~~~G~~~~~~~nPiIqV~F~dN~~~~~~~q   80 (249)
T pfam06028         4 QRMIPTIFIHGSGGTASS---FNFMVNQLLNKYGVGNKSLTAYVSKDGSVKVEGKISKDAKNPIIKVGFEDNRNASFDKQ   80 (249)
T ss_pred             CCCCCEEEECCCCCCCHH---HHHHHHHHHHHCCCCCEEEEEEECCCCCEEEEEEECCCCCCCEEEEEECCCCCCCHHHH
T ss_conf             888986998988887055---99999999873488861599999489829998770577879879999345888998999


Q ss_pred             CCCCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHCCC-----CCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             22222222222----22222223443444310133321023-----5652389628856331103569999998631111
Q gi|254780166|r   85 AADAVSLLEHL----GISKVHVMGYSMGARIACSMVLFYPS-----YVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSI  155 (261)
Q Consensus        85 ~~di~~~i~~l----~~~~~~liGhS~Gg~ia~~~a~~~p~-----~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (261)
                      ++.+..++..|    +++++-+|||||||.....|+..+..     .+.++|.++.+..........             
T Consensus        81 a~wl~~vl~~L~~~Y~~~~~N~VGHSmGg~~~~~yl~~~~~~~~~P~l~K~V~Ia~pfng~~~~~~~-------------  147 (249)
T pfam06028        81 AKWLKKVMSYLKSNYNFKKFNAVGHSMGGLAATYYLEDYGNDKSLPQLNKLVTIGGPFNGETNNDLG-------------  147 (249)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHCCCCCCCCHHEEEEECCCCCCCCCCCCC-------------
T ss_conf             9999999999998549756779987664399999999844677886231599962685751236775-------------


Q ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEEC------CCCCCCC--HHHHHHHCC-
Q ss_conf             0000111000000003476654135677765410122001210035760699847------8887880--799999679-
Q gi|254780166|r  156 DEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGS------QDDLAGS--PQELMSFIP-  226 (261)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~------~D~~~~~--~~~l~~~~p-  226 (261)
                              ..........+......+..+.....     ..+++ ++.+|-|.|.      .|-.+|.  ++.+...+. 
T Consensus       148 --------~~~~~~~~~~p~~~~~~y~~l~~~~~-----~~~p~-~i~vLnI~G~~~~g~~sDg~V~~~Ss~sl~yl~~~  213 (249)
T pfam06028       148 --------QTLAIVLKDGPKNKTPMYDYLIDNYK-----KKIPS-DLEVLNIAGDLDNGKQTDGIVPWASSLSGKYLFQK  213 (249)
T ss_pred             --------CCCCCCCCCCCCCCCHHHHHHHHHHH-----HCCCC-CCEEEEEEEECCCCCCCCCEEEHHHHHHHHHHHCC
T ss_conf             --------32111246898646999999998665-----24899-97899984236889988862648999999998615


Q ss_pred             ---CCEEEEEC--CCCCCCCCCCHHHHHHHHHHH
Q ss_conf             ---97999988--887384348489999999998
Q gi|254780166|r  227 ---SSQYLNIC--RRDHLLAVGDKQFKQGVVNFY  255 (261)
Q Consensus       227 ---~~~~~~i~--~~gH~~~~e~p~~~~~i~~Fl  255 (261)
                         .-+-.+++  ++.|--.-|.|++.+.|.+||
T Consensus       214 ~~~~Y~e~~v~G~~a~HS~LheN~~V~~~I~~FL  247 (249)
T pfam06028       214 NAKSYTEHLITGKEAGHSKLHENPEVDKYVKQFL  247 (249)
T ss_pred             CCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHC
T ss_conf             6685399999589974276878889999999851


No 74 
>COG0657 Aes Esterase/lipase [Lipid metabolism]
Probab=99.11  E-value=2.2e-09  Score=74.92  Aligned_cols=214  Identities=17%  Similarity=0.097  Sum_probs=108.9

Q ss_pred             CCCCEEEEECCCCCCCHHHHHH-HHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CC--C
Q ss_conf             9987899998788880012217-9999999868989999647655422222222222212222222222222---22--2
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLF-SGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH---LG--I   97 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~-~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~---l~--~   97 (261)
                      +..|.||++||.+-........ ..........|+.|+.+|+|=-     |....+-.+++..+-+.-+.++   ++  -
T Consensus        77 ~~~p~vly~HGGg~~~g~~~~~~~~~~~~~~~~g~~vv~vdYrla-----Pe~~~p~~~~d~~~a~~~l~~~~~~~g~dp  151 (312)
T COG0657          77 ATAPVVLYLHGGGWVLGSLRTHDALVARLAAAAGAVVVSVDYRLA-----PEHPFPAALEDAYAAYRWLRANAAELGIDP  151 (312)
T ss_pred             CCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCC-----CCCCCCCHHHHHHHHHHHHHHCCHHHCCCC
T ss_conf             887679998897544788035689999999876988999722678-----888885049999999999984346427786


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCC----CCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHH-HHHHH-CCCCC
Q ss_conf             222223443444310133321023----5652389628856331103569999998631111000011-10000-00003
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFYPS----YVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-LGKKF-RKFAD  171 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~p~----~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~-~~~~~  171 (261)
                      +++.++|+|-||.+++.++..-.+    .....+++.+...... ...........      ...... ...++ ..+..
T Consensus       152 ~~i~v~GdSAGG~La~~~a~~~~~~~~~~p~~~~li~P~~d~~~-~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~  224 (312)
T COG0657         152 SRIAVAGDSAGGHLALALALAARDRGLPLPAAQVLISPLLDLTS-SAASLPGYGEA------DLLDAAAILAWFADLYLG  224 (312)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHCCCCCCCHHEEECCCCCCCC-CCCHHHHHCCC------CCCCHHHHHHHHHHHHCC
T ss_conf             63599985843999999999754236888422203333324444-54102330334------431267888789998504


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHC----CCCEEEEECCCCCCC-CCCCHH
Q ss_conf             476654135677765410122001210035760699847888788079999967----997999988887384-348489
Q gi|254780166|r  172 LDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFI----PSSQYLNICRRDHLL-AVGDKQ  246 (261)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~----p~~~~~~i~~~gH~~-~~e~p~  246 (261)
                      ..  .+...     ..... ...+.+.. --|+++++|+.|.+.+..+.+++.+    ..+++..+++..|.. .+..|+
T Consensus       225 ~~--~~~~~-----p~~sp-l~~~~~~~-lPP~~i~~a~~D~l~~~~~~~a~~L~~agv~~~~~~~~g~~H~f~~~~~~~  295 (312)
T COG0657         225 AA--PDRED-----PEASP-LASDDLSG-LPPTLIQTAEFDPLRDEGEAYAERLRAAGVPVELRVYPGMIHGFDLLTGPE  295 (312)
T ss_pred             CC--CCCCC-----CCCCC-CCCCCCCC-CCCEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHH
T ss_conf             66--44458-----55286-54665358-999899844788773039999999996699548887689744501358888


Q ss_pred             ---HHHHHHHHHHHH
Q ss_conf             ---999999998751
Q gi|254780166|r  247 ---FKQGVVNFYANE  258 (261)
Q Consensus       247 ---~~~~i~~Fl~~~  258 (261)
                         ....+.+|+.+.
T Consensus       296 a~~~~~~~~~~l~~~  310 (312)
T COG0657         296 ARSALRQIAAFLRAA  310 (312)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999864


No 75 
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 1, TIGR03100) of the same superfamily.
Probab=99.10  E-value=1.8e-10  Score=81.27  Aligned_cols=124  Identities=16%  Similarity=0.240  Sum_probs=95.5

Q ss_pred             EEEEECCCCEEEEEEE--CCCCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             7999349949999996--48998789999878888001-22179999999868989999647655422222222222212
Q gi|254780166|r    6 KFFRSWRKYQFAFYDV--GDKDAPTILLIHGLASSVQT-NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV   82 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~--g~~~~~~vv~iHG~~~~~~~-~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~   82 (261)
                      -|+....|..+..++-  +.+....||++|.|+--... ..+...+++.|+..||-|+.+|++|+|+|.+...+  -+.+
T Consensus         3 ffl~~~~g~~F~~~h~P~~~~~~g~vl~~~PFaeE~n~srRm~a~~A~~laa~G~~vLrfD~~G~GDSaGdf~~--a~we   80 (266)
T TIGR03101         3 FFLDAPHGFRFCLYHPPVAVGPRGVVIYLPPFAEEMNKSRRMVALQARAFAAGGFGVLQIDLYGCGDSAGDFAA--ARWD   80 (266)
T ss_pred             EECCCCCCCEEEEEECCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC--CHHH
T ss_conf             02058998658997379888985079993840765314489999999999867974996244677786455540--2288


Q ss_pred             CCCCCCCCCCCC---CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECC
Q ss_conf             222222222222---2222222234434443101333210235652389628
Q gi|254780166|r   83 FMAADAVSLLEH---LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV  131 (261)
Q Consensus        83 ~~~~di~~~i~~---l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~  131 (261)
                      .+.+|+..-.+.   .+..+++|.|.-.|+.++..+|.+.+..+.+|||-.|
T Consensus        81 ~W~~Dv~aA~~~L~~~g~~~v~LwGLRlGAlLA~~aA~~~~~~v~~LVLWqP  132 (266)
T TIGR03101        81 VWKEDVAAAYRWLIEQGHPPVTLWGLRLGALLALDAANPLAAKCNRLVLWQP  132 (266)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             8999999999999864999568984004089999998644567673899702


No 76 
>pfam05728 UPF0227 Uncharacterized protein family (UPF0227). Despite being classed as uncharacterized proteins, the members of this family are almost certainly enzymes that are distantly related to the pfam00561.
Probab=99.10  E-value=5.4e-10  Score=78.50  Aligned_cols=183  Identities=15%  Similarity=0.075  Sum_probs=105.8

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCC--CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9999878888001221799999998689--89999647655422222222222212222222222222222222223443
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQG--FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYS  106 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~g--~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS  106 (261)
                      |+.+|||.+|..+ ..-..+.+.+++++  .++++++++-             +.+....+++.+++..+-+++.|||-|
T Consensus         2 IlYLHGF~SSp~S-~Ka~~l~~~~~~~~~~~~~~~P~L~~-------------~P~~ai~~l~~~I~~~~~~~~~LiGSS   67 (187)
T pfam05728         2 ILYLHGFNSSPGS-HKAQLLLQFIAQDVRFINYSTPHLPH-------------DPQQALKELEKAVAELGDDNPLLVGSS   67 (187)
T ss_pred             EEEECCCCCCCCC-HHHHHHHHHHHHHCCCCEEECCCCCC-------------CHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             6995687889877-89999999998519986797899998-------------899999999999996589974899427


Q ss_pred             CCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             44431013332102356523896288563311035699999986311110000111000000003476654135677765
Q gi|254780166|r  107 MGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLS  186 (261)
Q Consensus       107 ~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (261)
                      +||..|..+|.++.  ++ .||++|+-....    .++..    ..    ....+..           +.....-...+.
T Consensus        68 LGGfyAt~lae~~~--~~-aVLINPAv~p~~----~l~~~----lG----~~~n~~t-----------~e~~~~~~~h~~  121 (187)
T pfam05728        68 LGGYYATWLGFRCG--LR-QVLFNPAVRPYE----NLAGK----LG----EQANPYT-----------GQTYVLEEYHDI  121 (187)
T ss_pred             CHHHHHHHHHHHCC--CC-EEEECCCCCHHH----HHHHH----CC----CCCCCCC-----------CCCEEECHHHHH
T ss_conf             07999999998639--87-799758977556----18976----49----8767888-----------972687289999


Q ss_pred             HHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             410122001210035760699847888788079999967997999988887384348489999999998
Q gi|254780166|r  187 MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFY  255 (261)
Q Consensus       187 ~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~Fl  255 (261)
                      ..+..... .+.+ ..+++++.++.|++.+. ++..+..++++..+.+|++|-+ .+=++....|++|+
T Consensus       122 ~lk~l~~~-~~~~-p~~~lvLlq~gDEvLdy-r~a~~~y~~~~~~i~~GGdH~f-~~f~~~l~~I~~Fl  186 (187)
T pfam05728       122 ELKCLEVF-RLKN-PDRCLVLLQKGDEVLDY-RRAAAHYRPYYEIVWDGGDHKF-KDFSRHLQQIKAFK  186 (187)
T ss_pred             HHHHHCCC-CCCC-CCCEEEEEECCCCCCCH-HHHHHHHCCCEEEEECCCCCCC-CCHHHHHHHHHHHC
T ss_conf             99860533-3478-61389998568844489-9999995798369975998885-74999999999855


No 77 
>pfam02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family).
Probab=99.09  E-value=9.6e-10  Score=77.02  Aligned_cols=118  Identities=14%  Similarity=0.034  Sum_probs=75.0

Q ss_pred             CCCEEEEEEECC----CCCCEEEEECCCCCCCHHHHHHH--HHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             994999999648----99878999987888800122179--999999868989999647655422222222222212222
Q gi|254780166|r   12 RKYQFAFYDVGD----KDAPTILLIHGLASSVQTNWLFS--GWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA   85 (261)
Q Consensus        12 dG~~l~y~~~g~----~~~~~vv~iHG~~~~~~~~~~~~--~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~   85 (261)
                      ||.+|+--.+-+    +.-|+||....++-+........  .-...|+++||-|+..|.||.|.|++..... +  .+-.
T Consensus         1 DGv~L~advy~P~~~~~~~P~il~rtpY~r~~~~~~~~~~~~~~~~~a~~GYavV~qD~RG~g~S~G~~~~~-~--~~E~   77 (265)
T pfam02129         1 DGVRLAADIYRPAAGGGPVPVLLTRSPYGKRDPGASTLALAHPEWEFAARGYAVVVQDVRGTGGSEGVFTVG-G--PQEV   77 (265)
T ss_pred             CCCEEEEEEEEECCCCCCEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHCCEEEEEECCCCCCCCCCCCCCC-C--HHHH
T ss_conf             988899999977899998518999658789887665422235457798399089998778688999850369-8--2577


Q ss_pred             CCCC---CCCCCCCC--CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCC
Q ss_conf             2222---22222222--22222344344431013332102356523896288
Q gi|254780166|r   86 ADAV---SLLEHLGI--SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG  132 (261)
Q Consensus        86 ~di~---~~i~~l~~--~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~  132 (261)
                      +|..   +++.....  ++|.++|.|++|...+..|+..|..++.++-..+.
T Consensus        78 ~Dg~d~ieW~a~QpwsnG~VGm~G~SY~G~tq~~~A~~~pP~LkAi~p~~~~  129 (265)
T pfam02129        78 ADGKDVIDWLAGQPWCNGKVGMTGISYLGTTQLLAAATGPPGLKAIAPESAI  129 (265)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             7899999999859887892688825678888999985099850389414555


No 78 
>COG4188 Predicted dienelactone hydrolase [General function prediction only]
Probab=99.08  E-value=4.8e-11  Score=84.75  Aligned_cols=205  Identities=22%  Similarity=0.223  Sum_probs=112.8

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCC--CCCCCCCCCC----CCCCCCCCCCCCCCCCC-----
Q ss_conf             987899998788880012217999999986898999964765--5422222222----22221222222222222-----
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG--HGKSDKSYIE----NDYRLVFMAADAVSLLE-----   93 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G--~G~S~~~~~~----~~~s~~~~~~di~~~i~-----   93 (261)
                      ..|.||+-||.|++..   .+.-.++.+++.||-|..+|.+|  .|........    .+.-..+...|+..+++     
T Consensus        70 ~~PlvvlshG~Gs~~~---~f~~~A~~lAs~Gf~Va~~~hpgs~~~~~~~~~~~~~~~~p~~~~erp~dis~lLd~L~~~  146 (365)
T COG4188          70 LLPLVVLSHGSGSYVT---GFAWLAEHLASYGFVVAAPDHPGSNAGGAPAAYAGPGSYAPAEWWERPLDISALLDALLQL  146 (365)
T ss_pred             CCCEEEECCCCCCCCC---CHHHHHHHHHHCCEEEEECCCCCCCCCCCCHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHH
T ss_conf             6776983688888753---1366677786386389852689864245873124776556254541500079999999974


Q ss_pred             --------CCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCC-CCCCHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             --------222222222344344431013332102356523896288563-31103569999998631111000011100
Q gi|254780166|r   94 --------HLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL-YDSDVVDWQSLIDSFLLPSIDEVQNPLGK  164 (261)
Q Consensus        94 --------~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (261)
                              .+...++.++|||+||+-++..+....+....+--|...... ......+-.  .......    .  ++. 
T Consensus       147 ~~sP~l~~~ld~~~Vgv~GhS~GG~T~m~laGA~~~~~~~~~~C~~~~~~~~~~~~~~~~--~l~q~~a----v--~~~-  217 (365)
T COG4188         147 TASPALAGRLDPQRVGVLGHSFGGYTAMELAGAELDAEALLQHCESASRICLDPPGLNGR--LLNQCAA----V--WLP-  217 (365)
T ss_pred             HCCCCCCCCCCCCCEEEEECCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCHH--HHCCCCC----C--CCC-
T ss_conf             238421344675543787226665899985035306799999865533214688776766--6403534----3--665-


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH---HHHHHHCCCC--EEEEECCCCCC
Q ss_conf             000000347665413567776541012200121003576069984788878807---9999967997--99998888738
Q gi|254780166|r  165 KFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSS--QYLNICRRDHL  239 (261)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~---~~l~~~~p~~--~~~~i~~~gH~  239 (261)
                       ...+...++  ..+...+........+-..-+.+++.|++++.|..|.+.+..   .+....+|+.  -+.+++++.|+
T Consensus       218 -~~~~~~rDp--riravvA~~p~~~~~Fg~tgl~~v~~P~~~~a~s~D~~aP~~~~~~~~f~~l~g~~k~~~~vp~a~h~  294 (365)
T COG4188         218 -RQAYDLRDP--RIRAVVAINPALGMIFGTTGLVKVTDPVLLAAGSADGFAPPVTEQIRPFGYLPGALKYLRLVPGATHF  294 (365)
T ss_pred             -HHHHCCCCC--CCEEEEECCCCCCCCCCCCCCEEEECCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHEEECCCCCCC
T ss_conf             -132045560--01356641677545526442213213225631455555776455533200277641320324798664


Q ss_pred             CCCCC
Q ss_conf             43484
Q gi|254780166|r  240 LAVGD  244 (261)
Q Consensus       240 ~~~e~  244 (261)
                      -..|.
T Consensus       295 sfl~~  299 (365)
T COG4188         295 SFLEL  299 (365)
T ss_pred             CCCCC
T ss_conf             30346


No 79 
>PRK11071 esterase YqiA; Provisional
Probab=99.07  E-value=2.8e-09  Score=74.28  Aligned_cols=184  Identities=14%  Similarity=0.183  Sum_probs=107.7

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHC--CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78999987888800122179999999868--9899996476554222222222222122222222222222222222234
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQ--GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMG  104 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~--g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liG  104 (261)
                      ++||.+|||.+|..+. .-..+.++++++  +.+++++|++-.             ......+++++++..+-+++.|||
T Consensus         2 ~~ilYlHGF~SSp~S~-KA~~l~~~~~~~~~~~~~~~P~L~~~-------------P~~A~~~le~li~~~~~~~~~lIG   67 (190)
T PRK11071          2 STLLYLHGFNSSPRSA-KATLLKNWLAQHHPDIEMIVPQLPPY-------------PADAAELLESIVLEHGGDSLGLVG   67 (190)
T ss_pred             CEEEEECCCCCCCCCH-HHHHHHHHHHHCCCCCEEEECCCCCC-------------HHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             7589951778887588-99999999996099965991899899-------------999999999999856899769995


Q ss_pred             CCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             43444310133321023565238962885633110356999999863111100001110000000034766541356777
Q gi|254780166|r  105 YSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASC  184 (261)
Q Consensus       105 hS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (261)
                      -|+||..|..+|.++.  + +.||++|+-.  +...      ........    ....           .+..+......
T Consensus        68 SSLGGfyAt~Laeky~--~-~aVLINPAV~--P~~~------L~~~lG~~----~n~~-----------t~e~~~~t~~~  121 (190)
T PRK11071         68 SSLGGYYATWLSQCFM--L-PAVVVNPAVR--PFEL------LTDYLGQN----ENPY-----------TGQQYVLESRH  121 (190)
T ss_pred             CCHHHHHHHHHHHHHC--C-CEEEECCCCC--HHHH------HHHHCCCC----CCCC-----------CCCEEEECHHH
T ss_conf             5858999999999858--9-8799716768--4789------99972987----5888-----------79758971899


Q ss_pred             HHHHCCCCCHHHHHCCC--CCEEEEEECCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             65410122001210035--7606998478887880799999679979999888873843484899999999987
Q gi|254780166|r  185 LSMIRKPFCQDDLYRID--VPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYA  256 (261)
Q Consensus       185 ~~~~~~~~~~~~l~~i~--~P~l~i~G~~D~~~~~~~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~Fl~  256 (261)
                      +...+...    ..+++  ...+++..+.|++.+. +...+..++|+..+.+|++|-. .+=++....|.+|+.
T Consensus       122 i~~L~~l~----~~~i~~p~~~~lLlq~GDEvLdy-r~a~~~y~~~~~~i~~GGdH~f-~~fe~~l~~I~~Fl~  189 (190)
T PRK11071        122 IYDLKVMQ----IDPLESPDLIWLLQQTGDEVLDY-RQAVAYYASCRQTVEEGGNHAF-VGFERYFNQIVDFLG  189 (190)
T ss_pred             HHHHHHCC----CCCCCCCCEEEEEECCCCCCCCH-HHHHHHHCCCEEEEECCCCCCC-CHHHHHHHHHHHHHC
T ss_conf             99999624----55668863079997178850379-9999985798179867998773-149998999999967


No 80 
>KOG1515 consensus
Probab=99.04  E-value=6.4e-09  Score=72.13  Aligned_cols=221  Identities=15%  Similarity=0.080  Sum_probs=122.2

Q ss_pred             CCCEEEEECCCCCCCHH--HHHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------C
Q ss_conf             98789999878888001--22179999999868-989999647655422222222222212222222222222------2
Q gi|254780166|r   25 DAPTILLIHGLASSVQT--NWLFSGWIQLLCDQ-GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH------L   95 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~--~~~~~~~~~~l~~~-g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~------l   95 (261)
                      .-|.||++||.|-...+  +..+..+...++.+ +=-|+.+|+|     -.|+.+.+-..+|..+-+.-+.+.      .
T Consensus        89 ~~p~lvyfHGGGf~~~S~~~~~y~~~~~~~a~~~~~vvvSVdYR-----LAPEh~~Pa~y~D~~~Al~w~~~~~~~~~~~  163 (336)
T KOG1515          89 KLPVLVYFHGGGFCLGSANSPAYDSFCTRLAAELNCVVVSVDYR-----LAPEHPFPAAYDDGWAALKWVLKNSWLKLGA  163 (336)
T ss_pred             CCEEEEEEECCCCEECCCCCCHHHHHHHHHHHHCCEEEEECCCC-----CCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             76089999688027687887336789999997759299933764-----2899989854147999999999757998589


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHC------CCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCC
Q ss_conf             222222234434443101333210------23565238962885633110356999999863111100001110000000
Q gi|254780166|r   96 GISKVHVMGYSMGARIACSMVLFY------PSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKF  169 (261)
Q Consensus        96 ~~~~~~liGhS~Gg~ia~~~a~~~------p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  169 (261)
                      +.+++.|+|-|-||.+|..++.+.      +-++++.|++-|..........+.+...+..    ..........+|+.+
T Consensus       164 D~~rv~l~GDSaGGNia~~va~r~~~~~~~~~ki~g~ili~P~~~~~~~~~~e~~~~~~~~----~~~~~~~~~~~w~~~  239 (336)
T KOG1515         164 DPSRVFLAGDSAGGNIAHVVAQRAADEKLSKPKIKGQILIYPFFQGTDRTESEKQQNLNGS----PELARPKIDKWWRLL  239 (336)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHHCCC----CCHHHHHHHHHHHHH
T ss_conf             9661899835864899999999986435777655799998045378878778888762389----203178899999976


Q ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCC-EEEEEECCCCCCCCHHHHHHHC----CCCEEEEECCCCCCCCCCC
Q ss_conf             0347665413567776541012200121003576-0699847888788079999967----9979999888873843484
Q gi|254780166|r  170 ADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVP-VLIAVGSQDDLAGSPQELMSFI----PSSQYLNICRRDHLLAVGD  244 (261)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P-~l~i~G~~D~~~~~~~~l~~~~----p~~~~~~i~~~gH~~~~e~  244 (261)
                      ...........+.+....    ....+..-..+| +|++.++.|.+......+++.+    -..++...+++.|..++-.
T Consensus       240 lP~~~~~~~~p~~np~~~----~~~~d~~~~~lp~tlv~~ag~D~L~D~~~~Y~~~Lkk~Gv~v~~~~~e~~~H~~~~~~  315 (336)
T KOG1515         240 LPNGKTDLDHPFINPVGN----SLAKDLSGLGLPPTLVVVAGYDVLRDEGLAYAEKLKKAGVEVTLIHYEDGFHGFHILD  315 (336)
T ss_pred             CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEECCCEEEEEECC
T ss_conf             977778767862046556----5556732257996699995750404626999999987698179999779705899648


Q ss_pred             ---H---HHHHHHHHHHHHH
Q ss_conf             ---8---9999999998751
Q gi|254780166|r  245 ---K---QFKQGVVNFYANE  258 (261)
Q Consensus       245 ---p---~~~~~i~~Fl~~~  258 (261)
                         +   +..+.+.+|+++.
T Consensus       316 ~~~~~a~~~~~~i~~fi~~~  335 (336)
T KOG1515         316 PSSKEAHALMDAIVEFIKSN  335 (336)
T ss_pred             CCHHHHHHHHHHHHHHHHHC
T ss_conf             86046899999999998623


No 81 
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation .  The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=99.04  E-value=1.6e-10  Score=81.63  Aligned_cols=114  Identities=21%  Similarity=0.294  Sum_probs=74.9

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CC
Q ss_conf             899878999987888800122179999999868989999647655422222222222212222222222222------22
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH------LG   96 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~------l~   96 (261)
                      +++.|++|++|||.++....|...-.-..|...+++||+.|+..-  +...-...........+.+..+++.      +.
T Consensus        33 n~~~pt~iiiHG~~~~~~~~~~~~~~~a~l~~~d~NVi~VDW~~~--a~~~Y~~a~~n~~~Vg~~va~~i~~L~~~~g~~  110 (275)
T cd00707          33 NPSRPTRFIIHGWTSSGEESWISDLRKAYLSRGDYNVIVVDWGRG--ANPNYPQAVNNTRVVGAELAKFLDFLVDNTGLS  110 (275)
T ss_pred             CCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             788986999898798998747999999998638938999988200--161099999979999999999999999742988


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCC
Q ss_conf             222222344344431013332102356523896288563311
Q gi|254780166|r   97 ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS  138 (261)
Q Consensus        97 ~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~  138 (261)
                      .+++||||||+||.+|-........++.+++-.+|+...+..
T Consensus       111 ~~~ihlIGhSLGAHiaG~aG~~~~~~l~rItGLDPA~P~F~~  152 (275)
T cd00707         111 LENVHLIGHSLGAHVAGFAGKRLNGKLGRITGLDPAGPLFSG  152 (275)
T ss_pred             HHCEEEEEECHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCC
T ss_conf             210589951435778778888607742626623787653468


No 82 
>pfam09752 DUF2048 Uncharacterized conserved protein (DUF2048). The proteins in this family are conserved from plants to vertebrates. The function is unknown.
Probab=99.00  E-value=1.1e-08  Score=70.66  Aligned_cols=218  Identities=17%  Similarity=0.213  Sum_probs=125.4

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC--------------C
Q ss_conf             99878999987888800122179999999868989999647655422222222222212222222--------------2
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA--------------V   89 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di--------------~   89 (261)
                      +.+|..|.+.|.|. +. +|.=..++..|+++|...+.+..|=||. .+|......++.. |.|+              .
T Consensus        89 ~~~~vcihLagTGD-~~-f~rR~~~a~pLlk~gi~siile~pyYG~-RkP~~Q~~~~l~~-VsDl~~mg~~~i~E~~~Ll  164 (337)
T pfam09752        89 PKRPVCVHLAGTGD-HG-FWRRRRLARPLLKEGIGSIILENPFYGL-RRPKGQRRSSLRN-VSDLFLMGAATILESRALL  164 (337)
T ss_pred             CCCCEEEEECCCCC-CH-HHHHHHHHHHHHHCCCEEEEECCCCCCC-CCCCCHHCCCCCH-HHHHHHHHHHHHHHHHHHH
T ss_conf             88854998478675-11-7889887788986484068861564446-6984311252211-8799997778999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCC--CCCCCC----CHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             2222222222222344344431013332102356523896288--563311----0356999999863111100001110
Q gi|254780166|r   90 SLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG--SVLYDS----DVVDWQSLIDSFLLPSIDEVQNPLG  163 (261)
Q Consensus        90 ~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~--~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~  163 (261)
                      .+++..+.+++.+.|.||||.+|...+...|..+.-+=..+..  ...+..    ....|.....+...    .......
T Consensus       165 ~w~~~~g~g~~g~tG~SmGG~mAalaas~~p~Pia~vPclswsSAs~vfteGvLs~~i~W~~L~~q~~~----~~~~~~~  240 (337)
T pfam09752       165 HWLEREGYGPLGVTGLSMGGHMAALAASNWPKPLAVVPCLAWSSASSVFTEGVLSHSIAWDALEKQIRD----LAAQVES  240 (337)
T ss_pred             HHHHHCCCCCCEEEEECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCHHHHHCHHHC----CHHHHHH
T ss_conf             999972888613664233127777664058987312022046777304311020366677887242201----1001112


Q ss_pred             HHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCE-----EEEEECCCCCCCCH--HHHHHHCCCCEEEEECCC
Q ss_conf             00000003476654135677765410122001210035760-----69984788878807--999996799799998888
Q gi|254780166|r  164 KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPV-----LIAVGSQDDLAGSP--QELMSFIPSSQYLNICRR  236 (261)
Q Consensus       164 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~-----l~i~G~~D~~~~~~--~~l~~~~p~~~~~~i~~~  236 (261)
                      ..  .........+.+.....+..+   +....+.++.+|.     .++.+++|.++|..  ..+.+..|++++..+++ 
T Consensus       241 ~~--~~~~~~~~~~~E~~~~m~g~m---ds~Thl~nf~~P~dp~lii~V~A~~D~YVPR~~v~~Lq~iWPg~EiR~l~g-  314 (337)
T pfam09752       241 DK--LDGAKERGADKEAAREMLGLM---DSLTSLTNFPVPKDPSAAIFVAAKDDGYVPRESVATLQEIWPGSEVRWLDG-  314 (337)
T ss_pred             HH--HHHHCCCCCCHHHHHHHHHHH---HHHCCHHCCCCCCCCCEEEEEEECCCCEECCHHHCCHHHHCCCCEEEEEEC-
T ss_conf             33--331011213689999999876---310202127998888617999825871217156360988589973799706-


Q ss_pred             CCCC--CCCCHHHHHHHHHHH
Q ss_conf             7384--348489999999998
Q gi|254780166|r  237 DHLL--AVGDKQFKQGVVNFY  255 (261)
Q Consensus       237 gH~~--~~e~p~~~~~i~~Fl  255 (261)
                      ||..  ..++..|.++|.+=|
T Consensus       315 GHVsA~l~~q~~fR~aI~dAf  335 (337)
T pfam09752       315 GHVSAYLLHQDAFRRAIKDAL  335 (337)
T ss_pred             CCEEEEEECHHHHHHHHHHHH
T ss_conf             877888741578999999985


No 83 
>pfam03959 FSH1 Serine hydrolase (FSH1). This is a family of serine hydrolases.
Probab=98.98  E-value=7.4e-09  Score=71.74  Aligned_cols=166  Identities=16%  Similarity=0.123  Sum_probs=89.7

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHH---HCCCEEEEECCC-----CCCCCC-------CCCCCCCCCC--------
Q ss_conf             98789999878888001221799999998---689899996476-----554222-------2222222221--------
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLC---DQGFRVIAFDNL-----GHGKSD-------KSYIENDYRL--------   81 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~---~~g~~vi~~D~~-----G~G~S~-------~~~~~~~~s~--------   81 (261)
                      .+.-|+|+||+++|+..   ++.+...|.   .+++.++.+|=|     +-|.+.       .......|+.        
T Consensus         3 ~k~riLcLHG~g~n~~i---f~~q~~~l~~~L~~~~ef~f~daP~~~~~~~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~   79 (210)
T pfam03959         3 KKLKILCLHGFGQSGEI---FRAKTGALRKLLKKGVELVYLDAPFPLAPPADLPFEEPDAEEGEDDEPYRGWFRGDDETN   79 (210)
T ss_pred             CCCEEEEECCCCCCHHH---HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             77669987999979999---999999999986047469970786346888887654454444567997605265788764


Q ss_pred             --CCCCCCCCCCCCCCCC-CC-CCCCCCCCCCCCHHHHHHHCC--C------CCCCEEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             --2222222222222222-22-222344344431013332102--3------5652389628856331103569999998
Q gi|254780166|r   82 --VFMAADAVSLLEHLGI-SK-VHVMGYSMGARIACSMVLFYP--S------YVRSVILGGVGSVLYDSDVVDWQSLIDS  149 (261)
Q Consensus        82 --~~~~~di~~~i~~l~~-~~-~~liGhS~Gg~ia~~~a~~~p--~------~v~~lvl~~~~~~~~~~~~~~~~~~~~~  149 (261)
                        +.+-+.+..+.+.+.- .+ ..++|+|.||.+|..++....  .      .++-.|+++.......            
T Consensus        80 ~~~~~~~sl~~l~~~i~~~gPfdGIlGFSQGa~la~~l~~~~~~~~~~~~~p~~kfaI~~sG~~~~~~------------  147 (210)
T pfam03959        80 EYRGLDESLDYVRDYIKENGPFDGILGFSQGAALAAILASLLEEGLPLTDHPPLKFAILISGFRPREP------------  147 (210)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCH------------
T ss_conf             32799999999999998549924897514668999999999985156567998029999626888973------------


Q ss_pred             HHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCC
Q ss_conf             63111100001110000000034766541356777654101220012100357606998478887880--7999996799
Q gi|254780166|r  150 FLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPS  227 (261)
Q Consensus       150 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~  227 (261)
                                     .+...                         ..-.+|++|||.+.|++|.+++.  .+++++...+
T Consensus       148 ---------------~~~~~-------------------------~~~~~i~iPtlHi~G~~D~~v~~~~s~~L~~~~~~  187 (210)
T pfam03959       148 ---------------KYAEF-------------------------YTEPPIQTPSLHVIGELDTVVPEERSRKLAEACKN  187 (210)
T ss_pred             ---------------HHHHC-------------------------CCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             ---------------33001-------------------------24677787548998189877776999999997289


Q ss_pred             CEEEEECCCCCCCCCCCH
Q ss_conf             799998888738434848
Q gi|254780166|r  228 SQYLNICRRDHLLAVGDK  245 (261)
Q Consensus       228 ~~~~~i~~~gH~~~~e~p  245 (261)
                      ...++..++||.+....+
T Consensus       188 ~~~v~~H~gGH~vP~~~~  205 (210)
T pfam03959       188 SATVLEHPGGHFVPNKKP  205 (210)
T ss_pred             CCEEEECCCCCCCCCCHH
T ss_conf             968997399884979736


No 84 
>COG2936 Predicted acyl esterases [General function prediction only]
Probab=98.95  E-value=8.5e-09  Score=71.38  Aligned_cols=227  Identities=16%  Similarity=0.130  Sum_probs=119.5

Q ss_pred             EEEEEECCCCEEEE---EEECCCCCCEEEEECCCCCCCHH--HHHHHHHHH---HHHHCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             07999349949999---99648998789999878888001--221799999---99868989999647655422222222
Q gi|254780166|r    5 VKFFRSWRKYQFAF---YDVGDKDAPTILLIHGLASSVQT--NWLFSGWIQ---LLCDQGFRVIAFDNLGHGKSDKSYIE   76 (261)
Q Consensus         5 ~~~~~~~dG~~l~y---~~~g~~~~~~vv~iHG~~~~~~~--~~~~~~~~~---~l~~~g~~vi~~D~~G~G~S~~~~~~   76 (261)
                      -......||.+|+-   .-.+.+..|+++..+-.+-....  ...-....+   .++.+||-|+..|.||.|.|++....
T Consensus        21 ~v~V~MRDGvrL~~dIy~Pa~~g~~Pvll~~~~~Py~k~~~~~~~~~~~~p~~~~~aa~GYavV~qDvRG~~~SeG~~~~  100 (563)
T COG2936          21 DVMVPMRDGVRLAADIYRPAGAGPLPVLLSRTRLPYRKRNGTFGPQLSALPQPAWFAAQGYAVVNQDVRGRGGSEGVFDP  100 (563)
T ss_pred             EEEEEECCCEEEEEEEECCCCCCCCCEEEEEECCCCCCCCCCCCCHHHCCCCCCEEECCCEEEEEECCCCCCCCCCCCCE
T ss_conf             25678058708999887137788886668841266334466676211226555546327649998526556567762212


Q ss_pred             CCCCCCCCCCC---CCCCCCCCCC--CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCC-----C---HHHH
Q ss_conf             22221222222---2222222222--22222344344431013332102356523896288563311-----0---3569
Q gi|254780166|r   77 NDYRLVFMAAD---AVSLLEHLGI--SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS-----D---VVDW  143 (261)
Q Consensus        77 ~~~s~~~~~~d---i~~~i~~l~~--~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~-----~---~~~~  143 (261)
                      . ++  +-++|   +.+++..+..  ++|..+|.|++|...+.+|+..|--++.++-+.........     .   ...+
T Consensus       101 ~-~~--~E~~Dg~D~I~Wia~QpWsNG~Vgm~G~SY~g~tq~~~Aa~~pPaLkai~p~~~~~D~y~d~~~~~G~~~~~~~  177 (563)
T COG2936         101 E-SS--REAEDGYDTIEWLAKQPWSNGNVGMLGLSYLGFTQLAAAALQPPALKAIAPTEGLVDRYRDDAFYGGGAELNFN  177 (563)
T ss_pred             E-CC--CCCCCHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCCCHHEEECCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             0-14--32433237999998687447801311056789999999831993023662345554410000125762434456


Q ss_pred             HHHHHHHHCC-CCCHHHH-------H---HHHHHCCCCCCCCCCCHHHHHHH------HHHHCCCCCHHHHHCCCCCEEE
Q ss_conf             9999986311-1100001-------1---10000000034766541356777------6541012200121003576069
Q gi|254780166|r  144 QSLIDSFLLP-SIDEVQN-------P---LGKKFRKFADLDPGNDLKALASC------LSMIRKPFCQDDLYRIDVPVLI  206 (261)
Q Consensus       144 ~~~~~~~~~~-~~~~~~~-------~---~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~l~~i~~P~l~  206 (261)
                      .........+ .......       +   .+..++..........+......      -..+++.+...++.+|++|+|.
T Consensus       178 ~~W~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~~~~~~hp~~ddfW~~~~~~~d~~~i~vP~L~  257 (563)
T COG2936         178 LGWALTMLAPQPLTRIRPARLDRLAPLRVGAERWRDAPTELLEGEPYFLELWLEHPLRDDFWRRGDRVADLSKIKVPALV  257 (563)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCHHCCCCCCCHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEE
T ss_conf             77776532667643334210023205553201134566300012763312443287744033206724432137886799


Q ss_pred             EEECCCCCCCCHHHHHHHCCC--CEEEEEC
Q ss_conf             984788878807999996799--7999988
Q gi|254780166|r  207 AVGSQDDLAGSPQELMSFIPS--SQYLNIC  234 (261)
Q Consensus       207 i~G~~D~~~~~~~~l~~~~p~--~~~~~i~  234 (261)
                      +.|-.|......-++.+.+..  ..+++-|
T Consensus       258 i~gW~D~~l~~~~~~~~~~~~r~~~lvvgP  287 (563)
T COG2936         258 IGGWSDGYLHTAIKLFAFLRSRPVKLVVGP  287 (563)
T ss_pred             ECCCCCCCCCCHHHHHHHCCCCCCEEEECC
T ss_conf             753035653236888642246775068746


No 85 
>PRK13604 luxD acyl transferase; Provisional
Probab=98.93  E-value=1.9e-08  Score=69.34  Aligned_cols=217  Identities=21%  Similarity=0.299  Sum_probs=126.5

Q ss_pred             EEECCCCEEEEEEECCCC-----CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCCCCCCCCC
Q ss_conf             993499499999964899-----878999987888800122179999999868989999647655-42222222222221
Q gi|254780166|r    8 FRSWRKYQFAFYDVGDKD-----APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH-GKSDKSYIENDYRL   81 (261)
Q Consensus         8 ~~~~dG~~l~y~~~g~~~-----~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~-G~S~~~~~~~~~s~   81 (261)
                      ....+|.+|+.++.-+++     .-+|+...||.--.+   -|..++++|+..||+||.||-.-| |.|.+.-+....|+
T Consensus        12 i~l~~~~~I~VWet~Pk~~~~~rnnTiliAsGFarRMd---hfAglAeYLs~NGFhViRYDsLhHvGlSSG~i~eFtMsi   88 (305)
T PRK13604         12 ICLENGQSIRVWETLPKENSPKKNNTILIASGFARRMD---HFAGLAEYLSSNGFHVIRYDSLHHVGLSSGTIDEFTMSI   88 (305)
T ss_pred             EEECCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHH---HHHHHHHHHHHCCEEEEEECCCCCCCCCCCCHHHEEEEC
T ss_conf             88369978999844886677655772998026788778---889999998508738998456544687876562503301


Q ss_pred             CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             222-2222222222222222223443444310133321023565238962885633110356999999863111100001
Q gi|254780166|r   82 VFM-AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQN  160 (261)
Q Consensus        82 ~~~-~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (261)
                      ... ...+.+++..-+++++-+++-|+.+.+|.+.+..-.  ++-||- +.+-.-.       +...++-..  .+.+..
T Consensus        89 Gk~Sll~VidWLk~rgi~~iGlIAaSLSARIAY~v~~eid--lsfLiT-AVGVvnL-------R~TLEkal~--yDyl~l  156 (305)
T PRK13604         89 GKNSLLTVVDWLKTRGIQNIGLIAASLSARIAYEVINEID--LSFLIT-AVGVVNL-------RDTLEKALK--YDYLQL  156 (305)
T ss_pred             CHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCC--HHEEEE-EEEEEEH-------HHHHHHHHC--CCHHCC
T ss_conf             3456999999998659742344677678899999874212--320455-4355537-------999999848--753108


Q ss_pred             HHHHHHC--CCCCCCCCCCHHHHHH-HH-HHHCCCCC-HHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHC--CCCEEE
Q ss_conf             1100000--0003476654135677-76-54101220-0121003576069984788878807--9999967--997999
Q gi|254780166|r  161 PLGKKFR--KFADLDPGNDLKALAS-CL-SMIRKPFC-QDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFI--PSSQYL  231 (261)
Q Consensus       161 ~~~~~~~--~~~~~~~~~~~~~~~~-~~-~~~~~~~~-~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~--p~~~~~  231 (261)
                      +...-..  .|..-..  ..+.+++ |. ..|...+. ...++++++|...+.+..|..+...  .++...+  +.+++.
T Consensus       157 pi~~lPedldFEghnl--gs~vFvtDcf~~~Wdtl~sT~~~~~~l~iPfIAFtAn~DdWV~q~EV~~~l~~i~s~~~kly  234 (305)
T PRK13604        157 PINELPEDLDFEGHNL--GSEVFVTDCFKHGWDTLDSTINKVKGLDIPFIAFTANDDSWVKQSEVIDLLDSIRSEKCKLY  234 (305)
T ss_pred             CHHHCCCCCCCCCCCC--CCEEEEEHHHHCCCCCHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             9446965245456545--64067601766489706769998507898679998469634408999999971788751588


Q ss_pred             EECCCCCCCC
Q ss_conf             9888873843
Q gi|254780166|r  232 NICRRDHLLA  241 (261)
Q Consensus       232 ~i~~~gH~~~  241 (261)
                      -+-|++|-.-
T Consensus       235 sLiGSsHdLg  244 (305)
T PRK13604        235 SLIGSSHDLG  244 (305)
T ss_pred             EEECCCCCCC
T ss_conf             8624644321


No 86 
>pfam02273 Acyl_transf_2 Acyl transferase. This bacterial family of Acyl transferases (or myristoyl-acp-specific thioesterases) catalyse the first step in the bioluminescent fatty acid reductase system.
Probab=98.93  E-value=1.9e-08  Score=69.34  Aligned_cols=218  Identities=21%  Similarity=0.312  Sum_probs=127.3

Q ss_pred             EEEECCCCEEEEEEECCCC-----CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCCCCCCCC
Q ss_conf             9993499499999964899-----878999987888800122179999999868989999647655-4222222222222
Q gi|254780166|r    7 FFRSWRKYQFAFYDVGDKD-----APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH-GKSDKSYIENDYR   80 (261)
Q Consensus         7 ~~~~~dG~~l~y~~~g~~~-----~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~-G~S~~~~~~~~~s   80 (261)
                      .....+|.+|+.++.-+++     .-+|+...||.--.+   -|..++++|+..||+||.||-.-| |.|.+.-+....|
T Consensus         6 vi~l~~~r~I~VWet~Pk~~~~~rnnTiliAsGFarRMd---hfAglAeYLs~NGFhViRYDsLhHvGlSSG~i~eFtMs   82 (294)
T pfam02273         6 VIRVNNNREIHVWETPPKENVPKRNNTIVIASGFARRMD---HFAGLAEYLSTNGFHVIRYDSLHHVGLSSGEIDEFTMS   82 (294)
T ss_pred             EEEECCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHH---HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCHHHEEEE
T ss_conf             799369978999735886677654772998036888778---88999999850873899845654468786655251330


Q ss_pred             CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             1222-222222222222222222344344431013332102356523896288563311035699999986311110000
Q gi|254780166|r   81 LVFM-AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQ  159 (261)
Q Consensus        81 ~~~~-~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (261)
                      +... ...+.+++..-+++++-+++-|+.+.+|.+.+..-  .++-||- +.+-.-.       +...++-..  .+.+.
T Consensus        83 iGk~Sll~VidWLk~rgi~~lGlIAaSLSARIAY~v~~ei--~lsfLiT-AVGVvnL-------R~TLEkal~--~Dyl~  150 (294)
T pfam02273        83 VGKNSLLTVIDWLKTRGINNIGLIASSLSARIAYEVISEI--NLSFLIT-AVGVVNL-------RDTLEKALG--FDYLS  150 (294)
T ss_pred             CCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHC--CHHEEEE-EEEEEEH-------HHHHHHHHC--CCHHC
T ss_conf             1344699999999865973334457767789999987421--3211666-5455537-------999999848--75211


Q ss_pred             HHHHHHHC--CCCCCCCCCCHHHHHH-HH-HHHCCCC-CHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHC--CCCEE
Q ss_conf             11100000--0003476654135677-76-5410122-00121003576069984788878807--9999967--99799
Q gi|254780166|r  160 NPLGKKFR--KFADLDPGNDLKALAS-CL-SMIRKPF-CQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFI--PSSQY  230 (261)
Q Consensus       160 ~~~~~~~~--~~~~~~~~~~~~~~~~-~~-~~~~~~~-~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~--p~~~~  230 (261)
                      .+...-..  .|..-..  ..+.+++ |. ..|...+ ....++++++|...+.+.+|..+...  +++...+  +.+++
T Consensus       151 lpi~~lPedldFEgh~l--gs~vFvtDcf~~~Wdtl~sT~~~~~~l~iPfIAFtAn~DdWV~q~EV~~~l~~i~s~~~kl  228 (294)
T pfam02273       151 LPIDELPEDLDFEGHKL--GSEVFVRDCFENNWDTLDSTINKVANLDIPFIAFTANNDDWVKQHEVYDLLSNIRSDKCKI  228 (294)
T ss_pred             CCHHHCCCCCCCCCCCC--CCEEEEEHHHHCCCCCHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCCEE
T ss_conf             89446965245456545--6406760176648970675898850689857999846963440899999997179875158


Q ss_pred             EEECCCCCCCC
Q ss_conf             99888873843
Q gi|254780166|r  231 LNICRRDHLLA  241 (261)
Q Consensus       231 ~~i~~~gH~~~  241 (261)
                      .-+-|++|-+-
T Consensus       229 ysL~GSsHdLg  239 (294)
T pfam02273       229 YSLLGSSHDLG  239 (294)
T ss_pred             EEEECCCCCCC
T ss_conf             88624644321


No 87 
>pfam10230 DUF2305 Uncharacterized conserved protein (DUF2305). This family of proteins is conserved from plants to humans. The function is unknown.
Probab=98.91  E-value=1.7e-08  Score=69.57  Aligned_cols=100  Identities=25%  Similarity=0.362  Sum_probs=73.9

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHH---CCCEEEEECCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC----C
Q ss_conf             87899998788880012217999999986---8989999647655422222-22222221222222222222222----2
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSDKS-YIENDYRLVFMAADAVSLLEHLG----I   97 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~---~g~~vi~~D~~G~G~S~~~-~~~~~~s~~~~~~di~~~i~~l~----~   97 (261)
                      ++-|+||.|.+|-..   .|..++..|.+   ..|.|+++.+.||-.++.. .....|+++++++...+++++.-    -
T Consensus         2 ~~li~~IPGNPGlv~---fY~~Fl~~L~~~l~~~~~V~~ishaGh~~~~~~~~~~~~~~L~~QI~hk~~fi~~~~~~~~~   78 (260)
T pfam10230         2 RPLILLIPGNPGLVG---FYRTFLSLLHEKLNPSFDVLGISHAGHTLSPGNNKNERVFSLQDQIEHKIDFLRAFLPKKTD   78 (260)
T ss_pred             CEEEEEECCCCCHHH---HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             679999899997599---99999999998619986599977887768865666688647799999999999998545689


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCC--CCCCEEE
Q ss_conf             222223443444310133321023--5652389
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFYPS--YVRSVIL  128 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~p~--~v~~lvl  128 (261)
                      .+++|+|||.|++++++...+.+.  +|.+.++
T Consensus        79 ~k~iLiGHSIGayi~leil~r~~~~~~I~~~~l  111 (260)
T pfam10230        79 VKLILIGHSIGAYIALEVLKRLSLKFRIKKCVL  111 (260)
T ss_pred             CCEEEEECCHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             857998334689999999985455765678987


No 88 
>PRK12467 peptide synthase; Provisional
Probab=98.90  E-value=1e-08  Score=70.89  Aligned_cols=121  Identities=17%  Similarity=0.086  Sum_probs=87.8

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             489987899998788880012217999999986898999964765542222222222221222222222222222-2222
Q gi|254780166|r   22 GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG-ISKV  100 (261)
Q Consensus        22 g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~-~~~~  100 (261)
                      +.++.||++|+|+.+|+.   |+|.+++.+|. .++.|+.+..+|.....    ...-++++++.+..+.|...+ -+++
T Consensus      3689 ~~~~~pplfcvhp~~G~~---~~Y~~La~~L~-~~~pvyglq~~~l~~~~----~~~~s~~~~a~~Y~~~ir~~qp~GPy 3760 (3951)
T PRK12467       3689 RVTGLPALFCPHAGFGTV---FDYEPLARQLE-GHRSVLGIQCRMLLDTN----WQDTSLQAMAFDYINDIRQVQAKGPY 3760 (3951)
T ss_pred             CCCCCCCEEEECCCCCCE---EEHHHHHHHCC-CCCCEEEECCCCCCCCC----CCCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             899998589868887765---56888883458-99867986078888988----89877999999999999987899897


Q ss_pred             CCCCCCCCCCCHHHHHHH---CCCCCCCEEEECCCCCCCCC--CHHHHHHHHHHH
Q ss_conf             223443444310133321---02356523896288563311--035699999986
Q gi|254780166|r  101 HVMGYSMGARIACSMVLF---YPSYVRSVILGGVGSVLYDS--DVVDWQSLIDSF  150 (261)
Q Consensus       101 ~liGhS~Gg~ia~~~a~~---~p~~v~~lvl~~~~~~~~~~--~~~~~~~~~~~~  150 (261)
                      +|+|||+||.||.++|.+   ..+.|..|+|+++.......  ...+|..-...+
T Consensus      3761 ~L~GwS~GG~vA~e~A~~L~~~G~~V~~l~llDs~~p~~~~~~~~~~~~~~~~~~ 3815 (3951)
T PRK12467       3761 HLLGWSLGGTLATLVAAELERQGQSVAFLGLVDSYVPGPDATVAPNDQREDLLGF 3815 (3951)
T ss_pred             EEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             9886777079999999999977995768999817999988776845689999999


No 89 
>TIGR03230 lipo_lipase lipoprotein lipase. Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
Probab=98.89  E-value=1.8e-09  Score=75.46  Aligned_cols=113  Identities=19%  Similarity=0.278  Sum_probs=69.9

Q ss_pred             CCCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----
Q ss_conf             899878999987888800-122179999999868-9899996476554222222222222122222222222222-----
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQ-TNWLFSGWIQLLCDQ-GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL-----   95 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~-~~~~~~~~~~~l~~~-g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l-----   95 (261)
                      +++.|+.+.||||..+.. ..|...-.-..+..+ +++||+.|+.+ |... .-....-.......++..+++.|     
T Consensus        38 n~s~pT~~IIHG~~~~g~~~~Wv~~m~~all~~~~d~NVI~VDW~~-ga~~-~Y~~A~~ntr~VG~~iA~~i~~L~~~~g  115 (442)
T TIGR03230        38 NHETKTFIVIHGWTVTGMFESWVPKLVAALYEREPSANVIVVDWLS-RAQQ-HYPTSAAYTKLVGKDVAKFVNWMQEEFN  115 (442)
T ss_pred             CCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECHH-HCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9889809998888888987568999999999627981899980704-2272-3599999899999999999999998519


Q ss_pred             -CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC
Q ss_conf             -222222234434443101333210235652389628856331
Q gi|254780166|r   96 -GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD  137 (261)
Q Consensus        96 -~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~  137 (261)
                       ..+++||||||+||.+|-.+....+.++.+++-.+|+...+.
T Consensus       116 ~~~~~vHlIGhSLGAHvAG~aG~~~~~~lgRITGLDPA~P~F~  158 (442)
T TIGR03230       116 YPWDNVHLLGYSLGAHVAGIAGSLTKHKVNRITGLDPAGPTFE  158 (442)
T ss_pred             CCHHHEEEEEECCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC
T ss_conf             9811348985224201222345640687560884168752136


No 90 
>pfam08840 BAAT_C BAAT / Acyl-CoA thioester hydrolase C terminal. This catalytic domain is found at the C terminal of acyl-CoA thioester hydrolases and bile acid-CoA:amino acid N-acetyltransferases (BAAT).
Probab=98.85  E-value=1.3e-08  Score=70.29  Aligned_cols=150  Identities=21%  Similarity=0.237  Sum_probs=84.7

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             22222223443444310133321023565238962885633110356999999863111100001110000000034766
Q gi|254780166|r   96 GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG  175 (261)
Q Consensus        96 ~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  175 (261)
                      +-+++.++|.|.||-+++.+|+.+|+ |+.+|.+++.......... ++    ....+       .+............+
T Consensus        20 ~~~~IGl~G~SkGaelaL~~As~~~~-I~avV~i~gs~~~~~~~~~-yk----~~~lp-------~~~~~~~~~~~~~~~   86 (211)
T pfam08840        20 KGDKIGLLGISKGGELALSMASFLKQ-ISAVVSINGSAVVYGGPLL-YK----DNPLP-------PLGFGMEKIKVNKNG   86 (211)
T ss_pred             CCCCEEEEEECHHHHHHHHHHHHCCC-CCEEEEECCCCCEECCCCC-CC----CCCCC-------CCCCCCCEEEECCCC
T ss_conf             89988999978899999999860777-7789997896014467320-18----95278-------866561202542787


Q ss_pred             CCHHHHHHHHHHH---CCCCCHHHHHCCCCCEEEEEECCCCCCCCH---HHHHH----HC-C-CCEEEEECCCCCCC--C
Q ss_conf             5413567776541---012200121003576069984788878807---99999----67-9-97999988887384--3
Q gi|254780166|r  176 NDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMS----FI-P-SSQYLNICRRDHLL--A  241 (261)
Q Consensus       176 ~~~~~~~~~~~~~---~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~---~~l~~----~~-p-~~~~~~i~~~gH~~--~  241 (261)
                      .  ..........   ......-.+.+|++|+|++.|++|...++.   +.+.+    .- + +.++..++++||++  .
T Consensus        87 ~--~~~~~~~~~~~~~~~~~a~IpvEki~~piLli~G~dD~~wpS~~~a~~i~~rL~~~g~~~~~~~l~Yp~aGH~i~pP  164 (211)
T pfam08840        87 L--LDIRDMFNLPLSKPALKALIPVERAKGPFLFVVGEDDHNWPSVEYAEIACERLKKHGKKVEVQVLTYPGAGHLIEPP  164 (211)
T ss_pred             C--EEEHHHHCCCCCCCCCCCCCCHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCEECCC
T ss_conf             4--54012331655454412405475568878999756767775599999999999981999862899818999858889


Q ss_pred             CC---------------------------CHHHHHHHHHHHHHHCC
Q ss_conf             48---------------------------48999999999875168
Q gi|254780166|r  242 VG---------------------------DKQFKQGVVNFYANELR  260 (261)
Q Consensus       242 ~e---------------------------~p~~~~~i~~Fl~~~~~  260 (261)
                      +.                           +.+..+.+++||++.|-
T Consensus       165 Y~P~~~~~~~~~~~~~~~~GG~~~~ha~Aq~~sW~~i~~Ff~~hL~  210 (211)
T pfam08840       165 YFPHCRASYHALVGMPVLWGGEPKAHAKAQEDSWKKIQAFFKKHLG  210 (211)
T ss_pred             CCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9987223135556762553884078799999999999999998728


No 91 
>pfam10503 Esterase_phd Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
Probab=98.84  E-value=2.1e-08  Score=69.08  Aligned_cols=110  Identities=19%  Similarity=0.160  Sum_probs=68.8

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCC----CC
Q ss_conf             878999987888800122179999999868989999647655422222222222212------22222222222----22
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV------FMAADAVSLLE----HL   95 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~------~~~~di~~~i~----~l   95 (261)
                      -|.||++||.++++........+-..-.++||-|+.++........+-  -..+...      .-+..|..+++    +.
T Consensus        21 ~PLVV~LHGc~q~a~~~~~~t~~~~lAd~~GFiVvyPeq~~~~n~~~c--Wnw~~~~~~~~g~gd~~~I~~mi~~v~~~y   98 (226)
T pfam10503        21 MPLVVMLHGCQQHADDFAAGTRMNALADEHGFAVLYPEQSLRAHAHGC--WHWFEPDHDQAGRGEAATIAALADAIADAH   98 (226)
T ss_pred             CCEEEEEECCCCCHHHHHHHCCHHHHHHHCCCEEEECCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             587999528999999998555728999877928993677466789988--887886455689976999999999999972


Q ss_pred             CC--CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC
Q ss_conf             22--2222234434443101333210235652389628856331
Q gi|254780166|r   96 GI--SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD  137 (261)
Q Consensus        96 ~~--~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~  137 (261)
                      ++  ++|.+.|+|.||..+..++..|||+++++-.++..+.--.
T Consensus        99 ~iD~~RVyvtGlSaGg~Ma~~La~~~PD~FAAva~~sGlp~g~a  142 (226)
T pfam10503        99 GFDAARVYVAGLSAGAALADLLAHCHPDRFAAVALHSGLALGCA  142 (226)
T ss_pred             CCCCCCEEEEEECCHHHHHHHHHHHCCCHHEEEEEECCCCCCCC
T ss_conf             99803178987584899999998758612136600036675544


No 92 
>KOG2100 consensus
Probab=98.82  E-value=3.9e-08  Score=67.44  Aligned_cols=214  Identities=15%  Similarity=0.166  Sum_probs=123.0

Q ss_pred             CCCCEEEEEEECCC-----CC-CEEEEECCCCCCCHH----HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC---CCCC
Q ss_conf             49949999996489-----98-789999878888001----22179999999868989999647655422222---2222
Q gi|254780166|r   11 WRKYQFAFYDVGDK-----DA-PTILLIHGLASSVQT----NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS---YIEN   77 (261)
Q Consensus        11 ~dG~~l~y~~~g~~-----~~-~~vv~iHG~~~~~~~----~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~---~~~~   77 (261)
                      .||...++...-++     .+ |.+|.+||.++|...    ...|...  .....|+-|+.+|.||-|.....   ....
T Consensus       505 ~~g~~~~~~~~lP~~~~~~~kyPllv~~yGGP~sq~v~~~~~~~~~~~--~~s~~g~~v~~vd~RGs~~~G~~~~~~~~~  582 (755)
T KOG2100         505 IDGITANAILILPPNFDPSKKYPLLVVVYGGPGSQSVTSKFSVDWNEV--VVSSRGFAVLQVDGRGSGGYGWDFRSALPR  582 (755)
T ss_pred             ECCEEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCEEEECCHHE--EEECCCEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             345238999946899888787778998268987531232576332315--873466699998477767751457888787


Q ss_pred             CC---CCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCE-EEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             22---212222222222222--22222222344344431013332102356523-8962885633110356999999863
Q gi|254780166|r   78 DY---RLVFMAADAVSLLEH--LGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDSDVVDWQSLIDSFL  151 (261)
Q Consensus        78 ~~---s~~~~~~di~~~i~~--l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~l-vl~~~~~~~~~~~~~~~~~~~~~~~  151 (261)
                      ..   ..+|+..-+..+++.  .+.+++.+.|+|+||++++..+..+|+.+.+. +..++...+........++.   +.
T Consensus       583 ~lG~~ev~D~~~~~~~~~~~~~iD~~ri~i~GwSyGGy~t~~~l~~~~~~~fkcgvavaPVtd~~~yds~~tery---mg  659 (755)
T KOG2100         583 NLGDVEVKDQIEAVKKVLKLPFIDRSRVAIWGWSYGGYLTLKLLESDPGDVFKCGVAVAPVTDWLYYDSTYTERY---MG  659 (755)
T ss_pred             HCCCCCHHHHHHHHHHHHHCCCCCHHHEEEEEECHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEEECCCCCEEC---CC
T ss_conf             558821154899999998546535588389821608899999874084444676246414142474043020101---68


Q ss_pred             CCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCE-EEEEECCCCCCCCH--HHHHHH----
Q ss_conf             11110000111000000003476654135677765410122001210035760-69984788878807--999996----
Q gi|254780166|r  152 LPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPV-LIAVGSQDDLAGSP--QELMSF----  224 (261)
Q Consensus       152 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~-l~i~G~~D~~~~~~--~~l~~~----  224 (261)
                      .                     +..+...       .........+..++.|. |+++|+.|.-++..  .++.+.    
T Consensus       660 ~---------------------p~~~~~~-------y~e~~~~~~~~~~~~~~~LliHGt~DdnVh~q~s~~~~~aL~~~  711 (755)
T KOG2100         660 L---------------------PSENDKG-------YEESSVSSPANNIKTPKLLLIHGTEDDNVHFQQSAILIKALQNA  711 (755)
T ss_pred             C---------------------CCCCCCC-------HHHCCCCCHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9---------------------8622321-------21124100123114664799974667665846699999999976


Q ss_pred             -CCCCEEEEECCCCCCCCCCC--HHHHHHHHHHHHHH
Q ss_conf             -79979999888873843484--89999999998751
Q gi|254780166|r  225 -IPSSQYLNICRRDHLLAVGD--KQFKQGVVNFYANE  258 (261)
Q Consensus       225 -~p~~~~~~i~~~gH~~~~e~--p~~~~~i~~Fl~~~  258 (261)
                       ++ .++.++|+.+|-+..-.  +.+...+..||..-
T Consensus       712 gv~-~~~~vypde~H~is~~~~~~~~~~~~~~~~~~~  747 (755)
T KOG2100         712 GVP-FRLLVYPDENHGISYVEVISHLYEKLDRFLRDC  747 (755)
T ss_pred             CCC-EEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             994-489973898766434540589999999999986


No 93 
>pfam00151 Lipase Lipase.
Probab=98.79  E-value=2.3e-09  Score=74.72  Aligned_cols=114  Identities=22%  Similarity=0.282  Sum_probs=68.3

Q ss_pred             CCCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------C
Q ss_conf             8998789999878888001-22179999999868989999647655422222222222212222222222222------2
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQT-NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH------L   95 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~~-~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~------l   95 (261)
                      ++++|+.+++|||.++... .|...-.-..|...+++||++|+.+ | +...-...........+.+..+++.      +
T Consensus        68 n~~~pt~~iiHG~~~~~~~~~w~~~~~~a~l~~~d~NVI~VDW~~-~-a~~~Y~~A~~nt~~VG~~va~~i~~L~~~~g~  145 (329)
T pfam00151        68 NTSKKTRAIIHGFTDKGQEESWLSDMCKNLFQVEGVNVIVVDWGS-G-STTFYRQATLNVRVVGAEVAKLLVELEEELNV  145 (329)
T ss_pred             CCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECHH-H-HCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             878853899823457888514799999999744895799997857-8-58348999997999999999999999986399


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHCCC--CCCCEEEECCCCCCCCC
Q ss_conf             22222223443444310133321023--56523896288563311
Q gi|254780166|r   96 GISKVHVMGYSMGARIACSMVLFYPS--YVRSVILGGVGSVLYDS  138 (261)
Q Consensus        96 ~~~~~~liGhS~Gg~ia~~~a~~~p~--~v~~lvl~~~~~~~~~~  138 (261)
                      ..+++||||||+||.+|-.+......  ++.+++--+|+...+..
T Consensus       146 ~~~~vhlIGhSLGAHiaG~aG~~~~~~~~lgRItGLDPA~P~F~~  190 (329)
T pfam00151       146 SPENVHLIGHSLGAHVAGEAGRRTKGKHKLGRITGLDPAGPYFKG  190 (329)
T ss_pred             CHHHEEEEECCHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCC
T ss_conf             867858873146777767888753676521202046876421357


No 94 
>pfam01674 Lipase_2 Lipase (class 2). This family consists of hypothetical C. elegans proteins and lipases. Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids. One member, a triacylglycerol lipase, is a extracellular lipase from B. subtilis 168.
Probab=98.75  E-value=6.1e-09  Score=72.22  Aligned_cols=86  Identities=17%  Similarity=0.203  Sum_probs=58.7

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCE---EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCC
Q ss_conf             878999987888800122179999999868989---999647655422222222222212222222222222----2222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFR---VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEH----LGIS   98 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~---vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~----l~~~   98 (261)
                      ..||||+||...++..  .|....++|.++||+   |++.++=.... . +...........+.++.++++.    -+. 
T Consensus         1 ~~PVVlVHG~~~~a~~--~w~~~~~~l~~~GY~~~evya~tyG~~~~-~-~~~~~~~~~~~~~~qir~fI~~Vl~yTGa-   75 (218)
T pfam01674         1 NTPVIFVHGNSGLAAG--GWSKLRQYFKERGYTLAELYATTWGDGNL-L-TSLQRAEMKCEYVKQIRRFIEAVLGYTGA-   75 (218)
T ss_pred             CCCEEEECCCCCCHHH--HHHHHHHHHHHCCCCCHHEEECCCCCCCC-C-CCCCCCCCCCHHHHHHHHHHHHHHHHCCC-
T ss_conf             9899998589951334--49999999998699830046613468877-7-65212342015899999999999974378-


Q ss_pred             CCCCCCCCCCCCCHHHHH
Q ss_conf             222234434443101333
Q gi|254780166|r   99 KVHVMGYSMGARIACSMV  116 (261)
Q Consensus        99 ~~~liGhS~Gg~ia~~~a  116 (261)
                      ||.|||||||+.++..+.
T Consensus        76 kVDiVghSmG~~iaRk~I   93 (218)
T pfam01674        76 KVDIVAHSMGVPIARKAI   93 (218)
T ss_pred             CEEEEEECCCCHHHHHHH
T ss_conf             035886426654345553


No 95 
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=98.74  E-value=5.3e-08  Score=66.64  Aligned_cols=100  Identities=19%  Similarity=0.179  Sum_probs=78.4

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             789999878888001221799999998689899996476554222222222222122222222222222-2222222344
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL-GISKVHVMGY  105 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l-~~~~~~liGh  105 (261)
                      ||+.++|+.+|...   +|.++...+... ..|+..+-+|+|.-.    ...-+++++++...+.|... .-.+++|+||
T Consensus         1 ~pLF~fhp~~G~~~---~~~~L~~~l~~~-~~v~~l~a~g~~~~~----~~~~~l~~~a~~yv~~Ir~~QP~GPy~L~G~   72 (257)
T COG3319           1 PPLFCFHPAGGSVL---AYAPLAAALGPL-LPVYGLQAPGYGAGE----QPFASLDDMAAAYVAAIRRVQPEGPYVLLGW   72 (257)
T ss_pred             CCEEEECCCCCCHH---HHHHHHHHHCCC-CEEECCCCCCCCCCC----CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             97799758877177---878899984657-701000167667666----6657999999999999997399999798864


Q ss_pred             CCCCCCHHHHHHH---CCCCCCCEEEECCCCC
Q ss_conf             3444310133321---0235652389628856
Q gi|254780166|r  106 SMGARIACSMVLF---YPSYVRSVILGGVGSV  134 (261)
Q Consensus       106 S~Gg~ia~~~a~~---~p~~v~~lvl~~~~~~  134 (261)
                      |+||.+|...|.+   ....|+.|+++++.+.
T Consensus        73 S~GG~vA~evA~qL~~~G~~Va~L~llD~~~~  104 (257)
T COG3319          73 SLGGAVAFEVAAQLEAQGEEVAFLGLLDAVPP  104 (257)
T ss_pred             CCCCHHHHHHHHHHHHCCCEEEEEEEECCCCC
T ss_conf             66649999999999967970899998516887


No 96 
>KOG2281 consensus
Probab=98.72  E-value=2.6e-07  Score=62.52  Aligned_cols=226  Identities=17%  Similarity=0.132  Sum_probs=127.5

Q ss_pred             CEEEEEECCCCEEEEEEEC------CCCCCEEEEECCCCCCCHHHHHHHH----HHHHHHHCCCEEEEECCCCCCCCCCC
Q ss_conf             4079993499499999964------8998789999878888001221799----99999868989999647655422222
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVG------DKDAPTILLIHGLASSVQTNWLFSG----WIQLLCDQGFRVIAFDNLGHGKSDKS   73 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g------~~~~~~vv~iHG~~~~~~~~~~~~~----~~~~l~~~g~~vi~~D~~G~G~S~~~   73 (261)
                      ++.-|.+..|..++=-.+.      .+.-|+|+++=|.++-.-.+-.|+.    ....|+..||.|+++|-||--.-...
T Consensus       614 eif~fqs~tg~~lYgmiyKPhn~~pgkkYptvl~VYGGP~VQlVnnsfkgi~ylR~~~LaslGy~Vv~IDnRGS~hRGlk  693 (867)
T KOG2281         614 EIFSFQSKTGLTLYGMIYKPHNFQPGKKYPTVLNVYGGPGVQLVNNSFKGIQYLRFCRLASLGYVVVFIDNRGSAHRGLK  693 (867)
T ss_pred             HHEEEECCCCCEEEEEEECCCCCCCCCCCCEEEEECCCCEEEEEECCCCCEEEHHHHHHHHCCEEEEEECCCCCCCCCCH
T ss_conf             21311138884799999645447778877649996179705886134443120101357537559999858874014403


Q ss_pred             ------CCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHH
Q ss_conf             ------2222222122222222222222---2222222344344431013332102356523896288563311035699
Q gi|254780166|r   74 ------YIENDYRLVFMAADAVSLLEHL---GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ  144 (261)
Q Consensus        74 ------~~~~~~s~~~~~~di~~~i~~l---~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~  144 (261)
                            ..-.-..++|+++-+.-+.++.   +.+++.+-|+|+||++++...+++|+-++-.|..++...+..-+....+
T Consensus       694 FE~~ik~kmGqVE~eDQVeglq~Laeq~gfidmdrV~vhGWSYGGYLSlm~L~~~P~IfrvAIAGapVT~W~~YDTgYTE  773 (867)
T KOG2281         694 FESHIKKKMGQVEVEDQVEGLQMLAEQTGFIDMDRVGVHGWSYGGYLSLMGLAQYPNIFRVAIAGAPVTDWRLYDTGYTE  773 (867)
T ss_pred             HHHHHHHCCCEEEEHHHHHHHHHHHHHCCCCCHHHEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEECCCCCHH
T ss_conf             68888612771775677789999998508656124578433530288888876175403677417851133420242136


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCC---CHH--
Q ss_conf             999986311110000111000000003476654135677765410122001210035760699847888788---079--
Q gi|254780166|r  145 SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG---SPQ--  219 (261)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~---~~~--  219 (261)
                      +.                +        -.|.++.+++.+---...    .+.+..-..-.|+++|--|+-+.   ...  
T Consensus       774 RY----------------M--------g~P~~nE~gY~agSV~~~----VeklpdepnRLlLvHGliDENVHF~Hts~Lv  825 (867)
T KOG2281         774 RY----------------M--------GYPDNNEHGYGAGSVAGH----VEKLPDEPNRLLLVHGLIDENVHFAHTSRLV  825 (867)
T ss_pred             HH----------------C--------CCCCCCHHCCCCHHHHHH----HHCCCCCCCEEEEEEECCCCCHHHHHHHHHH
T ss_conf             54----------------3--------798630111330128888----7508887760799850334530346689999


Q ss_pred             -HHHHHCCCCEEEEECCCCCCCCC-CCHH-HHHHHHHHHHH
Q ss_conf             -99996799799998888738434-8489-99999999875
Q gi|254780166|r  220 -ELMSFIPSSQYLNICRRDHLLAV-GDKQ-FKQGVVNFYAN  257 (261)
Q Consensus       220 -~l~~~~p~~~~~~i~~~gH~~~~-e~p~-~~~~i~~Fl~~  257 (261)
                       ++.+.-+.-++.++|+--|.+-- |... +-..++.|+.+
T Consensus       826 s~lvkagKpyeL~IfP~ERHsiR~~es~~~yE~rll~FlQ~  866 (867)
T KOG2281         826 SALVKAGKPYELQIFPNERHSIRNPESGIYYEARLLHFLQE  866 (867)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99986799348997763014567775412499999999853


No 97 
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=98.70  E-value=1.9e-07  Score=63.41  Aligned_cols=164  Identities=20%  Similarity=0.239  Sum_probs=108.3

Q ss_pred             CCCC-EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9987-899998788880012217999999986898999964765-----5422222222222212222222222222222
Q gi|254780166|r   24 KDAP-TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG-----HGKSDKSYIENDYRLVFMAADAVSLLEHLGI   97 (261)
Q Consensus        24 ~~~~-~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G-----~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~   97 (261)
                      ++.| +||+.||-|.+.++ ......+..|+.+|+.|..|+++=     .|. .+|.+...--...+...+.++...+.-
T Consensus        11 g~~~~tilLaHGAGasmdS-t~m~~~a~~la~~G~~vaRfefpYma~Rrtg~-rkPp~~~~t~~~~~~~~~aql~~~l~~   88 (213)
T COG3571          11 GPAPVTILLAHGAGASMDS-TSMTAVAAALARRGWLVARFEFPYMAARRTGR-RKPPPGSGTLNPEYIVAIAQLRAGLAE   88 (213)
T ss_pred             CCCCEEEEEECCCCCCCCC-HHHHHHHHHHHHCCEEEEEEECCHHHHCCCCC-CCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             9987789984378988777-79999999997374167776250543054568-799694455788999999999822467


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             22222344344431013332102356523896288563311035699999986311110000111000000003476654
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGND  177 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  177 (261)
                      .+.++-|+||||.++..++..-...|.+|+..+. |.. ++...+                                   
T Consensus        89 gpLi~GGkSmGGR~aSmvade~~A~i~~L~clgY-Pfh-ppGKPe-----------------------------------  131 (213)
T COG3571          89 GPLIIGGKSMGGRVASMVADELQAPIDGLVCLGY-PFH-PPGKPE-----------------------------------  131 (213)
T ss_pred             CCEEECCCCCCCHHHHHHHHHHCCCCCEEEEECC-CCC-CCCCCC-----------------------------------
T ss_conf             8656525355633788988763697415888457-668-999844-----------------------------------


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHH--HCCCCEEEEECCCCCCC
Q ss_conf             1356777654101220012100357606998478887880799999--67997999988887384
Q gi|254780166|r  178 LKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMS--FIPSSQYLNICRRDHLL  240 (261)
Q Consensus       178 ~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~--~~p~~~~~~i~~~gH~~  240 (261)
                                   ....+.|.-|.+|+|+.+|+.|++-.-.+ .+.  ..+..|++.++++.|=+
T Consensus       132 -------------~~Rt~HL~gl~tPtli~qGtrD~fGtr~~-Va~y~ls~~iev~wl~~adHDL  182 (213)
T COG3571         132 -------------QLRTEHLTGLKTPTLITQGTRDEFGTRDE-VAGYALSDPIEVVWLEDADHDL  182 (213)
T ss_pred             -------------CCHHHHCCCCCCCEEEEECCCCCCCCHHH-HHHHHCCCCEEEEEECCCCCCC
T ss_conf             -------------11032136777774786225454458999-8753138865899840576665


No 98 
>PRK07868 acyl-CoA synthetase; Validated
Probab=98.70  E-value=4.8e-08  Score=66.90  Aligned_cols=212  Identities=19%  Similarity=0.236  Sum_probs=109.5

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHH-----HHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---
Q ss_conf             987899998788880012217999-----999986898999964765542222222222221222222222222222---
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGW-----IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG---   96 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~-----~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~---   96 (261)
                      .+|+|+++|....+++.   |+-.     .-.|-..|..+..+|+   |..++-+.--.-++.+++--+-+.||...   
T Consensus        66 ~~p~vl~v~pmm~sa~~---~dvt~~~gav~ilh~~gldpwvidf---gspd~~egg~~r~ladhvva~s~aid~v~~~t  139 (990)
T PRK07868         66 VGPPVLMVHPMMMSADM---WDVTREDGAVGILHRAGLDPWVIDF---GSPDKVEGGMRRNLADHIVALSEAIDTVKDVT  139 (990)
T ss_pred             CCCCEEEECCCCCCCCC---EEECCCCCEEEEEECCCCCCEEEEC---CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             89956983643212530---2204567707871114887558735---99631125522244455334988999998623


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHH-CCCCCCCEEEECCC-------CCCCCCCH----HHHH-----------HHHHHHHCC
Q ss_conf             2222223443444310133321-02356523896288-------56331103----5699-----------999986311
Q gi|254780166|r   97 ISKVHVMGYSMGARIACSMVLF-YPSYVRSVILGGVG-------SVLYDSDV----VDWQ-----------SLIDSFLLP  153 (261)
Q Consensus        97 ~~~~~liGhS~Gg~ia~~~a~~-~p~~v~~lvl~~~~-------~~~~~~~~----~~~~-----------~~~~~~~~~  153 (261)
                      -..+||+|+|.||+++.+.|+. +..-+.++|-.++.       |.-.+...    .++-           ..+.+..++
T Consensus       140 g~dvhl~gysqggmf~yq~aayr~s~~~asiitfgspvd~~a~lp~g~pa~~~~~~a~f~adhvf~rl~i~~w~ar~gfq  219 (990)
T PRK07868        140 GRDVHLVGYSQGGMFCYQAAAYRRSKDIASIVAFGSPVDTLAALPMGIPAGLAAAAADFMADHVFNRLDIPSWMARTGFQ  219 (990)
T ss_pred             CCCEEEEEECCCCEEEHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHCCCE
T ss_conf             77136741047762004777877227840278607845676428778981230567889988630536671176650340


Q ss_pred             CCCHHHHH--HHHHHCCCCCC---CCCCCH---------------------HHHHHHHHHHC-CCCC---HHHHHCCCCC
Q ss_conf             11000011--10000000034---766541---------------------35677765410-1220---0121003576
Q gi|254780166|r  154 SIDEVQNP--LGKKFRKFADL---DPGNDL---------------------KALASCLSMIR-KPFC---QDDLYRIDVP  203 (261)
Q Consensus       154 ~~~~~~~~--~~~~~~~~~~~---~~~~~~---------------------~~~~~~~~~~~-~~~~---~~~l~~i~~P  203 (261)
                      .++..+..  .....++.-+.   .+..+.                     +.|....+.+. .+.+   .-.|..|+||
T Consensus       220 ~ldpvkt~~~r~dflrqlhdr~allpre~qrrfl~~egwvawsgpai~ellkqfi~hnrm~tggf~i~g~~vtl~~i~cp  299 (990)
T PRK07868        220 MLDPVKTAKARVDFLRQLHDREALLPREQQRRFLESEGWIAWSGPAISELLKQFIAHNRMMTGGFAINGQMVTLTDITCP  299 (990)
T ss_pred             ECCHHHHHHHHHHHHHHHCCHHHCCCHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHCCCCEEECCEEEEEECCCCC
T ss_conf             23878888989999997413442076787766650387164365789999999987510202765787858763205773


Q ss_pred             EEEEEECCCCCCCC--HHHHHHHCCCCEE-EEECCCCCCCCC
Q ss_conf             06998478887880--7999996799799-998888738434
Q gi|254780166|r  204 VLIAVGSQDDLAGS--PQELMSFIPSSQY-LNICRRDHLLAV  242 (261)
Q Consensus       204 ~l~i~G~~D~~~~~--~~~l~~~~p~~~~-~~i~~~gH~~~~  242 (261)
                      +|.+.||-|.+--+  .+-+.+.-|++++ +..-.+|||..+
T Consensus       300 vlafvge~ddigqpasvrgi~raap~a~vye~~~~aghfglv  341 (990)
T PRK07868        300 VLAFVGEVDDIGQPASVRGIRRAAPNAEVYECLIRAGHFGLV  341 (990)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHCCCCCCEEEEECCCCEEEE
T ss_conf             489975112357846665477608876412322115725688


No 99 
>PRK10115 protease 2; Provisional
Probab=98.69  E-value=5e-07  Score=60.86  Aligned_cols=232  Identities=16%  Similarity=0.094  Sum_probs=122.6

Q ss_pred             CEEEEEECCCCEEEEEEEC------CCCCCEEEEECC-CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC-----
Q ss_conf             4079993499499999964------899878999987-8888001221799999998689899996476554222-----
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVG------DKDAPTILLIHG-LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD-----   71 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g------~~~~~~vv~iHG-~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~-----   71 (261)
                      +--++.+.||+++.+.-..      ++++|+++.--| |+-+..-  .|....-.|.++|+-......||=|+=.     
T Consensus       417 ~rv~~~SkDGt~VP~siv~rk~~~~dg~~P~lLyGYG~ygis~~p--~Fs~~~l~ll~rG~v~AiahvRGGgE~G~~Wh~  494 (686)
T PRK10115        417 EHLWITARDGVEVPVSLVYHRKHFRKGHNPLLVYGYGSYGASIDA--DFSFSRLSLLDRGFVYAIVHVRGGGELGQQWYE  494 (686)
T ss_pred             EEEEEECCCCCEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCC--CCCHHHHHHHHCCCEEEEEECCCCCCCCCHHHH
T ss_conf             999998899978317999806887678987799997646663278--626657568658978999961578877447898


Q ss_pred             -CCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             -22222222212222222222222--222222223443444310133321023565238962885633110356999999
Q gi|254780166|r   72 -KSYIENDYRLVFMAADAVSLLEH--LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID  148 (261)
Q Consensus        72 -~~~~~~~~s~~~~~~di~~~i~~--l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~  148 (261)
                       +.......+++|++.-.+.+++.  -.-++..+.|-|-||+++-..+.++|++++++|+.-+--.+... +        
T Consensus       495 ~G~~~~K~n~f~Dfia~ae~Li~~g~t~~~~l~~~G~SaGGLLvga~~n~~Pelf~a~v~~Vp~vD~l~~-~--------  565 (686)
T PRK10115        495 DGKFLKKKNTFNDYLDACDALLKLGYGSPSLCYGMGGSAGGMLMGVAINERPELFHGVIAQVPFVDVVTT-M--------  565 (686)
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHHCHHHHCEEEECCCCCCCEEC-C--------
T ss_conf             6656459647799999999999839998302899972758888999885195763557866772232121-3--------


Q ss_pred             HHHCCCCCHHHHHHH-HHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCC-CEEEEEECCCCCCCC--HHHHHHH
Q ss_conf             863111100001110-000000034766541356777654101220012100357-606998478887880--7999996
Q gi|254780166|r  149 SFLLPSIDEVQNPLG-KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDV-PVLIAVGSQDDLAGS--PQELMSF  224 (261)
Q Consensus       149 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~-P~l~i~G~~D~~~~~--~~~l~~~  224 (261)
                        ...     .-++. .++..+.+   ..+.+.+..........+..    .-.= ++|+.+|.+|..|++  +.++++.
T Consensus       566 --~d~-----~~plt~~e~~E~G~---p~~~~~~~~i~~YsPy~nv~----~~~YP~~l~tt~~~D~RV~~~~~~K~~A~  631 (686)
T PRK10115        566 --LDE-----SIPLTTGEFEEWGN---PQDPQYYEYMKSYSPYDNVT----AQAYPHLLVTTGLHDSQVQYWEPAKWVAK  631 (686)
T ss_pred             --CCC-----CCCCCCCHHHHCCC---CCCHHHHHHHHHCCCHHCCC----CCCCCHHHEEECCCCCCCCCCHHHHHHHH
T ss_conf             --347-----87888641201379---68999999998659242589----78898687884268888797777999999


Q ss_pred             C----CCCEEEEE---CCCCCCCCCCCH---HHHHHHHHHHHHHCC
Q ss_conf             7----99799998---888738434848---999999999875168
Q gi|254780166|r  225 I----PSSQYLNI---CRRDHLLAVGDK---QFKQGVVNFYANELR  260 (261)
Q Consensus       225 ~----p~~~~~~i---~~~gH~~~~e~p---~~~~~i~~Fl~~~~~  260 (261)
                      +    .+...+++   -++||...-.+-   +-......||+..+.
T Consensus       632 L~~~~~~~~p~ll~~~~~aGHg~~~~~~~~~~e~A~~~aFll~~~~  677 (686)
T PRK10115        632 LRELKTDDHLLLLCTDMDSGHGGKSGRFKSYEGVAMEYAFLIALAQ  677 (686)
T ss_pred             HHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             9863659970899964768677888889999999999999999730


No 100
>KOG4840 consensus
Probab=98.67  E-value=2.4e-07  Score=62.79  Aligned_cols=229  Identities=14%  Similarity=0.096  Sum_probs=117.6

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCC
Q ss_conf             878999987888800122179999999868989999647655422222222222212222222222222222----2222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGI----SKVH  101 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~----~~~~  101 (261)
                      ...||||-|.+...-.-..-..+...|.+.+|.++-+-++.+     ...-..+|+.+-++|+..++++++.    .+++
T Consensus        36 ~~~vvfiGGLgdgLl~~~y~~~L~~~lde~~wslVq~q~~Ss-----y~G~Gt~slk~D~edl~~l~~Hi~~~~fSt~vV  110 (299)
T KOG4840          36 SVKVVFIGGLGDGLLICLYTTMLNRYLDENSWSLVQPQLRSS-----YNGYGTFSLKDDVEDLKCLLEHIQLCGFSTDVV  110 (299)
T ss_pred             EEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCC-----CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEE
T ss_conf             789999745577752354288998888643643664001056-----566565010235899999999862157656649


Q ss_pred             CCCCCCCCCCHHHHHH--HCCCCCCCEEEECCCCCCCCCCHH--HHHHHHHHHHCCCCC-HHHHHHHHHHCCCCCCCCCC
Q ss_conf             2344344431013332--102356523896288563311035--699999986311110-00011100000000347665
Q gi|254780166|r  102 VMGYSMGARIACSMVL--FYPSYVRSVILGGVGSVLYDSDVV--DWQSLIDSFLLPSID-EVQNPLGKKFRKFADLDPGN  176 (261)
Q Consensus       102 liGhS~Gg~ia~~~a~--~~p~~v~~lvl~~~~~~~~~~~~~--~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~  176 (261)
                      |+|||-|++=.+.|..  ..|..++..|+-++..........  +......-+...... .....+  ..|.-....+-.
T Consensus       111 L~GhSTGcQdi~yYlTnt~~~r~iraaIlqApVSDrEYqf~~~~etk~l~d~l~a~~~~~grgedv--~pR~~~~~~p~s  188 (299)
T KOG4840         111 LVGHSTGCQDIMYYLTNTTKDRKIRAAILQAPVSDREYQFLEEHETKDLSDLLRAAKETIGRGEDV--APRYGGGSQPLS  188 (299)
T ss_pred             EEECCCCCHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCC
T ss_conf             971576605799998742223889999872765215555026634578999999987652235423--534588876664


Q ss_pred             CHHHHHHHHHHHC----CCCC-HHHH-------HCCCCCEEEEEECCCCCCCCH-HHHHHHCCCCEEEEECCCCCCCC--
Q ss_conf             4135677765410----1220-0121-------003576069984788878807-99999679979999888873843--
Q gi|254780166|r  177 DLKALASCLSMIR----KPFC-QDDL-------YRIDVPVLIAVGSQDDLAGSP-QELMSFIPSSQYLNICRRDHLLA--  241 (261)
Q Consensus       177 ~~~~~~~~~~~~~----~~~~-~~~l-------~~i~~P~l~i~G~~D~~~~~~-~~l~~~~p~~~~~~i~~~gH~~~--  241 (261)
                      ..+.+.-+-..-.    ..+. .+++       +.-.+-++++.++.|+++++. ++-.....+++..-++.+.|...  
T Consensus       189 a~R~~dl~~~~G~dDmFSSdLS~D~f~~~lg~gsta~~qiif~ms~rDEyv~~~~dkk~llnR~s~~~r~~e~~~~lsg~  268 (299)
T KOG4840         189 ARRALDLFSRYGKDDMFSSDLSEDRFYMELGEGSTAGAQIIFVMSGRDEYVKADIDKKLLLNRNSRVERIPEGTHVLSGA  268 (299)
T ss_pred             HHHHHHHHHHHCCCCCHHCCCCHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             77888899871874200012326689998546788775699994376544673157899987653420677554101266


Q ss_pred             --CC--CHHHHHHHHHHHHHHCCC
Q ss_conf             --48--489999999998751689
Q gi|254780166|r  242 --VG--DKQFKQGVVNFYANELRA  261 (261)
Q Consensus       242 --~e--~p~~~~~i~~Fl~~~~~~  261 (261)
                        ++  -+...++++.|+.++..+
T Consensus       269 ~~~~n~~~~~sqei~k~i~~~~~s  292 (299)
T KOG4840         269 EDVENFLGFLSQEIEKAIGQKAQS  292 (299)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             417654013059999999843788


No 101
>pfam06057 VirJ Bacterial virulence protein (VirJ). This family consists of several bacterial VirJ virulence proteins. VirJ is thought to be involved in the type IV secretion system. It is thought that the substrate proteins localized to the periplasm may associate with the pilus in a manner that is mediated by VirJ, and suggest a two-step process for type IV secretion in Agrobacterium.
Probab=98.65  E-value=2.4e-07  Score=62.78  Aligned_cols=180  Identities=19%  Similarity=0.147  Sum_probs=111.5

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC
Q ss_conf             789999878888001221799999998689899996476554222222222222122222222222222----2222222
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL----GISKVHV  102 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l----~~~~~~l  102 (261)
                      +..||+.|=||=..   .=+.+++.|+++|+.|+-+|-+-|=.|.+       +.+..+.|+..++++.    +.++++|
T Consensus         3 tlav~~SGDGGW~~---lD~~va~~L~~~GvpVvGvdSLrYFW~~k-------tP~q~a~Dl~~ii~~Y~~~w~~~~v~L   72 (192)
T pfam06057         3 TVAVFYSGDGGWRD---LDKEVGSALQKQGVPVVGVDSLRYFWSER-------TPEEVADDLDRIIDTYRKRWKVKNVVL   72 (192)
T ss_pred             EEEEEEECCCCHHH---HHHHHHHHHHHCCCCEEEECHHHHHHCCC-------CHHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             79999946887355---51999999997798365532688875659-------989999999999999999858965999


Q ss_pred             CCCCCCCCCHHHHHHHCC----CCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCH
Q ss_conf             344344431013332102----3565238962885633110356999999863111100001110000000034766541
Q gi|254780166|r  103 MGYSMGARIACSMVLFYP----SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL  178 (261)
Q Consensus       103 iGhS~Gg~ia~~~a~~~p----~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  178 (261)
                      +|+|+|+-+......+-|    ++|+.++|.++.......                 -....++...     .       
T Consensus        73 iGYSFGADvlP~~~n~LP~~~r~~v~~v~LL~~~~~adfe-----------------ihv~~wlg~~-----~-------  123 (192)
T pfam06057        73 IGYSFGADVLPAAYNRLPPATKQRVRQVSLLALGKKADFE-----------------ISVEGWLGWD-----G-------  123 (192)
T ss_pred             EEECCCCCHHHHHHHHCCHHHHHHHHEEEEECCCCCCEEE-----------------EEEHHHCCCC-----C-------
T ss_conf             9617872266654610999998541178884468853189-----------------9832301678-----8-------


Q ss_pred             HHHHHHHHHHCCCCCHHHHHCCC-CCEEEEEECCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             35677765410122001210035-76069984788878807999996799799998888738434848999999999875
Q gi|254780166|r  179 KALASCLSMIRKPFCQDDLYRID-VPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN  257 (261)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~l~~i~-~P~l~i~G~~D~~~~~~~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~Fl~~  257 (261)
                               -......++++++. .|+++|.|+++.-...+.   -..++.+.+.+||+ |.+--+-+.+.+.|++=|+.
T Consensus       124 ---------~~~~~~~pei~~l~~~~v~CiyG~~E~d~~cp~---l~~~~~~~i~lpGg-HHFd~Dy~~la~~Il~~l~~  190 (192)
T pfam06057       124 ---------EGKADPVPDLARLPPARVQCIYGQDEKDTACPS---LRQRGAEVVALPGG-HHFDGDYEALAKRILQGLRA  190 (192)
T ss_pred             ---------CCCCCCCHHHHCCCCCEEEEEECCCCCCCCCCC---CCCCCCEEEECCCC-CCCCCCHHHHHHHHHHHHHH
T ss_conf             ---------775675467860998706999758878766856---56788779965898-77787599999999999983


Q ss_pred             H
Q ss_conf             1
Q gi|254780166|r  258 E  258 (261)
Q Consensus       258 ~  258 (261)
                      .
T Consensus       191 r  191 (192)
T pfam06057       191 R  191 (192)
T ss_pred             C
T ss_conf             2


No 102
>pfam05990 DUF900 Alpha/beta hydrolase of unknown function (DUF900). This family consists of several hypothetical proteins of unknown function mostly found in Rhizobium species. Members of this family have an alpha/beta hydrolase fold.
Probab=98.65  E-value=1.5e-08  Score=69.85  Aligned_cols=110  Identities=13%  Similarity=0.069  Sum_probs=64.5

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89987899998788880012217999999986898999964765542222---222222221222222222222222222
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK---SYIENDYRLVFMAADAVSLLEHLGISK   99 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~---~~~~~~~s~~~~~~di~~~i~~l~~~~   99 (261)
                      .+++..+||+|||..+.+....-..|+.+...-.-.++.|.+|..|.-..   +.....++-..+.+-+..+.+..+.++
T Consensus        16 s~~r~vlvFVHGyN~~f~~a~~r~aQl~~d~~~~g~~v~FSWPS~g~~~~Y~~D~~sa~~s~~~l~~~L~~l~~~~~~~~   95 (230)
T pfam05990        16 SAGKRVLVFVHGYNNSFEDAVYRFAQIAHDLGFPGVPVVFTWPSGASLFGYNYDRESANYSRDALERLLRYLATTPPVKR   95 (230)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             89985999975899998999999999998469997469996889996134487999999999999999999986669874


Q ss_pred             CCCCCCCCCCCCHHHHHHH---------CCCCCCCEEEECCC
Q ss_conf             2223443444310133321---------02356523896288
Q gi|254780166|r  100 VHVMGYSMGARIACSMVLF---------YPSYVRSVILGGVG  132 (261)
Q Consensus       100 ~~liGhS~Gg~ia~~~a~~---------~p~~v~~lvl~~~~  132 (261)
                      +++++||||+.+.++....         .+.++..+||.++.
T Consensus        96 I~ilAHSMG~rl~~~aL~~l~~~~~~~~~~~~i~~viLaApD  137 (230)
T pfam05990        96 IHLIAHSMGTWLVMEALRQLAIEADEPDVVAKIGNVILAAPD  137 (230)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHCCCCCHHHHHHCEEEECCC
T ss_conf             899985817899999999999856674044443126774688


No 103
>KOG2551 consensus
Probab=98.62  E-value=6.2e-07  Score=60.31  Aligned_cols=60  Identities=17%  Similarity=0.280  Sum_probs=45.3

Q ss_pred             HHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             1003576069984788878807--9999967997999988887384348489999999998751
Q gi|254780166|r  197 LYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYANE  258 (261)
Q Consensus       197 l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~Fl~~~  258 (261)
                      .+.|++|+|-|.|+.|.++++.  +.|++.++++.+. ...+||+++--. .+.+.+.+|+...
T Consensus       159 ~~~i~~PSLHi~G~~D~iv~~~~s~~L~~~~~~a~vl-~HpggH~VP~~~-~~~~~i~~fi~~~  220 (230)
T KOG2551         159 KRPLSTPSLHIFGETDTIVPSERSEQLAESFKDATVL-EHPGGHIVPNKA-KYKEKIADFIQSF  220 (230)
T ss_pred             CCCCCCCEEEEECCCCEEECCHHHHHHHHHCCCCEEE-ECCCCCCCCCCH-HHHHHHHHHHHHH
T ss_conf             3677787057843655341326779999856787689-548875478710-7899999999999


No 104
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I; InterPro: IPR010963   This entry represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerises hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of the cell.; GO: 0008415 acyltransferase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=98.61  E-value=8.4e-08  Score=65.47  Aligned_cols=212  Identities=15%  Similarity=0.147  Sum_probs=117.7

Q ss_pred             CCCEEEEECCCC-----CCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCC
Q ss_conf             987899998788-----880012217999999986898999964765542222222222221222222-----2222222
Q gi|254780166|r   25 DAPTILLIHGLA-----SSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD-----AVSLLEH   94 (261)
Q Consensus        25 ~~~~vv~iHG~~-----~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~d-----i~~~i~~   94 (261)
                      .++||+.++-|-     .+.+   .=..++..|.++||+|..+-+|.-..+-     ...+++|++.|     +..+-+.
T Consensus       187 ~~tPlLiVPP~INKyYILDLr---P~NSlvrWlv~QG~TVF~~SWrNPd~~~-----A~~tfdDY~~~G~~~Al~~v~~i  258 (541)
T TIGR01838       187 HKTPLLIVPPFINKYYILDLR---PENSLVRWLVEQGHTVFLISWRNPDAEQ-----ADLTFDDYVRDGVIAALEVVEEI  258 (541)
T ss_pred             CCCEEEEECCCCCCCEECCCC---CCHHHHHHHHHCCCCEEEEEECCCCHHH-----HHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             430258737873311201678---6535899999549938998600627564-----53674789999999999999861


Q ss_pred             CCCCCCCCCCCCCCCCCHHH----HHHHC-CCCCCCEEEECCCCCC----------CCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             22222222344344431013----33210-2356523896288563----------311035699999986311110000
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACS----MVLFY-PSYVRSVILGGVGSVL----------YDSDVVDWQSLIDSFLLPSIDEVQ  159 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~----~a~~~-p~~v~~lvl~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~  159 (261)
                      -|.++++.||++-||++...    +|++. .+||++.++..+.-..          .+.-....++..+....| ...+.
T Consensus       259 tGe~~~N~~GYCIGGT~Ls~alA~lAArg~~~ri~SaTffTTllDF~~~G~l~~F~~E~~v~~iE~~~~~~GGP-~~~l~  337 (541)
T TIGR01838       259 TGEKQVNAVGYCIGGTLLSTALAYLAARGEKKRIKSATFFTTLLDFSDPGELGVFVDEEIVSAIERQNNQKGGP-IAYLD  337 (541)
T ss_pred             CCCEEEEEEEEEHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCHHCCCCCCEEECCHHHHHHHHHHCCCCCC-EEEEC
T ss_conf             55406504541044789999999999617896124588999984310278531123808999999984137895-67506


Q ss_pred             -HHHHHHHCC-----------CCCCCCCCCH--------------------HHHHHHH-H--------HHCCCCCHHHHH
Q ss_conf             -111000000-----------0034766541--------------------3567776-5--------410122001210
Q gi|254780166|r  160 -NPLGKKFRK-----------FADLDPGNDL--------------------KALASCL-S--------MIRKPFCQDDLY  198 (261)
Q Consensus       160 -~~~~~~~~~-----------~~~~~~~~~~--------------------~~~~~~~-~--------~~~~~~~~~~l~  198 (261)
                       ..++..|..           +.....++.+                    ..|++.+ .        .+.--..+-+|+
T Consensus       338 G~~la~TFSlLR~NdL~WnY~vdnYLKG~~P~pFDLLfWN~DsTN~Pg~~h~~yLR~lYl~N~L~~~g~l~~~G~~lDL~  417 (541)
T TIGR01838       338 GRSLAVTFSLLRENDLIWNYYVDNYLKGKSPVPFDLLFWNSDSTNLPGKMHNFYLRNLYLQNELVSKGKLEVGGVRLDLS  417 (541)
T ss_pred             CHHHHHHHHHCCCCCEEECCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCEEEECC
T ss_conf             05688887312468702066304314677578600121155011004778989987530101111688548732462034


Q ss_pred             CCCCCEEEEEECCCCCCCC--HHHHHHHCC-CCEEEEECCCCCCCC-CCCH
Q ss_conf             0357606998478887880--799999679-979999888873843-4848
Q gi|254780166|r  199 RIDVPVLIAVGSQDDLAGS--PQELMSFIP-SSQYLNICRRDHLLA-VGDK  245 (261)
Q Consensus       199 ~i~~P~l~i~G~~D~~~~~--~~~l~~~~p-~~~~~~i~~~gH~~~-~e~p  245 (261)
                      +|++|++++...+|+++|-  +-+=++.+. +-...++-++||..- +.+|
T Consensus       418 ~vk~P~y~~at~eDHIApW~~~y~G~~~lGsG~~rFvLgeSGHIAGvvNPP  468 (541)
T TIGR01838       418 KVKVPVYIIATKEDHIAPWQSAYRGAALLGSGEKRFVLGESGHIAGVVNPP  468 (541)
T ss_pred             CCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCEEEEECCC
T ss_conf             243124576134443458279999998853898348852665050046788


No 105
>pfam07819 PGAP1 PGAP1-like protein. The sequences found in this family are similar to PGAP1. This is an endoplasmic reticulum membrane protein with a catalytic serine containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body.
Probab=98.61  E-value=8.6e-08  Score=65.40  Aligned_cols=98  Identities=18%  Similarity=0.165  Sum_probs=55.1

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHH--------CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC----C
Q ss_conf             9987899998788880012217999999986--------898999964765542222222222221222222222----2
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCD--------QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVS----L   91 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~--------~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~----~   91 (261)
                      -++.||+||||.+||.+.   ...++..+.+        ..+.+++.|+-... |.   - ..-++.++++-+..    +
T Consensus         2 l~GiPVLFIPGNaGSykQ---vRSlas~~~~~~~~~~~~~~ld~ftvDfnEel-sA---~-~G~~l~~Qaeyv~~aI~~I   73 (225)
T pfam07819         2 LSGIPVLFIPGNAGSYKQ---VRSIASVALRKAELNDNGFHLDFFSVDFNEEL-SA---F-HGRTLLDQAEYLNDAIRYI   73 (225)
T ss_pred             CCCCEEEEECCCCCCHHH---HHHHHHHHHHHHHCCCCCCCCEEEEECCCCHH-HH---C-CCHHHHHHHHHHHHHHHHH
T ss_conf             888608986899886788---98999999998751377754208987345355-53---1-6188999999999999999


Q ss_pred             CCCC-----CCCCCCCCCCCCCCCCHHHHHHHCCC----CCCCEEEEC
Q ss_conf             2222-----22222223443444310133321023----565238962
Q gi|254780166|r   92 LEHL-----GISKVHVMGYSMGARIACSMVLFYPS----YVRSVILGG  130 (261)
Q Consensus        92 i~~l-----~~~~~~liGhS~Gg~ia~~~a~~~p~----~v~~lvl~~  130 (261)
                      ++..     ..+.++|+||||||.||..+.. .|+    .|.-+|-.+
T Consensus        74 l~lY~~~~~~p~sVilvGHSMGGiVAr~~l~-~~~~~~~~V~tIItLs  120 (225)
T pfam07819        74 LSLYNSGRPPPTSVILIGHSMGGLVARAALT-LPNYIPDSVNTIVTLS  120 (225)
T ss_pred             HHHHCCCCCCCCCEEEEEECCCHHHHHHHHC-CCCCCCCCEEEEEEEC
T ss_conf             9985247899971699863241177877751-7433445223788803


No 106
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only]
Probab=98.51  E-value=1.2e-06  Score=58.61  Aligned_cols=172  Identities=10%  Similarity=0.013  Sum_probs=107.2

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             87899998788880012217999999986898999964765542222222222221222222222222222222222344
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGY  105 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGh  105 (261)
                      .+.+|.+||+.+|....  |..+.+.-..   .+-.+++.      .+..   -..+++++.+..-++.. -++++||+|
T Consensus         2 ~~~~lIVpG~~~Sg~~H--Wq~~we~~l~---~a~rveq~------~w~~---P~~~dWi~~l~~~v~a~-~~~~vlVAH   66 (181)
T COG3545           2 MTDVLIVPGYGGSGPNH--WQSRWESALP---NARRVEQD------DWEA---PVLDDWIARLEKEVNAA-EGPVVLVAH   66 (181)
T ss_pred             CCEEEEECCCCCCCHHH--HHHHHHHHCC---CCHHCCCC------CCCC---CCHHHHHHHHHHHHHCC-CCCEEEEEE
T ss_conf             85099946888998127--8999874183---22112667------8788---87999999999999606-797499984


Q ss_pred             CCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             34443101333210235652389628856331103569999998631111000011100000000347665413567776
Q gi|254780166|r  106 SMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCL  185 (261)
Q Consensus       106 S~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (261)
                      |+|+..+++++......|++..|+++...-.+..                      ..+.                    
T Consensus        67 SLGc~~v~h~~~~~~~~V~GalLVAppd~~~~~~----------------------~~~~--------------------  104 (181)
T COG3545          67 SLGCATVAHWAEHIQRQVAGALLVAPPDVSRPEI----------------------RPKH--------------------  104 (181)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC----------------------CHHH--------------------
T ss_conf             5457999999986420431589956877555554----------------------4042--------------------


Q ss_pred             HHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEECCCCCCCCCC----CHHHHHHHHHHHHHH
Q ss_conf             54101220012100357606998478887880--79999967997999988887384348----489999999998751
Q gi|254780166|r  186 SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNICRRDHLLAVG----DKQFKQGVVNFYANE  258 (261)
Q Consensus       186 ~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~~gH~~~~e----~p~~~~~i~~Fl~~~  258 (261)
                        ...++.. ...++.-|.+++...+|++++.  ++.+++.+ ++.++.+..+||+.--+    =|+....+.+|+.+.
T Consensus       105 --~~tf~~~-p~~~lpfps~vvaSrnDp~~~~~~a~~~a~~w-gs~lv~~g~~GHiN~~sG~g~wpeg~~~l~~~~s~~  179 (181)
T COG3545         105 --LMTFDPI-PREPLPFPSVVVASRNDPYVSYEHAEDLANAW-GSALVDVGEGGHINAESGFGPWPEGYALLAQLLSRA  179 (181)
T ss_pred             --CCCCCCC-CCCCCCCCEEEEEECCCCCCCHHHHHHHHHHC-CHHHEECCCCCCCCHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             --3444788-66667876358972699878989999999860-276545355664323306887477999999876530


No 107
>KOG3043 consensus
Probab=98.44  E-value=6.6e-06  Score=54.19  Aligned_cols=185  Identities=15%  Similarity=0.177  Sum_probs=107.9

Q ss_pred             ECCCCEEEEEEECCCCCC-EEEEECC-CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC--------CCCCC
Q ss_conf             349949999996489987-8999987-8888001221799999998689899996476554222222--------22222
Q gi|254780166|r   10 SWRKYQFAFYDVGDKDAP-TILLIHG-LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY--------IENDY   79 (261)
Q Consensus        10 ~~dG~~l~y~~~g~~~~~-~vv~iHG-~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~--------~~~~~   79 (261)
                      ...|.+.  |..|..+.+ .||.+-- ||-...   .-...+..++..||.|+.+|+. .|+.-.+.        --..+
T Consensus        24 ~v~glda--Yv~gs~~~~~~li~i~DvfG~~~~---n~r~~Adk~A~~Gy~v~vPD~~-~Gdp~~~~~~~~~~~~w~~~~   97 (242)
T KOG3043          24 EVGGLDA--YVVGSTSSKKVLIVIQDVFGFQFP---NTREGADKVALNGYTVLVPDFF-RGDPWSPSLQKSERPEWMKGH   97 (242)
T ss_pred             EECCEEE--EEECCCCCCEEEEEEEEEECCCCH---HHHHHHHHHHCCCCEEECCHHH-CCCCCCCCCCHHHHHHHHHCC
T ss_conf             6457268--996688887589999863036647---7899999872288479725220-589899888713538988447


Q ss_pred             CCCCCCCCCCCCCCCC---C-CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             2122222222222222---2-22222234434443101333210235652389628856331103569999998631111
Q gi|254780166|r   80 RLVFMAADAVSLLEHL---G-ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSI  155 (261)
Q Consensus        80 s~~~~~~di~~~i~~l---~-~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (261)
                      +....-+++..+++.+   + .+++-++|.+|||.++..+.+..| ++.+.+.+=+.                       
T Consensus        98 ~~~~~~~~i~~v~k~lk~~g~~kkIGv~GfCwGak~vv~~~~~~~-~f~a~v~~hps-----------------------  153 (242)
T KOG3043          98 SPPKIWKDITAVVKWLKNHGDSKKIGVVGFCWGAKVVVTLSAKDP-EFDAGVSFHPS-----------------------  153 (242)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEEEEEEECCEEEEEEECCCH-HHEEEEEECCC-----------------------
T ss_conf             954210678999999997298615657888525507888504343-12034574477-----------------------


Q ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHH---CC--CC
Q ss_conf             000011100000000347665413567776541012200121003576069984788878807--999996---79--97
Q gi|254780166|r  156 DEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSF---IP--SS  228 (261)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~---~p--~~  228 (261)
                                                        ..+ .++..++++|+|++.|+.|+++|+.  .+..+.   .|  ++
T Consensus       154 ----------------------------------~~d-~~D~~~vk~Pilfl~ae~D~~~p~~~v~~~ee~lk~~~~~~~  198 (242)
T KOG3043         154 ----------------------------------FVD-SADIANVKAPILFLFAELDEDVPPKDVKAWEEKLKENPAVGS  198 (242)
T ss_pred             ----------------------------------CCC-HHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             ----------------------------------588-667741789879873035666787788999998740766431


Q ss_pred             EEEEECCCCCCCC-----CCCHH-------HHHHHHHHHHHHC
Q ss_conf             9999888873843-----48489-------9999999987516
Q gi|254780166|r  229 QYLNICRRDHLLA-----VGDKQ-------FKQGVVNFYANEL  259 (261)
Q Consensus       229 ~~~~i~~~gH~~~-----~e~p~-------~~~~i~~Fl~~~~  259 (261)
                      +++++++.+|-.+     ++.|+       ..+.+++||+.-+
T Consensus       199 ~v~~f~g~~HGf~~~r~~~~~Ped~~~~eea~~~~~~Wf~~y~  241 (242)
T KOG3043         199 QVKTFSGVGHGFVARRANISSPEDKKAAEEAYQRFISWFKHYL  241 (242)
T ss_pred             EEEECCCCCCHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6897078650433111577985677889999999999999963


No 108
>KOG3975 consensus
Probab=98.42  E-value=5.9e-06  Score=54.48  Aligned_cols=240  Identities=14%  Similarity=0.106  Sum_probs=119.4

Q ss_pred             EEECCCCEEEEEEEC------CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH---CCCEEEEECCCCCCCCC---CC--
Q ss_conf             993499499999964------89987899998788880012217999999986---89899996476554222---22--
Q gi|254780166|r    8 FRSWRKYQFAFYDVG------DKDAPTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSD---KS--   73 (261)
Q Consensus         8 ~~~~dG~~l~y~~~g------~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~---~g~~vi~~D~~G~G~S~---~~--   73 (261)
                      +.+..|..++-...+      ..+++.+++|.|.+|....   |..++..|..   +.+.++++-..||-.-.   +.  
T Consensus         5 ~~~~~gl~~si~~~~~~v~~~~~~~~li~~IpGNPG~~gF---Y~~F~~~L~~~l~~r~~~wtIsh~~H~~~P~sl~~~~   81 (301)
T KOG3975           5 EYTKSGLPTSILTLKPWVTKSGEDKPLIVWIPGNPGLLGF---YTEFARHLHLNLIDRLPVWTISHAGHALMPASLREDH   81 (301)
T ss_pred             EEEECCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCHHH---HHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCC
T ss_conf             3550687666166421011378972389996699983257---8999999998644336416870366566871000340


Q ss_pred             --CCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCHHHHHHHCC--CCCCCEEEECCCC-CCCC-------CC
Q ss_conf             --2222222122222222222222--2222222344344431013332102--3565238962885-6331-------10
Q gi|254780166|r   74 --YIENDYRLVFMAADAVSLLEHL--GISKVHVMGYSMGARIACSMVLFYP--SYVRSVILGGVGS-VLYD-------SD  139 (261)
Q Consensus        74 --~~~~~~s~~~~~~di~~~i~~l--~~~~~~liGhS~Gg~ia~~~a~~~p--~~v~~lvl~~~~~-~~~~-------~~  139 (261)
                        ....-|+++++++.=.+++++.  +-.|++++|||-|+++.++......  ..+.+.++.=|.- .+.+       ..
T Consensus        82 s~~~~eifsL~~QV~HKlaFik~~~Pk~~ki~iiGHSiGaYm~Lqil~~~k~~~~vqKa~~LFPTIerM~eSpnG~~~t~  161 (301)
T KOG3975          82 SHTNEEIFSLQDQVDHKLAFIKEYVPKDRKIYIIGHSIGAYMVLQILPSIKLVFSVQKAVLLFPTIERMHESPNGIRLTK  161 (301)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHCCCCCCEEEEEEECCHHHHHHCCCCCEEEEE
T ss_conf             03555543511677889999997488887799994352699999975641466414788885421888724998638652


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHC----CCCCCCCCCCHHHHH-HHHHHHCCC------------------CCHHH
Q ss_conf             3569999998631111000011100000----000347665413567-776541012------------------20012
Q gi|254780166|r  140 VVDWQSLIDSFLLPSIDEVQNPLGKKFR----KFADLDPGNDLKALA-SCLSMIRKP------------------FCQDD  196 (261)
Q Consensus       140 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~-~~~~~~~~~------------------~~~~~  196 (261)
                      ...+...+..+..-.   +-.....+.+    ++.-..+ +.++.+. +.+...+..                  ...+-
T Consensus       162 ~l~~~~hv~~lt~yi---~~~~lp~~ir~~Li~~~l~~~-n~p~e~l~tal~l~h~~v~rn~v~la~qEm~eV~~~d~e~  237 (301)
T KOG3975         162 VLRYLPHVVSLTSYI---YWILLPGFIRFILIKFMLCGS-NGPQEFLSTALFLTHPQVVRNSVGLAAQEMEEVTTRDIEY  237 (301)
T ss_pred             EEEEEHHHHHEEEEE---EEECCHHHHHHHHHHHHCCCC-CCCHHHHHHHHHHHCHHHHHHHHHHCHHHHHHHHHHHHHH
T ss_conf             213213432013022---020084889999999733267-8827887547775159999987610468899999868999


Q ss_pred             HHCCCCCEEEEEECCCCCCCCH--HHHHHHCCCC--EEEEECCCCCCCCCCCH-HHHHHHHHHH
Q ss_conf             1003576069984788878807--9999967997--99998888738434848-9999999998
Q gi|254780166|r  197 LYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSS--QYLNICRRDHLLAVGDK-QFKQGVVNFY  255 (261)
Q Consensus       197 l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~~--~~~~i~~~gH~~~~e~p-~~~~~i~~Fl  255 (261)
                      +++-.+-+.+..|..|..+|..  +.+++..|..  ++.+ ++..|.+.+... ..++.+.+.+
T Consensus       238 ~een~d~l~Fyygt~DgW~p~~~~d~~kdd~~eed~~Lde-dki~HAFV~~~~q~ma~~v~d~~  300 (301)
T KOG3975         238 CEENLDSLWFYYGTNDGWVPSHYYDYYKDDVPEEDLKLDE-DKIPHAFVVKHAQYMANAVFDMI  300 (301)
T ss_pred             HHHCCCEEEEECCCCCCCCCHHHHHHHHHHCCHHCEEECC-CCCCCCEEECCCHHHHHHHHHHH
T ss_conf             9851748999903788875267878886435600054340-35973123204189999999862


No 109
>pfam00450 Peptidase_S10 Serine carboxypeptidase.
Probab=98.35  E-value=1.1e-05  Score=52.81  Aligned_cols=120  Identities=14%  Similarity=0.118  Sum_probs=67.9

Q ss_pred             CCEEEEEEE--C--CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH--------------CCCEEEEECCC-CCCCCCCC
Q ss_conf             949999996--4--89987899998788880012217999999986--------------89899996476-55422222
Q gi|254780166|r   13 KYQFAFYDV--G--DKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--------------QGFRVIAFDNL-GHGKSDKS   73 (261)
Q Consensus        13 G~~l~y~~~--g--~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~--------------~g~~vi~~D~~-G~G~S~~~   73 (261)
                      |..++|.-+  .  +.+.|.||.+.|.+|++...-.+...-+....              +-.+++.+|+| |-|.|-..
T Consensus        23 ~~~lffwffes~~~p~~~PlilWlnGGPG~SS~~G~f~E~GP~~~~~~~~~l~~N~~SWn~~an~L~iDqPvGtGfSy~~  102 (415)
T pfam00450        23 GRSLFYWFFESENNPETDPLVLWLNGGPGCSSLGGLFEELGPFRVNPDGPTLYLNPYSWNKVANVLFLDQPVGVGFSYSN  102 (415)
T ss_pred             CCEEEEEEEECCCCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEECCCCCCCEECCCCCCCCCCEEEEECCCCCCCCCCC
T ss_conf             96799999973799887988999789994777777875276828889998121687631034547999658766736778


Q ss_pred             C-CCCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCCHHHHHHHC----------CCCCCCEEEECCC
Q ss_conf             2-22222212222222222222-------2222222234434443101333210----------2356523896288
Q gi|254780166|r   74 Y-IENDYRLVFMAADAVSLLEH-------LGISKVHVMGYSMGARIACSMVLFY----------PSYVRSVILGGVG  132 (261)
Q Consensus        74 ~-~~~~~s~~~~~~di~~~i~~-------l~~~~~~liGhS~Gg~ia~~~a~~~----------p~~v~~lvl~~~~  132 (261)
                      . .....+.++.+.|+..+++.       +.-.+++|.|-|+||..+..+|..-          +-.++++++.++.
T Consensus       103 ~~~~~~~~~~~~A~~~~~fL~~Ff~~fp~~~~~~~~i~GESYgG~YvP~ia~~i~~~n~~~~~~~inLkGi~IGng~  179 (415)
T pfam00450       103 TTSDYTTGDEETAEDNYEFLQKFFEKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKGDKPNINLKGVLIGNGL  179 (415)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCHHHCCCCEEEEECCCCCEEHHHHHHHHHHHCCCCCCCCEEEEEEEECCCC
T ss_conf             97666688799999999999999996967507963898233354338999999997320257872103688954864


No 110
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only]
Probab=98.32  E-value=1.4e-05  Score=52.21  Aligned_cols=225  Identities=20%  Similarity=0.250  Sum_probs=111.4

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             99878999987888800122179999999868989999647655422222--------222222212222222222222-
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS--------YIENDYRLVFMAADAVSLLEH-   94 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~--------~~~~~~s~~~~~~di~~~i~~-   94 (261)
                      +.-|.+++.||+++......   .....++..++.++..+....|.+...        .....+...........++.. 
T Consensus        47 ~~~p~v~~~h~~~~~~~~~~---~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  123 (299)
T COG1073          47 KKLPAVVFLHGFGSSKEQSL---GYAVLLAEKGYRVLAGDASLFGESGGDPRGLADSEGYAEDFSAAVLLLLSEGVLDKD  123 (299)
T ss_pred             CCCCEEEECCCCCCCCCCCH---HHHHHHCCCCEEECCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             77786787156554214430---355643056145302423335661688247743034555554310101222466687


Q ss_pred             -----CCCCCCCCCCCCCCCCCHHHHHHHCCC--CCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHC
Q ss_conf             -----222222223443444310133321023--5652389628856331103569999998631111000011100000
Q gi|254780166|r   95 -----LGISKVHVMGYSMGARIACSMVLFYPS--YVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFR  167 (261)
Q Consensus        95 -----l~~~~~~liGhS~Gg~ia~~~a~~~p~--~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  167 (261)
                           ...++....|+++|+..+..++...+.  ....+++.+..-..... ........ .......+.+......   
T Consensus       124 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~g~s~g~~~~-~~~~~~~~-~~~~~~~~~~~~~~~~---  198 (299)
T COG1073         124 YRLLGASLGPRILAGLSLGGPSAGALLAWGPTRLDASRIVVWGESLGGALA-LLLLGANP-ELARELIDYLITPGGF---  198 (299)
T ss_pred             HHHHHHCCCCCEEEEEEECCHHHHHHHHHCCCCCCCCCEEEEEECCCCHHH-HHHHCCCC-HHHCCCCCEEECCCCC---
T ss_conf             775412258713678993351699998636454333440588623562888-86520020-2111335478726864---


Q ss_pred             CCCCCCCCCCHHHHHHH---HHHHCCCCCHHHHHCCC-CCEEEEEECCCCCCCCH--HHHHHHCC--CCEEEEECCCCCC
Q ss_conf             00034766541356777---65410122001210035-76069984788878807--99999679--9799998888738
Q gi|254780166|r  168 KFADLDPGNDLKALASC---LSMIRKPFCQDDLYRID-VPVLIAVGSQDDLAGSP--QELMSFIP--SSQYLNICRRDHL  239 (261)
Q Consensus       168 ~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~l~~i~-~P~l~i~G~~D~~~~~~--~~l~~~~p--~~~~~~i~~~gH~  239 (261)
                        ...  ......+...   .......+....+.++. .|+|+++|+.|..++..  +.+....+  ..+...+++++|.
T Consensus       199 --~~~--~~~~~~~~~~~~~~~~~~~~d~~~~~~~i~~~P~l~~~G~~D~~vp~~~~~~~~~~~~~~~~~~~~~~~~~H~  274 (299)
T COG1073         199 --APL--PAPEAPLDTLPLRAVLLLLLDPFDDAEKISPRPVLLVHGERDEVVPLRDAEDLYEAARERPKKLLFVPGGGHI  274 (299)
T ss_pred             --CCC--CCCCCHHCCCCCCHHHHCCCCCHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             --566--5553000133331034315574114553067862999777787258899878999743168469843896532


Q ss_pred             CCCC-CH---HHHHHHHHHHHHHCC
Q ss_conf             4348-48---999999999875168
Q gi|254780166|r  240 LAVG-DK---QFKQGVVNFYANELR  260 (261)
Q Consensus       240 ~~~e-~p---~~~~~i~~Fl~~~~~  260 (261)
                      .... .+   +..+.+.+||.+.+.
T Consensus       275 ~~~~~~~~~~~~~~~~~~f~~~~l~  299 (299)
T COG1073         275 DLYDNPPAVEQALDKLAEFLERHLL  299 (299)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             2467745889999999999997519


No 111
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]
Probab=98.30  E-value=7.9e-07  Score=59.70  Aligned_cols=101  Identities=26%  Similarity=0.224  Sum_probs=70.0

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCE---EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             878999987888800122179999999868989---99964765542222222222221222222222222222222222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFR---VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHV  102 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~---vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~l  102 (261)
                      .-|+|++||++.+..   .|..+...+...|+.   +++++.++- ....   +.....+.....+.+++...+.+++.|
T Consensus        59 ~~pivlVhG~~~~~~---~~~~~~~~~~~~g~~~~~~~~~~~~~~-~~~~---~~~~~~~ql~~~V~~~l~~~ga~~v~L  131 (336)
T COG1075          59 KEPIVLVHGLGGGYG---NFLPLDYRLAILGWLTNGVYAFELSGG-DGTY---SLAVRGEQLFAYVDEVLAKTGAKKVNL  131 (336)
T ss_pred             CCEEEEECCCCCCHH---HHHHHHHHHHHCCCCCCCEEEEECCCC-CCCC---CCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             752999747866631---677776575321420055478621556-6776---432339999999999987548862578


Q ss_pred             CCCCCCCCCHHHHHHHCC--CCCCCEEEECCCC
Q ss_conf             344344431013332102--3565238962885
Q gi|254780166|r  103 MGYSMGARIACSMVLFYP--SYVRSVILGGVGS  133 (261)
Q Consensus       103 iGhS~Gg~ia~~~a~~~p--~~v~~lvl~~~~~  133 (261)
                      +|||+||.++..++...+  .+|++++..++.-
T Consensus       132 igHS~GG~~~ry~~~~~~~~~~V~~~~tl~tp~  164 (336)
T COG1075         132 IGHSMGGLDSRYYLGVLGGANRVASVVTLGTPH  164 (336)
T ss_pred             EEECCCCHHHHHHHHHCCCCCEEEEEEEECCCC
T ss_conf             651664067789998478634056789842677


No 112
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism]
Probab=98.30  E-value=3.6e-05  Score=49.80  Aligned_cols=229  Identities=19%  Similarity=0.174  Sum_probs=126.0

Q ss_pred             EEEEECCCCEEEEEEEC---CCC-CCEEEEECC-CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCC---CC
Q ss_conf             79993499499999964---899-878999987-88880012217999999986898999964765542222222---22
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVG---DKD-APTILLIHG-LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI---EN   77 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g---~~~-~~~vv~iHG-~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~---~~   77 (261)
                      .|..+.||++|+|+..+   +.+ .|++|.-=| |.-+..  -.|.+....+.++|...+..++||=|+=. |.-   ..
T Consensus       397 ~~atSkDGT~IPYFiv~K~~~~D~~pTll~aYGGF~vslt--P~fs~~~~~WLerGg~fv~ANIRGGGEfG-p~WH~Aa~  473 (648)
T COG1505         397 FFATSKDGTRIPYFIVRKGAKKDENPTLLYAYGGFNISLT--PRFSGSRKLWLERGGVFVLANIRGGGEFG-PEWHQAGM  473 (648)
T ss_pred             EEEECCCCCCCCEEEEECCCCCCCCCEEEEECCCCCCCCC--CCCCHHHHHHHHCCCEEEEEECCCCCCCC-HHHHHHHH
T ss_conf             9997278854217998547777888658995156244557--76423778887618869999614677568-79999776


Q ss_pred             CCCCCCCCCCCCCCCCCC---CC---CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             222122222222222222---22---222223443444310133321023565238962885633110356999999863
Q gi|254780166|r   78 DYRLVFMAADAVSLLEHL---GI---SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFL  151 (261)
Q Consensus        78 ~~s~~~~~~di~~~i~~l---~~---~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~  151 (261)
                      .-.-....+|..++.+.|   ++   +++-+-|-|-||.+.-....++|+.+..+|. .. |.+   ++.   ++..  .
T Consensus       474 k~nrq~vfdDf~AVaedLi~rgitspe~lgi~GGSNGGLLvg~alTQrPelfgA~v~-eV-Pll---DMl---RYh~--l  543 (648)
T COG1505         474 KENKQNVFDDFIAVAEDLIKRGITSPEKLGIQGGSNGGLLVGAALTQRPELFGAAVC-EV-PLL---DML---RYHL--L  543 (648)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCCCCEEEEEEECCCHHHHCCEEE-CC-CHH---HHH---HHCC--C
T ss_conf             403201367799999999981899878962005777764676663148144182443-56-306---654---3401--5


Q ss_pred             CCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCCC--
Q ss_conf             1111000011100000000347665413567776541012200121003576069984788878807--999996799--
Q gi|254780166|r  152 LPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPS--  227 (261)
Q Consensus       152 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p~--  227 (261)
                      .           .....+.+.....+++...........++...-  +.=-|+|+-++..|..|.|+  ..+++.+..  
T Consensus       544 ~-----------aGasW~~EYG~Pd~P~d~~~l~~YSPy~nl~~g--~kYP~~LITTs~~DDRVHPaHArKfaa~L~e~~  610 (648)
T COG1505         544 T-----------AGSSWIAEYGNPDDPEDRAFLLAYSPYHNLKPG--QKYPPTLITTSLHDDRVHPAHARKFAAKLQEVG  610 (648)
T ss_pred             C-----------CCHHHHHHCCCCCCHHHHHHHHHCCCHHCCCCC--CCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             6-----------660137551898987898998863943117765--557975787035556516068899999998538


Q ss_pred             CE--EEEECCCCCCCCCCCHH---HHHHHHHHHHHHCC
Q ss_conf             79--99988887384348489---99999999875168
Q gi|254780166|r  228 SQ--YLNICRRDHLLAVGDKQ---FKQGVVNFYANELR  260 (261)
Q Consensus       228 ~~--~~~i~~~gH~~~~e~p~---~~~~i~~Fl~~~~~  260 (261)
                      +.  +.+=-++||..--.+.+   ....+..||.+.|.
T Consensus       611 ~pv~~~e~t~gGH~g~~~~~~~A~~~a~~~afl~r~L~  648 (648)
T COG1505         611 APVLLREETKGGHGGAAPTAEIARELADLLAFLLRTLG  648 (648)
T ss_pred             CCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             96599952477656789757889999999999998619


No 113
>pfam03583 LIP Secretory lipase. These lipases are expressed and secreted during the infection cycle of these pathogens. In particular, C. albicans has a large number of different lipases, possibly reflecting broad lipolytic activity, which may contribute to the persistence and virulence of C. albicans in human tissue.
Probab=98.26  E-value=5.2e-06  Score=54.80  Aligned_cols=55  Identities=15%  Similarity=0.261  Sum_probs=36.8

Q ss_pred             CCCEEEEEECCCCCCCCH--HHHHHH-C----CCCEEEEECCCCCCCCC--CCHHHHHHHHHHH
Q ss_conf             576069984788878807--999996-7----99799998888738434--8489999999998
Q gi|254780166|r  201 DVPVLIAVGSQDDLAGSP--QELMSF-I----PSSQYLNICRRDHLLAV--GDKQFKQGVVNFY  255 (261)
Q Consensus       201 ~~P~l~i~G~~D~~~~~~--~~l~~~-~----p~~~~~~i~~~gH~~~~--e~p~~~~~i~~Fl  255 (261)
                      +.|+++.+|..|.++|..  +++.+. +    .+.++...+..+|+...  ..|.....+.+=|
T Consensus       220 ~~Pv~i~~g~~D~vvP~~~~~~l~~~~Ca~G~a~V~~~~~~~~~H~~~~~~~~~~a~~wl~dRf  283 (291)
T pfam03583       220 QIPVFVYHGTHDEIVPIADIDALYKNWCAWGIASVEFAEDLSNGHFTEALVGAPAALTWLDDRF  283 (291)
T ss_pred             CCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHCCCHHHHHHHHHHH
T ss_conf             9998988668886336289999999999769983799868998546577536578999999997


No 114
>KOG3253 consensus
Probab=98.25  E-value=2.5e-05  Score=50.76  Aligned_cols=163  Identities=19%  Similarity=0.254  Sum_probs=94.3

Q ss_pred             CCCEEEEECCCC---CCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCC
Q ss_conf             987899998788---880012217999999986898999964765542222222222221222222----2222222222
Q gi|254780166|r   25 DAPTILLIHGLA---SSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD----AVSLLEHLGI   97 (261)
Q Consensus        25 ~~~~vv~iHG~~---~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~d----i~~~i~~l~~   97 (261)
                      ..|.+|++||.+   .+.+..|.|........ +--.+-++|++--  .++  .....-.+.++.-    +.++--++..
T Consensus       175 ~spl~i~aps~p~ap~tSd~~~~wqs~lsl~g-evvev~tfdl~n~--igG--~nI~h~ae~~vSf~r~kvlei~gefph  249 (784)
T KOG3253         175 ASPLAIKAPSTPLAPKTSDRMWSWQSRLSLKG-EVVEVPTFDLNNP--IGG--ANIKHAAEYSVSFDRYKVLEITGEFPH  249 (784)
T ss_pred             CCCEEEECCCCCCCCCCCHHHHHHHHHHHHHC-EEEEECCCCCCCC--CCC--CCHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             77317962688878766357776999875420-0210002455677--777--234888888777765433322033789


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCC-CCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCC
Q ss_conf             22222344344431013332102-35652389628856331103569999998631111000011100000000347665
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFYP-SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGN  176 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~p-~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  176 (261)
                      .+++|+|.|||+.++.+...... ..|+.+|=++-  .+.....                    +.              
T Consensus       250 a~IiLvGrsmGAlVachVSpsnsdv~V~~vVCigy--pl~~vdg--------------------pr--------------  293 (784)
T KOG3253         250 APIILVGRSMGALVACHVSPSNSDVEVDAVVCIGY--PLDTVDG--------------------PR--------------  293 (784)
T ss_pred             CCEEEEECCCCCEEEEEECCCCCCCEEEEEEEECC--CCCCCCC--------------------CC--------------
T ss_conf             85588742447301687512567734789997156--3567776--------------------66--------------


Q ss_pred             CHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCC-CCEEEEECCCCCCCCC
Q ss_conf             41356777654101220012100357606998478887880--799999679-9799998888738434
Q gi|254780166|r  177 DLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIP-SSQYLNICRRDHLLAV  242 (261)
Q Consensus       177 ~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p-~~~~~~i~~~gH~~~~  242 (261)
                                    ....+.+-.+..|+|++.|.+|.++++  .+++++.+. ..++++|.+++|-.-+
T Consensus       294 --------------girDE~Lldmk~PVLFV~Gsnd~mcspn~ME~vreKMqA~~elhVI~~adhsmai  348 (784)
T KOG3253         294 --------------GIRDEALLDMKQPVLFVIGSNDHMCSPNSMEEVREKMQAEVELHVIGGADHSMAI  348 (784)
T ss_pred             --------------CCCCHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             --------------8862566741796699836875667988999999986255169996577744247


No 115
>pfam04301 DUF452 Protein of unknown function (DUF452).
Probab=98.23  E-value=3.3e-05  Score=50.07  Aligned_cols=183  Identities=15%  Similarity=0.157  Sum_probs=87.1

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHH-HHCCCEE-EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             878999987888800122179999999-8689899-99647655422222222222212222222222222222222223
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLL-CDQGFRV-IAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVM  103 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l-~~~g~~v-i~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~li  103 (261)
                      +.-|||.-|||++..   .    +.+| .+++|.+ +++|+|..-        .++       |      .-+.+.+.||
T Consensus        11 ~~LiLfF~GWg~~~~---~----f~hL~~p~~~D~l~~yDYr~l~--------~d~-------d------~s~Y~~i~Lv   62 (213)
T pfam04301        11 DHLILYFAGWGTPPD---A----VEHLILPENHDLCICYDYQDLH--------CDF-------D------FSAYQHIRLV   62 (213)
T ss_pred             CEEEEEEECCCCCHH---H----HHHHCCCCCCEEEEEECCCCCC--------CCC-------C------CCCCCEEEEE
T ss_conf             759999816789978---9----8663367786499991466676--------654-------6------0128768999


Q ss_pred             CCCCCCCCHHHHHHHCCCCCCCEEEECCCC-CCCCC---CHHHHHHHHHHHHCCCCCHHHHHH---HHHHCCCCCCCCCC
Q ss_conf             443444310133321023565238962885-63311---035699999986311110000111---00000000347665
Q gi|254780166|r  104 GYSMGARIACSMVLFYPSYVRSVILGGVGS-VLYDS---DVVDWQSLIDSFLLPSIDEVQNPL---GKKFRKFADLDPGN  176 (261)
Q Consensus       104 GhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~-~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~  176 (261)
                      ++|||-.+|.++....  .+++-|.++..+ .+...   ....+....+.+............   ...+..+....+..
T Consensus        63 AWSmGVwaA~~~l~~~--~~~~aiAiNGT~~Pid~~~GIpp~iF~~Tl~~l~e~~~~rF~RRmcg~~~~~~~f~~~~~~~  140 (213)
T pfam04301        63 AWSMGVWAAERALQGI--PLKSATAINGTGLPCDDNFGIPCAIFAGTLEGLNEDNRLKFERRICGDKALFEDYQHFPARP  140 (213)
T ss_pred             EEEHHHHHHHHHHCCC--CCCEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCHHHHHHCCCCCC
T ss_conf             9775999999875148--86405898088887566779798999999840899999999987327810677876068899


Q ss_pred             CHHHHHHHHHHHCC---CCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCC
Q ss_conf             41356777654101---2200121003576069984788878807999996799799998888738434
Q gi|254780166|r  177 DLKALASCLSMIRK---PFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV  242 (261)
Q Consensus       177 ~~~~~~~~~~~~~~---~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~~~~~~i~~~gH~~~~  242 (261)
                      ....+.+-+.....   .+.....-..   .-++.|.+|.+.|+..+....-+.+++.++ +++|+++.
T Consensus       141 ~~~d~~eEL~~l~~~~~~~~~~~~~~W---d~aiIg~~D~IFp~~nQ~~~W~~~~~i~ei-~~pHypF~  205 (213)
T pfam04301       141 TFGEIHAELIALFAFIGQDRRTDLIRW---SKAIVGSGDKIFMAANQHAYWQDRCAIREI-AGEHLLFP  205 (213)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCC---CEEEECCCCEEECHHHHHHHHHCCCCEEEE-CCCCCCCC
T ss_conf             989999999999997504577776666---677855997772789999986177857994-48876501


No 116
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only]
Probab=98.21  E-value=1.4e-05  Score=52.17  Aligned_cols=201  Identities=16%  Similarity=0.126  Sum_probs=105.4

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCC-----EEEEECCCCC----CCCCCCCC---------CCCCCCCCCC
Q ss_conf             9987899998788880012217999999986898-----9999647655----42222222---------2222212222
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGF-----RVIAFDNLGH----GKSDKSYI---------ENDYRLVFMA   85 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~-----~vi~~D~~G~----G~S~~~~~---------~~~~s~~~~~   85 (261)
                      +...|.|||||++|++.+   .+..+..|.+++-     -++..|--|-    |.=++...         +..-+..++.
T Consensus        43 ~~~iPTIfIhGsgG~asS---~~~Mv~ql~~~~~~~~e~Lt~~V~~dgslk~tGk~~Kd~~nP~I~~gfe~n~~s~~~~s  119 (288)
T COG4814          43 KVAIPTIFIHGSGGTASS---LNGMVNQLLPDYKAGTESLTMTVDVDGSLKVTGKISKDAKNPIIEFGFEDNTASGLDQS  119 (288)
T ss_pred             CCCCCEEEEECCCCCHHH---HHHHHHHHHHCCCCCCCCEEEEECCCCCEEEEEEECCCCCCCEEEEEEECCCCCHHHHH
T ss_conf             666646999658887067---88999986340133456569998178837885661345778718999863867624578


Q ss_pred             CCCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHCCC-----CCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCC
Q ss_conf             222222222----222222223443444310133321023-----56523896288563311035699999986311110
Q gi|254780166|r   86 ADAVSLLEH----LGISKVHVMGYSMGARIACSMVLFYPS-----YVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID  156 (261)
Q Consensus        86 ~di~~~i~~----l~~~~~~liGhS~Gg~ia~~~a~~~p~-----~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~  156 (261)
                      ..+..++.+    .+++++.++||||||.-...|+..+.+     .+.++|.++..........   .........    
T Consensus       120 ~wlk~~msyL~~~Y~i~k~n~VGhSmGg~~~~~Y~~~yg~dks~P~lnK~V~l~gpfN~~~l~~---de~v~~v~~----  192 (288)
T COG4814         120 KWLKKAMSYLQKHYNIPKFNAVGHSMGGLGLTYYMIDYGDDKSLPPLNKLVSLAGPFNVGNLVP---DETVTDVLK----  192 (288)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCCCCCCHHHEEEECCCCCCCCCCC---CCCHHEEEC----
T ss_conf             9999999999975698601031005652778999998657777845222378524333455577---763210221----


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCC--CCCEEEEEECCCC------CCCCH--HHHHHHCC
Q ss_conf             00011100000000347665413567776541012200121003--5760699847888------78807--99999679
Q gi|254780166|r  157 EVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRI--DVPVLIAVGSQDD------LAGSP--QELMSFIP  226 (261)
Q Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i--~~P~l~i~G~~D~------~~~~~--~~l~~~~p  226 (261)
                                     ..++.....+..++        .....++  .+-+|+|.|+.|.      .+|-+  ..+...++
T Consensus       193 ---------------~~~~~~~t~y~~y~--------~~n~k~v~~~~evl~IaGDl~dg~~tDG~Vp~assls~~~lf~  249 (288)
T COG4814         193 ---------------DGPGLIKTPYYDYI--------AKNYKKVSPNTEVLLIAGDLDDGKQTDGAVPWASSLSIYHLFK  249 (288)
T ss_pred             ---------------CCCCCCCCHHHHHH--------HHCCEECCCCCEEEEEECCCCCCCCCCCCEECHHHHHHHHHHC
T ss_conf             ---------------58643376789999--------8436357998479997413466886787211237678999866


Q ss_pred             C---CE---EEEECCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9---79---9998888738434848999999999875
Q gi|254780166|r  227 S---SQ---YLNICRRDHLLAVGDKQFKQGVVNFYAN  257 (261)
Q Consensus       227 ~---~~---~~~i~~~gH~~~~e~p~~~~~i~~Fl~~  257 (261)
                      +   +=   +..=+++-|--+-|+|.+.+.+..||-+
T Consensus       250 ~~~ksy~e~~~~Gk~a~Hs~lhen~~v~~yv~~FLw~  286 (288)
T COG4814         250 KNGKSYIESLYKGKDARHSKLHENPTVAKYVKNFLWE  286 (288)
T ss_pred             CCCCEEEEEEEECCCCHHHCCCCCHHHHHHHHHHHHC
T ss_conf             5864147776307763010167883589999988406


No 117
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase; InterPro: IPR014186   This entry describes proteins from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (3.1.2.12 from EC). Eukaryotic members, particularly the human protein, are better known as esterase D (3.1.1.1 from EC), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well..
Probab=98.20  E-value=2.4e-06  Score=56.78  Aligned_cols=103  Identities=19%  Similarity=0.245  Sum_probs=71.8

Q ss_pred             EEE-EECCCCCCCHHHHHHHHHHHHH-HHCCCEEEEECCCCCCCCCCCC--------------------CCCCCCCCCC-
Q ss_conf             899-9987888800122179999999-8689899996476554222222--------------------2222221222-
Q gi|254780166|r   28 TIL-LIHGLASSVQTNWLFSGWIQLL-CDQGFRVIAFDNLGHGKSDKSY--------------------IENDYRLVFM-   84 (261)
Q Consensus        28 ~vv-~iHG~~~~~~~~~~~~~~~~~l-~~~g~~vi~~D~~G~G~S~~~~--------------------~~~~~s~~~~-   84 (261)
                      ||| +|-|.+++.+.. +.|.-++.+ ++.|.-+|+||--=-|.+-..+                    -...|.+..+ 
T Consensus        44 PvL~yLsGLTCT~en~-m~Kag~~R~AAe~G~aLVaPDTSPR~~gi~gE~D~wDfG~GAGFYvDAt~~PWs~hYRmysYv  122 (279)
T TIGR02821        44 PVLYYLSGLTCTEENF-MIKAGAQRFAAEYGLALVAPDTSPRGTGIAGEDDEWDFGKGAGFYVDATEEPWSQHYRMYSYV  122 (279)
T ss_pred             CEEEECCCCCHHHHHH-HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCHHHHCCCCHHHH
T ss_conf             2331000013115789-987778999976890797267898777776786542147987521102201233207023558


Q ss_pred             CCCCCCCCCC-C--CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECC
Q ss_conf             2222222222-2--222222234434443101333210235652389628
Q gi|254780166|r   85 AADAVSLLEH-L--GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV  131 (261)
Q Consensus        85 ~~di~~~i~~-l--~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~  131 (261)
                      +.+|.+|++. +  +-++--|.||||||.=|+..|.++|++.+++-..+|
T Consensus       123 ~~ELpal~~~~fPld~~r~GI~GHSMGGhGAL~~AlknP~~fkSVSAFAP  172 (279)
T TIGR02821       123 VQELPALVAAQFPLDGERQGITGHSMGGHGALVIALKNPDRFKSVSAFAP  172 (279)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEECCCCC
T ss_conf             88999999985892201160135555467999998618873133124112


No 118
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=98.20  E-value=1.3e-06  Score=58.42  Aligned_cols=109  Identities=13%  Similarity=0.153  Sum_probs=66.8

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             998789999878888001221799999998689899996476554222---22222222212222222222222222222
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD---KSYIENDYRLVFMAADAVSLLEHLGISKV  100 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~---~~~~~~~~s~~~~~~di~~~i~~l~~~~~  100 (261)
                      .++..+||+|||.-+.+..-.-..++-+-......++.+.+|-.|.--   .+.....||-....+-+..+.+....+++
T Consensus       114 ~~k~vlvFvHGfNntf~dav~R~aqI~~d~g~~~~pVvFSWPS~g~l~~Yn~DreS~~~Sr~aLe~~lr~La~~~~~~~I  193 (377)
T COG4782         114 SAKTVLVFVHGFNNTFEDAVYRTAQIVHDSGNDGVPVVFSWPSRGSLLGYNYDRESTNYSRPALERLLRYLATDKPVKRI  193 (377)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79859999802587355778999988763189820699974788732000145556553389999999999747888628


Q ss_pred             CCCCCCCCCCCHHHHHHH--------CCCCCCCEEEECCC
Q ss_conf             223443444310133321--------02356523896288
Q gi|254780166|r  101 HVMGYSMGARIACSMVLF--------YPSYVRSVILGGVG  132 (261)
Q Consensus       101 ~liGhS~Gg~ia~~~a~~--------~p~~v~~lvl~~~~  132 (261)
                      ++++||||.++.++...+        -+.+++-+||.++.
T Consensus       194 ~ilAHSMGtwl~~e~LrQLai~~~~~l~~ki~nViLAaPD  233 (377)
T COG4782         194 YLLAHSMGTWLLMEALRQLAIRADRPLPAKIKNVILAAPD  233 (377)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHEEEECCC
T ss_conf             9998544279999999998446874322566514861788


No 119
>pfam07224 Chlorophyllase Chlorophyllase. This family consists of several plant specific Chlorophyllase proteins (EC:3.1.1.14). Chlorophyllase (Chlase) is the first enzyme involved in chlorophyll (Chl) degradation and catalyses the hydrolysis of ester bond to yield chlorophyllide and phytol.
Probab=98.20  E-value=2.3e-06  Score=56.98  Aligned_cols=92  Identities=23%  Similarity=0.260  Sum_probs=57.3

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCC-------CC
Q ss_conf             9878999987888800122179999999868989999647655422222222222-212222222222222-------22
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY-RLVFMAADAVSLLEH-------LG   96 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~-s~~~~~~di~~~i~~-------l~   96 (261)
                      .-|.++|+||+...   +..|..++++.+.+||=|+++-+-.-  +..|....++ +....++++-.=+..       -+
T Consensus        45 ~YPV~lFlHG~~l~---NsfYsqll~HIaSHGfIvVAPQly~i--~~~p~~~~EI~~aa~V~nWL~~GL~~~LP~~V~pd  119 (307)
T pfam07224        45 TYPVVLFLHGTMLS---NEFYSLFFNHIASHGFIVVAPQLYRL--FPPPSQQDEIDSAAEVANWLPLGLQVVLPTGVEAN  119 (307)
T ss_pred             CCCEEEEECCCEEC---CHHHHHHHHHHHCCCEEEECCEEEEC--CCCCCCCHHHHHHHHHHHHHHHCCHHHCCCCCCCC
T ss_conf             64179985042212---26899999987606508984510013--58988607888899998777630542388765767


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHCCC
Q ss_conf             2222223443444310133321023
Q gi|254780166|r   97 ISKVHVMGYSMGARIACSMVLFYPS  121 (261)
Q Consensus        97 ~~~~~liGhS~Gg~ia~~~a~~~p~  121 (261)
                      ++|+.|.|||.||-+|..+|..+..
T Consensus       120 l~klalaGHSRGGktAFalALG~~~  144 (307)
T pfam07224       120 LSKLALSGHSRGGKTAFALALGYSL  144 (307)
T ss_pred             HHHEEEECCCCCCHHHHHHHHCCCC
T ss_conf             1120331247743879999851356


No 120
>pfam05057 DUF676 Putative serine esterase (DUF676). This family of proteins are probably serine esterase type enzymes with an alpha/beta hydrolase fold.
Probab=98.18  E-value=4.1e-06  Score=55.42  Aligned_cols=87  Identities=16%  Similarity=0.195  Sum_probs=47.8

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC
Q ss_conf             7899998788880012217999999986898999964765542222222222221222222222222222-222222344
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG-ISKVHVMGY  105 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~-~~~~~liGh  105 (261)
                      =-|||+||+.|+..+...++..+..-.+.. .++..-..+.+  .++.+.-+.--+..++++.+.++... ..++.+|||
T Consensus         6 HLvVlvHGl~G~~~dm~~l~~~l~~~~~~~-~~~~~~~~~n~--~~T~dGI~~~G~Rla~EI~~~i~~~~~~~kISfIGh   82 (212)
T pfam05057         6 HLVVLVHGLWGNSADMEYIAEQLEKDLPDP-LIVVLMSSNNQ--GKTFDGIDVMGERLANEVLEFVQDKSDKKKISFVGH   82 (212)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCC-EEEEEECCCCC--CCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             899995888699999999999999878997-79998246778--715248999999999999999984688745999964


Q ss_pred             CCCCCCHHHHH
Q ss_conf             34443101333
Q gi|254780166|r  106 SMGARIACSMV  116 (261)
Q Consensus       106 S~Gg~ia~~~a  116 (261)
                      |+||.++..++
T Consensus        83 SLGGLi~RyAl   93 (212)
T pfam05057        83 SLGGLIARSAI   93 (212)
T ss_pred             CHHHHHHHHHH
T ss_conf             42479999999


No 121
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular; InterPro: IPR010915   This entry represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting..
Probab=98.17  E-value=2.9e-06  Score=56.30  Aligned_cols=227  Identities=19%  Similarity=0.156  Sum_probs=132.2

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             87899998788880012217999999986898999964765542222222222221222222222222222222222344
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGY  105 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGh  105 (261)
                      .|.|+.+=-..|++  .+.....++.|.+. ..|+.-|+-.-  -.-|.....|+++|+++-|.++|+.+|-+++++|+-
T Consensus       109 dp~vLiVAPmSGHy--ATLLR~TV~aLLP~-~dVYiTDW~~A--R~VPl~aG~FD~~DYIdY~ief~~~lGp~r~hV~aV  183 (414)
T TIGR01849       109 DPKVLIVAPMSGHY--ATLLRSTVEALLPD-HDVYITDWVDA--RMVPLEAGKFDLEDYIDYLIEFLRFLGPDRIHVVAV  183 (414)
T ss_pred             CCCEEEECCCHHHH--HHHHHHHHHHHCCC-CCEEEECCCCC--CCCCHHHCCCCHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             87127856741256--66556789985789-96788631401--603050086433568999999999718897637887


Q ss_pred             CCCCCCHHHHH-----HHCCCCCCCEEEECCCCCCCCCCHHHHH----HHHHHHHCCCCCHH------------------
Q ss_conf             34443101333-----2102356523896288563311035699----99998631111000------------------
Q gi|254780166|r  106 SMGARIACSMV-----LFYPSYVRSVILGGVGSVLYDSDVVDWQ----SLIDSFLLPSIDEV------------------  158 (261)
Q Consensus       106 S~Gg~ia~~~a-----~~~p~~v~~lvl~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~------------------  158 (261)
                      +.=+-..+.++     ...|..-++|||+|.+.....+.....+    +-++-+..+.+-.+                  
T Consensus       184 CQP~vPvLAA~aLmae~~~P~~P~sm~lmGGPIDaR~~PT~VN~lA~~~~~eWF~~n~i~~VP~~YpG~GR~VYPGFlQL  263 (414)
T TIGR01849       184 CQPAVPVLAAVALMAENEEPAQPRSMTLMGGPIDARASPTVVNELAKEKPIEWFQENLIMRVPFPYPGAGRKVYPGFLQL  263 (414)
T ss_pred             ECCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCHHHHHHHCCCCHHHHHHCCEEECCCCCCCCCCCCCCHHHHH
T ss_conf             46845799999998745788888405762777664555213443001267278853876408426777885437138888


Q ss_pred             H-------HHHHHH------------------HCCCCCCCCCC---CHHHHHHHHHH-HCCCCC----------HHHHHC
Q ss_conf             0-------111000------------------00000347665---41356777654-101220----------012100
Q gi|254780166|r  159 Q-------NPLGKK------------------FRKFADLDPGN---DLKALASCLSM-IRKPFC----------QDDLYR  199 (261)
Q Consensus       159 ~-------~~~~~~------------------~~~~~~~~~~~---~~~~~~~~~~~-~~~~~~----------~~~l~~  199 (261)
                      .       +...+.                  .+.|.+++...   .-+.|+..... +.++..          +=+++.
T Consensus       264 agF~SmN~dRH~~aH~~~~~~LvkgDg~~Ad~H~~FYDEYLaVmDmtAEFYLqTi~~VF~q~~Lp~G~~~~~G~rVd~~~  343 (414)
T TIGR01849       264 AGFISMNLDRHVKAHKDFFAHLVKGDGDEADKHRKFYDEYLAVMDMTAEFYLQTIDVVFQQFLLPKGKFIVEGKRVDPKA  343 (414)
T ss_pred             HHHHHHCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCEEECCEEECHHH
T ss_conf             86884065667999999999862375257788876312453205450344554899998653144771678874316434


Q ss_pred             CC-CCEEEEEECCCCCCCCH-----HHHHHHCCCC--EEEEECCCCCCCCCCCH----HHHHHHHHHHHH
Q ss_conf             35-76069984788878807-----9999967997--99998888738434848----999999999875
Q gi|254780166|r  200 ID-VPVLIAVGSQDDLAGSP-----QELMSFIPSS--QYLNICRRDHLLAVGDK----QFKQGVVNFYAN  257 (261)
Q Consensus       200 i~-~P~l~i~G~~D~~~~~~-----~~l~~~~p~~--~~~~i~~~gH~~~~e~p----~~~~~i~~Fl~~  257 (261)
                      |+ +=+|-|=||+|.+....     ..|+..||.+  +..+-|++||...+.-.    ++.=.|.+|+.+
T Consensus       344 It~~ALltvEGEnDDIsg~GQT~AA~~LCtgIpe~~k~~~~~pgvGHYGvF~GsrfR~~I~P~v~~FI~~  413 (414)
T TIGR01849       344 ITKVALLTVEGENDDISGLGQTKAALKLCTGIPEDMKRHYLQPGVGHYGVFSGSRFREEIYPRVREFIRR  413 (414)
T ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCHHHHHHHC
T ss_conf             1345434432652233740378999984379876887751568873135436840011366068998741


No 122
>KOG4627 consensus
Probab=98.16  E-value=8.6e-06  Score=53.53  Aligned_cols=182  Identities=14%  Similarity=0.082  Sum_probs=102.4

Q ss_pred             EEEEC-CCCCCEEEEECCCC---CCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             99964-89987899998788---88001221799999998689899996476554222222222222122222222222-
Q gi|254780166|r   18 FYDVG-DKDAPTILLIHGLA---SSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLL-   92 (261)
Q Consensus        18 y~~~g-~~~~~~vv~iHG~~---~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i-   92 (261)
                      .-.+| .-..+.+|||||.-   ++..   .....+..+..+||+|...++   +.+     ++..+++....|....+ 
T Consensus        58 VDIwg~~~~~klfIfIHGGYW~~g~rk---~clsiv~~a~~~gY~vasvgY---~l~-----~q~htL~qt~~~~~~gv~  126 (270)
T KOG4627          58 VDIWGSTNQAKLFIFIHGGYWQEGDRK---MCLSIVGPAVRRGYRVASVGY---NLC-----PQVHTLEQTMTQFTHGVN  126 (270)
T ss_pred             EEEECCCCCCCEEEEEECCHHHCCCHH---CCCCHHHHHHHCCEEEEEECC---CCC-----CCCCCHHHHHHHHHHHHH
T ss_conf             987657777608999936613307521---030201156646707998346---767-----653329999999997788


Q ss_pred             ---CCC-CCCCCCCCCCCCCCCCHHHHHHH-CCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHC
Q ss_conf             ---222-22222223443444310133321-0235652389628856331103569999998631111000011100000
Q gi|254780166|r   93 ---EHL-GISKVHVMGYSMGARIACSMVLF-YPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFR  167 (261)
Q Consensus        93 ---~~l-~~~~~~liGhS~Gg~ia~~~a~~-~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  167 (261)
                         +.. +.+++.+-|||-|+-+++....+ +.-||.+++|.+....+.+-  .      . ....      ..+.-   
T Consensus       127 filk~~~n~k~l~~gGHSaGAHLa~qav~R~r~prI~gl~l~~GvY~l~EL--~------~-te~g------~dlgL---  188 (270)
T KOG4627         127 FILKYTENTKVLTFGGHSAGAHLAAQAVMRQRSPRIWGLILLCGVYDLREL--S------N-TESG------NDLGL---  188 (270)
T ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH--H------C-CCCC------CCCCC---
T ss_conf             999865664269982552688999999987408257889887437639987--2------7-7632------21375---


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCC--CCHHHHHHHCCCCEEEEECCCCCCCCCC
Q ss_conf             000347665413567776541012200121003576069984788878--8079999967997999988887384348
Q gi|254780166|r  168 KFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA--GSPQELMSFIPSSQYLNICRRDHLLAVG  243 (261)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~--~~~~~l~~~~p~~~~~~i~~~gH~~~~e  243 (261)
                              + .+...     ....+. ..+..++.|+|++.|+.|...  ...+.+++....+++.++++.+|+-.++
T Consensus       189 --------t-~~~ae-----~~Scdl-~~~~~v~~~ilVv~~~~espklieQnrdf~~q~~~a~~~~f~n~~hy~I~~  251 (270)
T KOG4627         189 --------T-ERNAE-----SVSCDL-WEYTDVTVWILVVAAEHESPKLIEQNRDFADQLRKASFTLFKNYDHYDIIE  251 (270)
T ss_pred             --------C-CCHHH-----HCCCCH-HHHCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHCCEEECCCCCHHHHHH
T ss_conf             --------5-00023-----237447-774186035667662246817888523689885012000137851454887


No 123
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family. Members of this protein family are bacterial lipoproteins largely from the Gammaproteobacteria. Characterized members are expressed in extracellularly and have esterase activity. Members include the lipase Pla-1 from Aeromonas hydrophila (AF092033) and CHO cell elongation factor (cef) from Vibrio hollisae
Probab=98.11  E-value=3.7e-06  Score=55.73  Aligned_cols=105  Identities=23%  Similarity=0.304  Sum_probs=64.0

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC----------CCCCC-----------CCCCC
Q ss_conf             8789999878888001221799999998689899996476554222222----------22222-----------21222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY----------IENDY-----------RLVFM   84 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~----------~~~~~-----------s~~~~   84 (261)
                      -|+||+.||.++..+..   ...+..++.+||-+|++|+|=||.-.-..          .+..|           .+++-
T Consensus       449 ~PvvIyqHGITs~Ke~a---~a~A~~la~ag~AtvAID~PLHGeR~~d~~~~~~~~t~~~~~~fiNL~~l~~aRDNlRQs  525 (792)
T TIGR03502       449 WPVVIYQHGITGAKENA---LAFAGTLAAAGVATIAIDHPLHGARSFDANASGVNATNANVLAYMNLASLLVARDNLRQS  525 (792)
T ss_pred             CCEEEEEECCCCCCHHH---HHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCHHHHHH
T ss_conf             84699985267750458---887543203755899825765665666877765435689843488766632211128888


Q ss_pred             CCCCCCCCCC----------------CCCCCCCCCCCCCCCCCHHHHHHHCCC-----------CCCCEEEECCCC
Q ss_conf             2222222222----------------222222223443444310133321023-----------565238962885
Q gi|254780166|r   85 AADAVSLLEH----------------LGISKVHVMGYSMGARIACSMVLFYPS-----------YVRSVILGGVGS  133 (261)
Q Consensus        85 ~~di~~~i~~----------------l~~~~~~liGhS~Gg~ia~~~a~~~p~-----------~v~~lvl~~~~~  133 (261)
                      +-|+..+.-.                +...+++++|||+||.++..+++....           .++...|..++.
T Consensus       526 v~DlL~LRasL~~~~~~~~~~~~~~~~d~skV~f~GhSLGgIvG~~f~a~AN~~~~~~~~~~lf~~~~asl~~pGG  601 (792)
T TIGR03502       526 ILDLLGLRLSLNGSALAGAPLSGINVIDGSKVSFLGHSLGGIVGTSFIAYANTPLGSPTADALYAVNAASLQNPGG  601 (792)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCC
T ss_conf             8998999998753211345445566566662169864212000536465415667887656553224688735885


No 124
>pfam02089 Palm_thioest Palmitoyl protein thioesterase.
Probab=98.09  E-value=2.9e-05  Score=50.36  Aligned_cols=105  Identities=13%  Similarity=0.165  Sum_probs=58.5

Q ss_pred             CCCCEEEEECCCCCCCHH---HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-C
Q ss_conf             998789999878888001---2217999999986898999964765542222222222221222222222222222-2-2
Q gi|254780166|r   24 KDAPTILLIHGLASSVQT---NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG-I-S   98 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~---~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~-~-~   98 (261)
                      ++--|||+.||.|.+.-.   ....+.+++... .|-.|+++++ |-+..+-....-.-.+.++++.+++.+.+.. + +
T Consensus         3 ~~p~PvViwHGlgDsc~~~~~m~~i~~~i~~~~-PG~~V~~i~i-g~~~~~D~~~s~f~~v~~Qv~~vc~~l~~~p~L~~   80 (279)
T pfam02089         3 PAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKEI-PGIHVLSLEI-GKNLMEDVENSFFLNVNSQVNMVCQILAKDPKLQQ   80 (279)
T ss_pred             CCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHC-CCCEEEEEEE-CCCCCHHHHCCCEECHHHHHHHHHHHHHHCHHHHC
T ss_conf             998858998468714568122899999999768-9938999996-89700442323000599999999999973956524


Q ss_pred             CCCCCCCCCCCCCHHHHHHHCCC-CCCCEEEEC
Q ss_conf             22223443444310133321023-565238962
Q gi|254780166|r   99 KVHVMGYSMGARIACSMVLFYPS-YVRSVILGG  130 (261)
Q Consensus        99 ~~~liGhS~Gg~ia~~~a~~~p~-~v~~lvl~~  130 (261)
                      -++++|+|.||.++..++.++|+ .|..+|-.+
T Consensus        81 G~n~IGfSQGgl~~R~~verc~~p~V~nlISlg  113 (279)
T pfam02089        81 GYNAIGFSQGGQFLRAVAQRCPSPPMMNLISVG  113 (279)
T ss_pred             CCCEEEECCCHHHHHHHHHHCCCCCCCEEEEEC
T ss_conf             756443654026666556545998732368706


No 125
>pfam12048 DUF3530 Protein of unknown function (DUF3530). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 272 to 336 amino acids in length. These proteins are distantly related to alpa/beta hydrolases so they may act as enzymes.
Probab=98.07  E-value=2.1e-05  Score=51.27  Aligned_cols=203  Identities=13%  Similarity=0.118  Sum_probs=115.3

Q ss_pred             CEEEEEECCCCEEEEEEEC--CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCC------
Q ss_conf             4079993499499999964--89987899998788880012217999999986898999964765542222222------
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVG--DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI------   75 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g--~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~------   75 (261)
                      +++.....|..-+..+..-  ....-.||++||.+.+++-.....++-..|.+.||+++.+.+|---....+..      
T Consensus        56 ev~~L~~g~~~flaL~~p~~~~~~~GavIil~~~g~~adwp~~i~~LR~~L~~~GW~TLSit~P~~~~~~~p~~~~~~~~  135 (294)
T pfam12048        56 EVKWLDAGDEKFLALWRPANTGKPQGAVIILPDTGETADWPGLIAPLRRELPDAGWATLSLTPPDPPSAAPPNRPTEAEE  135 (294)
T ss_pred             HHHHHHCCCEEEEEEEECCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             85033159845666761301788750599955899899847689999975650384378743798764457766677644


Q ss_pred             -----CCCCC-----------CCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHHCC-CCCCCEEEECCCCCC
Q ss_conf             -----22222-----------122222222222---2222222222344344431013332102-356523896288563
Q gi|254780166|r   76 -----ENDYR-----------LVFMAADAVSLL---EHLGISKVHVMGYSMGARIACSMVLFYP-SYVRSVILGGVGSVL  135 (261)
Q Consensus        76 -----~~~~s-----------~~~~~~di~~~i---~~l~~~~~~liGhS~Gg~ia~~~a~~~p-~~v~~lvl~~~~~~~  135 (261)
                           ....+           .+.+..-+.+++   ...+.++++|+||+.|+..+.+|.+..+ ..+..||++++....
T Consensus       136 ~~~~~~~~~~~~~~~~~~~~~~~~l~ari~a~~~~~~~~~~~~ivll~~G~gA~~a~~~l~~~~~~~~daLV~I~~~~p~  215 (294)
T pfam12048       136 VTKAGAKQLSSPSNEELLEAQEERLFARLEALIAFAQQYGGKNIVLLGQGTGAGWAIRYLAQKPSPAPDALVLISAYSPQ  215 (294)
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHCCCCCCCEEEEEECCCCC
T ss_conf             56766666677434455256799999999999999975788448999827718999999982898779869998178986


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             31103569999998631111000011100000000347665413567776541012200121003576069984788878
Q gi|254780166|r  136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA  215 (261)
Q Consensus       136 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~  215 (261)
                      ..                                                   ...+..+.+.++.+|+|=|++.+|...
T Consensus       216 ~~---------------------------------------------------~~~~L~~~la~l~iPvLDiy~~~~~~~  244 (294)
T pfam12048       216 SD---------------------------------------------------LNKALAEQLAQLALPVLDIYSADGNPA  244 (294)
T ss_pred             CC---------------------------------------------------CCHHHHHHHHHCCCCEEEEECCCCCHH
T ss_conf             43---------------------------------------------------255289887406887687566889989


Q ss_pred             CC--H-H--HHHHHCCC--CEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             80--7-9--99996799--7999988887384348489999999998751
Q gi|254780166|r  216 GS--P-Q--ELMSFIPS--SQYLNICRRDHLLAVGDKQFKQGVVNFYANE  258 (261)
Q Consensus       216 ~~--~-~--~l~~~~p~--~~~~~i~~~gH~~~~e~p~~~~~i~~Fl~~~  258 (261)
                      ..  + +  ..++...+  -+.+-+.+.-+...-++ ++.+.|.-|+...
T Consensus       245 ~~~~a~~R~~~a~r~~~~~Y~Q~~L~~~~~~~~~~~-~l~~rI~Gwl~~~  293 (294)
T pfam12048       245 SLQAAKQRKQAAKRAKKLDYRQIQLPLLPGNPSAWQ-ELLRRIRGWLKRL  293 (294)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEECCCCCCCHHHHH-HHHHHHHHHHHHC
T ss_conf             998699999999754899857866446889837899-9999999988612


No 126
>KOG3724 consensus
Probab=98.06  E-value=3.3e-06  Score=56.00  Aligned_cols=105  Identities=24%  Similarity=0.234  Sum_probs=56.0

Q ss_pred             CCCCEEEEEEEC---------CCCCCEEEEECCCCCCCHHHHHHHHHHHH-------------HHHCCCEEEEECCCC--
Q ss_conf             499499999964---------89987899998788880012217999999-------------986898999964765--
Q gi|254780166|r   11 WRKYQFAFYDVG---------DKDAPTILLIHGLASSVQTNWLFSGWIQL-------------LCDQGFRVIAFDNLG--   66 (261)
Q Consensus        11 ~dG~~l~y~~~g---------~~~~~~vv~iHG~~~~~~~~~~~~~~~~~-------------l~~~g~~vi~~D~~G--   66 (261)
                      .+.+.++.|.+|         +.++.||+||+|..||.........++..             .....|+..+.|+-+  
T Consensus        65 a~kY~LYLY~Egs~~~e~~~lelsGIPVLFIPGNAGSyKQvRSiAS~a~n~y~~~~~e~t~~~d~~~~~DFFaVDFnEe~  144 (973)
T KOG3724          65 ADKYSLYLYREGSRWWERSTLELSGIPVLFIPGNAGSYKQVRSIASVAQNAYQGGPFEKTEDRDNPFSFDFFAVDFNEEF  144 (973)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEEECCCCHH
T ss_conf             88427999635531022563567796189945888726778889999866540784555430147544416998565334


Q ss_pred             ---CCCCCCCCCCCCCCCCCCCCCCCCCCCC----C-C--------CCCCCCCCCCCCCCCHHHHHHHCCCCCCCE
Q ss_conf             ---5422222222222212222222222222----2-2--------222222344344431013332102356523
Q gi|254780166|r   67 ---HGKSDKSYIENDYRLVFMAADAVSLLEH----L-G--------ISKVHVMGYSMGARIACSMVLFYPSYVRSV  126 (261)
Q Consensus        67 ---~G~S~~~~~~~~~s~~~~~~di~~~i~~----l-~--------~~~~~liGhS~Gg~ia~~~a~~~p~~v~~l  126 (261)
                         ||.          ++.++++-+.+.|..    . +        -..++++||||||.||... ..+|..+.+.
T Consensus       145 tAm~G~----------~l~dQtEYV~dAIk~ILslYr~~~e~~~p~P~sVILVGHSMGGiVAra~-~tlkn~~~~s  209 (973)
T KOG3724         145 TAMHGH----------ILLDQTEYVNDAIKYILSLYRGEREYASPLPHSVILVGHSMGGIVARAT-LTLKNEVQGS  209 (973)
T ss_pred             HHHCCH----------HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCHHHHHHHH-HHHHHHCCCH
T ss_conf             442247----------6899999999999999998606655688999549998245132999999-8501101550


No 127
>KOG2237 consensus
Probab=98.01  E-value=2.4e-05  Score=50.92  Aligned_cols=229  Identities=18%  Similarity=0.128  Sum_probs=113.0

Q ss_pred             CEEEEEECCCCEEEEEEE-C-----CCCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC----
Q ss_conf             407999349949999996-4-----8998789999878-8880012217999999986898999964765542222----
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDV-G-----DKDAPTILLIHGL-ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK----   72 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~-g-----~~~~~~vv~iHG~-~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~----   72 (261)
                      +-.++.+.||.++.-... .     .++.|.++..+|. +-+..-+  |..--..|.++|+-....|.||=|+-..    
T Consensus       442 ~r~~~~SkDGt~VPM~Iv~kk~~k~dg~~P~LLygYGay~isl~p~--f~~srl~lld~G~Vla~a~VRGGGe~G~~WHk  519 (712)
T KOG2237         442 ERIEVSSKDGTKVPMFIVYKKDIKLDGSKPLLLYGYGAYGISLDPS--FRASRLSLLDRGWVLAYANVRGGGEYGEQWHK  519 (712)
T ss_pred             EEEEEECCCCCCCCEEEEEECHHHHCCCCCEEEEEECCCCEEECCC--CCCCEEEEEECCEEEEEEEECCCCCCCCCHHH
T ss_conf             9999745888764269998101443079964999854454240555--46112588816559999762367623400010


Q ss_pred             --CCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECC----CCCCCCCCHHHHH
Q ss_conf             --2222222212222222222222--2222222234434443101333210235652389628----8563311035699
Q gi|254780166|r   73 --SYIENDYRLVFMAADAVSLLEH--LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV----GSVLYDSDVVDWQ  144 (261)
Q Consensus        73 --~~~~~~~s~~~~~~di~~~i~~--l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~----~~~~~~~~~~~~~  144 (261)
                        .....-.++.++..-.+.+++.  ..-++..+.|.|-||.++...+..+|+++..+|+--+    ......+....| 
T Consensus       520 ~G~lakKqN~f~Dfia~AeyLve~gyt~~~kL~i~G~SaGGlLvga~iN~rPdLF~avia~VpfmDvL~t~~~tilplt-  598 (712)
T KOG2237         520 DGRLAKKQNSFDDFIACAEYLVENGYTQPSKLAIEGGSAGGLLVGACINQRPDLFGAVIAKVPFMDVLNTHKDTILPLT-  598 (712)
T ss_pred             CCCHHHHCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHCCCCHHHHHHHHCCCCEEHHHHHCCCCCCCC-
T ss_conf             5503431044888999999999758777222367514676626677761590676543116863002344025765560-


Q ss_pred             HHHHHHHCCCCCHHHHHHH-HHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCC-EEEEEECCCCCCCC---HH
Q ss_conf             9999863111100001110-0000000347665413567776541012200121003576-06998478887880---79
Q gi|254780166|r  145 SLIDSFLLPSIDEVQNPLG-KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVP-VLIAVGSQDDLAGS---PQ  219 (261)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P-~l~i~G~~D~~~~~---~~  219 (261)
                             ....+....+.. .++-++....+               ..+++.+-   .=| +|+.++++|..+++   .+
T Consensus       599 -------~sd~ee~g~p~~~~~~~~i~~y~p---------------v~~i~~q~---~YPS~lvtta~hD~RV~~~~~~K  653 (712)
T KOG2237         599 -------TSDYEEWGNPEDFEDLIKISPYSP---------------VDNIKKQV---QYPSMLVTTADHDDRVGPLESLK  653 (712)
T ss_pred             -------HHHHCCCCCHHHHHHHHEECCCCC---------------CCCCCHHC---CCCCEEEEECCCCCCCCCCCHHH
T ss_conf             -------666245698012114430055676---------------67771321---37614786112777524320578


Q ss_pred             ---HHHHHCCC-------CEEEEECCCCCCCCCCCH---HHHHHHHHHHHHHCC
Q ss_conf             ---99996799-------799998888738434848---999999999875168
Q gi|254780166|r  220 ---ELMSFIPS-------SQYLNICRRDHLLAVGDK---QFKQGVVNFYANELR  260 (261)
Q Consensus       220 ---~l~~~~p~-------~~~~~i~~~gH~~~~e~p---~~~~~i~~Fl~~~~~  260 (261)
                         .+.+...+       .=+.+-.++||+.---+.   +-.....+||+..+-
T Consensus       654 ~vAklre~~~~~~~q~~pvll~i~~~agH~~~~~~~k~~~E~a~~yaFl~K~~~  707 (712)
T KOG2237         654 WVAKLREATCDSLKQTNPVLLRIETKAGHGAEKPRFKQIEEAAFRYAFLAKMLN  707 (712)
T ss_pred             HHHHHHHHHHCCHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             999999986335201787799985388654677357887888999999998733


No 128
>PRK04940 hypothetical protein; Provisional
Probab=97.99  E-value=2.9e-05  Score=50.36  Aligned_cols=175  Identities=15%  Similarity=0.254  Sum_probs=91.3

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99998788880012217999999986898999964765542222222222221222222222222222222222344344
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMG  108 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~G  108 (261)
                      |+.+|||.++..+...=..+. .+.+.+.+.+.+-       .  ..+ .++++...+++..+++..+.+...++|.|+|
T Consensus         2 IlYlHGF~Sss~~~k~k~~q~-~fi~~dvr~i~~~-------t--~~P-~~d~~~ll~ev~k~i~~~~d~~~liiGssLG   70 (179)
T PRK04940          2 IIYLHGFDSTSPGNHEKVLQL-QFIDPDVRLISYS-------T--LHP-KHDMQHLLKEVDKMLQLSDDERPLICGVGLG   70 (179)
T ss_pred             EEEEECCCCCCCCCHHHHHHH-HHCCCCCCCCCCC-------C--CCC-CHHHHHHHHHHHHHHHHCCCCCCEEEECCCH
T ss_conf             799944678896329999999-7257565546678-------8--993-1209999999999998358788379954723


Q ss_pred             CCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             43101333210235652389628856331103569999998631111000011100000000347665413567776541
Q gi|254780166|r  109 ARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI  188 (261)
Q Consensus       109 g~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  188 (261)
                      |.-|..++.++.  +++ |+++|.  +.+....  +..+        +.   +  ..+   .+.        ...+...+
T Consensus        71 GyyA~~l~~~~~--~Ka-VliNPa--l~P~~~m--~~~i--------~~---p--eey---~di--------~~k~v~~f  119 (179)
T PRK04940         71 GYWAERIGFLCG--IRQ-VIFNPN--LFPEENM--EGKI--------DR---P--EEY---ADI--------ATKCVTNF  119 (179)
T ss_pred             HHHHHHHHHHCC--CCE-EEECCC--CCHHHHH--HHHH--------CC---C--CHH---HHH--------HHHHHHHH
T ss_conf             899999999829--867-998899--8804655--6550--------78---7--126---888--------88789998


Q ss_pred             CCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHCCCCEEEEE-CCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             012200121003576069984788878807999996799799998-8887384348489999999998
Q gi|254780166|r  189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNI-CRRDHLLAVGDKQFKQGVVNFY  255 (261)
Q Consensus       189 ~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~~~~~~i-~~~gH~~~~e~p~~~~~i~~Fl  255 (261)
                      +.        +-+-.+|++.-..|++...-+ .+..+...-.+++ +++.|-. ..=.+..+.|.+|.
T Consensus       120 r~--------kn~~~~LvlL~~gDEVLD~~~-~a~~l~~~~~Ii~d~gg~H~F-~~~~~~L~~I~~F~  177 (179)
T PRK04940        120 RE--------KNRDRCLVILSRNDEVLDSQR-TAEELHPYYEIVWDEEQTHKF-KNISPHLQRIKAFK  177 (179)
T ss_pred             HH--------CCCCCEEEEEECCCHHHHHHH-HHHHHCCCCEEEECCCCCCCC-CCHHHHHHHHHHHH
T ss_conf             61--------283038999855626660999-999845463588628998676-51999989999875


No 129
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional
Probab=97.98  E-value=3.2e-05  Score=50.15  Aligned_cols=210  Identities=14%  Similarity=0.105  Sum_probs=108.6

Q ss_pred             HHHHHCCCEEEEECCCCCCCCCCCCCCCCC----CCCCCCCCCCC----CCCC---------CCCCCCCCCCCCCCCCCH
Q ss_conf             999868989999647655422222222222----21222222222----2222---------222222223443444310
Q gi|254780166|r   50 QLLCDQGFRVIAFDNLGHGKSDKSYIENDY----RLVFMAADAVS----LLEH---------LGISKVHVMGYSMGARIA  112 (261)
Q Consensus        50 ~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~----s~~~~~~di~~----~i~~---------l~~~~~~liGhS~Gg~ia  112 (261)
                      .+|..+||-|+..+-.|-+.|++-......    +....++.+..    .-+.         ..-++|.+.|.|+-|.++
T Consensus       276 dYfl~RGfAvVy~~giGT~~SdG~~t~G~~~Et~s~kAVIdWLnGr~~AfT~r~~~~~vkA~WSnGkVaMtG~SYlGTL~  355 (769)
T PRK05371        276 DYFLARGFAVVYVSGIGTRGSDGCPTTGDPQEIEAMKAVIDWLNGRATAFTSRTRGHQVKADWSNGKVAMTGKSYLGTLP  355 (769)
T ss_pred             CEEECCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCCCH
T ss_conf             43440422899833677677888766699889778899999875886423567898468865237830025214244104


Q ss_pred             HHHHHHCCCCCCCEEEECCCCCCCC----CC---------HHHHHHHHHHHHCCCCCHHHH-HHHHHHCCCCCCCCCCCH
Q ss_conf             1333210235652389628856331----10---------356999999863111100001-110000000034766541
Q gi|254780166|r  113 CSMVLFYPSYVRSVILGGVGSVLYD----SD---------VVDWQSLIDSFLLPSIDEVQN-PLGKKFRKFADLDPGNDL  178 (261)
Q Consensus       113 ~~~a~~~p~~v~~lvl~~~~~~~~~----~~---------~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~  178 (261)
                      ..+|..--+=++-+|-+++.+.++.    ..         -.+.....+.......+.-.- .....+...........-
T Consensus       356 ~avATTGV~GLetIIpeAaISSWYdYYR~nGlV~aPgGyqGED~DvLa~~~~Sr~~~~~d~~~~~~~~~~~l~~~~~~~D  435 (769)
T PRK05371        356 TAVATTGVEGLKTIIPEAAISSWYDYYRENGLVRAPGGYQGEDLDVLAELTLSRNLLAGDYLRHNEACEKLLAELTAAQD  435 (769)
T ss_pred             HHHHHCCCCCCEEEEECCCCCCHHHHHHCCCCEECCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             46762487761466432101248988543881507888666422688887613445643122330789999999875045


Q ss_pred             HHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHCC---CCEEEEECCCCCCCCCCC--HHHHHHH
Q ss_conf             3567776541012200121003576069984788878807--99999679---979999888873843484--8999999
Q gi|254780166|r  179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIP---SSQYLNICRRDHLLAVGD--KQFKQGV  251 (261)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~p---~~~~~~i~~~gH~~~~e~--p~~~~~i  251 (261)
                      +....+...|..-+......+|++++++++|-+|.-|.+.  .++-+.++   --+-..+..++|.-+..-  -++.+.+
T Consensus       436 R~TGdYn~FW~~RNYl~~a~~iKa~vl~vHGLnDwNVKp~~v~~~~~AL~~~~v~~kl~LHQg~H~y~~~~~s~df~d~m  515 (769)
T PRK05371        436 RKTGDYNDFWDDRNYLKNADNIKADVLVVHGLNDWNVKPKQVYQWWDALPRNGVPKHLFLHQGQHVYPNNWQSIDFTDSM  515 (769)
T ss_pred             CCCCCCCHHHHHCCCCCCCCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHH
T ss_conf             56677431231025523200333028997436645768889999999998589971699815776897743320489999


Q ss_pred             HHHHHHHC
Q ss_conf             99987516
Q gi|254780166|r  252 VNFYANEL  259 (261)
Q Consensus       252 ~~Fl~~~~  259 (261)
                      -.||...|
T Consensus       516 N~Wfs~~L  523 (769)
T PRK05371        516 NAWLTHKL  523 (769)
T ss_pred             HHHHHHHH
T ss_conf             99998887


No 130
>KOG2112 consensus
Probab=97.96  E-value=1.4e-05  Score=52.29  Aligned_cols=174  Identities=18%  Similarity=0.225  Sum_probs=98.8

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC--CCCCCCCC--------------CCCCCCCCCC
Q ss_conf             8789999878888001221799999998689899996476554222--22222222--------------2122222222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD--KSYIENDY--------------RLVFMAADAV   89 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~--~~~~~~~~--------------s~~~~~~di~   89 (261)
                      ..+||++||.+.+...   |..++..+.-+..+-|++.-|=.-.+.  +..-+..|              ++...++-+.
T Consensus         3 ~atIi~LHglGDsg~~---~~~~~~~l~l~NiKwIcP~aP~rpvt~~~G~~~~aWfd~~~~~~~~~~d~~~~~~aa~~i~   79 (206)
T KOG2112           3 TATIIFLHGLGDSGSG---WAQFLKQLPLPNIKWICPTAPSRPVTLNGGAFMNAWFDIMELSSDAPEDEEGLHRAADNIA   79 (206)
T ss_pred             EEEEEEEECCCCCCCC---HHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCEECCEEECCCCCHHHHHHHHHHHHHH
T ss_conf             3799997348887754---8999970888870387678988762115887555200104207653111567889999999


Q ss_pred             CCCCCC---C--CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             222222---2--22222234434443101333210235652389628856331103569999998631111000011100
Q gi|254780166|r   90 SLLEHL---G--ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGK  164 (261)
Q Consensus        90 ~~i~~l---~--~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (261)
                      .++++.   +  ..++.+-|.|+||.+++..+..+|..+.+..-  .........                .....+...
T Consensus        80 ~Li~~e~~~Gi~~~rI~igGfs~G~a~aL~~~~~~~~~l~G~~~--~s~~~p~~~----------------~~~~~~~~~  141 (206)
T KOG2112          80 NLIDNEPANGIPSNRIGIGGFSQGGALALYSALTYPKALGGIFA--LSGFLPRAS----------------IGLPGWLPG  141 (206)
T ss_pred             HHHHHHHHCCCCCCCEEECCCCCHHHHHHHHHHCCCCCCCEEEC--CCCCCCCCH----------------HHCCCCCCC
T ss_conf             99998987599844516744374278899877214400123641--333256502----------------203677666


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH------HHHHHHCCCCEEEEECCCCC
Q ss_conf             000000347665413567776541012200121003576069984788878807------99999679979999888873
Q gi|254780166|r  165 KFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP------QELMSFIPSSQYLNICRRDH  238 (261)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~------~~l~~~~p~~~~~~i~~~gH  238 (261)
                                 .            .           ..|++..+|+.|+++|..      +.+......+++..+++.+|
T Consensus       142 -----------~------------~-----------~~~i~~~Hg~~d~~vp~~~g~~s~~~l~~~~~~~~f~~y~g~~h  187 (206)
T KOG2112         142 -----------V------------N-----------YTPILLCHGTADPLVPFRFGEKSAQFLKSLGVRVTFKPYPGLGH  187 (206)
T ss_pred             -----------C------------C-----------CCHHHEECCCCCCEEEHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             -----------6------------7-----------54120023567740032778888999997297346541698655


Q ss_pred             CCCCCCHHHHHHHHHHHHH
Q ss_conf             8434848999999999875
Q gi|254780166|r  239 LLAVGDKQFKQGVVNFYAN  257 (261)
Q Consensus       239 ~~~~e~p~~~~~i~~Fl~~  257 (261)
                      ..   -|+-.+.+..|+.+
T Consensus       188 ~~---~~~e~~~~~~~~~~  203 (206)
T KOG2112         188 ST---SPQELDDLKSWIKT  203 (206)
T ss_pred             CC---CHHHHHHHHHHHHH
T ss_conf             23---47999999999997


No 131
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=97.90  E-value=1.4e-05  Score=52.24  Aligned_cols=121  Identities=21%  Similarity=0.208  Sum_probs=70.4

Q ss_pred             CCCCEEEEEEEC----CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC-CCCCCCCC----
Q ss_conf             499499999964----899878999987888800122179999999868989999647655422222-22222221----
Q gi|254780166|r   11 WRKYQFAFYDVG----DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS-YIENDYRL----   81 (261)
Q Consensus        11 ~dG~~l~y~~~g----~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~-~~~~~~s~----   81 (261)
                      .+|.+..|.-+-    +.++|.||.+||.+++.....-...+-.....+||-|+.+|--  ..+-.+ .....+..    
T Consensus        42 ~~g~~r~y~l~vP~g~~~~apLvv~LHG~~~sgag~~~~sg~d~lAd~~gFlV~yPdg~--~~~wn~~~~~~~~~p~~~~  119 (312)
T COG3509          42 VNGLKRSYRLYVPPGLPSGAPLVVVLHGSGGSGAGQLHGTGWDALADREGFLVAYPDGY--DRAWNANGCGNWFGPADRR  119 (312)
T ss_pred             CCCCCCCEEEECCCCCCCCCCEEEEEECCCCCHHHHHCCCCHHHHHCCCCCEEECCCCC--CCCCCCCCCCCCCCCCCCC
T ss_conf             27875316897189889998779998368887678641355565524158679776766--6556887565568866444


Q ss_pred             --CCCCCCCCCCC----CCCCCC--CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCC
Q ss_conf             --22222222222----222222--22223443444310133321023565238962885
Q gi|254780166|r   82 --VFMAADAVSLL----EHLGIS--KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS  133 (261)
Q Consensus        82 --~~~~~di~~~i----~~l~~~--~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~  133 (261)
                        .+-+..|.+++    .+.+++  +|.+.|.|-||.++..++..+|+.+.++-.++...
T Consensus       120 ~g~ddVgflr~lva~l~~~~gidp~RVyvtGlS~GG~Ma~~lac~~p~~faa~A~VAg~~  179 (312)
T COG3509         120 RGVDDVGFLRALVAKLVNEYGIDPARVYVTGLSNGGRMANRLACEYPDIFAAIAPVAGLL  179 (312)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHHHCCCCCCCCEEEEECCC
T ss_conf             785078899999999877407674227998207578999998740754311201330456


No 132
>KOG1553 consensus
Probab=97.90  E-value=7.9e-06  Score=53.75  Aligned_cols=101  Identities=18%  Similarity=0.246  Sum_probs=66.1

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC--CCCCCC
Q ss_conf             878999987888800122179999999868989999647655422222222222212222222-22222222--222222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA-VSLLEHLG--ISKVHV  102 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di-~~~i~~l~--~~~~~l  102 (261)
                      ...|||.-|..|-.+     ......-++.||.|+-+++||++.|++..-+.  .....++-+ +-.|+.++  .+.+++
T Consensus       243 q~LvIC~EGNAGFYE-----vG~m~tP~~lgYsvLGwNhPGFagSTG~P~p~--n~~nA~DaVvQfAI~~Lgf~~edIil  315 (517)
T KOG1553         243 QDLVICFEGNAGFYE-----VGVMNTPAQLGYSVLGWNHPGFAGSTGLPYPV--NTLNAADAVVQFAIQVLGFRQEDIIL  315 (517)
T ss_pred             CEEEEEECCCCCCEE-----EEEECCHHHHCCEEECCCCCCCCCCCCCCCCC--CCHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             638999558765267-----64324768728424315788756667998764--10578899999999981898010699


Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCEEEECCCCC
Q ss_conf             34434443101333210235652389628856
Q gi|254780166|r  103 MGYSMGARIACSMVLFYPSYVRSVILGGVGSV  134 (261)
Q Consensus       103 iGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~  134 (261)
                      .|+|.||.-+.-+|+.||+ |+++||-++-..
T Consensus       316 ygWSIGGF~~~waAs~YPd-VkavvLDAtFDD  346 (517)
T KOG1553         316 YGWSIGGFPVAWAASNYPD-VKAVVLDATFDD  346 (517)
T ss_pred             EEEECCCCHHHHHHHCCCC-CEEEEEECCHHH
T ss_conf             9752078367778642887-417885031013


No 133
>COG0627 Predicted esterase [General function prediction only]
Probab=97.90  E-value=0.00011  Score=47.06  Aligned_cols=226  Identities=19%  Similarity=0.116  Sum_probs=104.7

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC--------------CCCCCCCCCCC-----C-CCCCCCC
Q ss_conf             98789999878888001221799999998689899996476--------------55422222222-----2-2221222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL--------------GHGKSDKSYIE-----N-DYRLVFM   84 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~--------------G~G~S~~~~~~-----~-~~s~~~~   84 (261)
                      +=|+++++||..++....+....+-....+.++-++++|-.              |-+.|-.....     . .|..+++
T Consensus        53 ~ipV~~~l~G~t~~~~~~~~~~g~~~~~~~~g~~~~~p~t~~~~~~~~~~vv~p~G~~~sfY~d~~~~~~~~~~~q~~tf  132 (316)
T COG0627          53 DIPVLYLLSGLTCNEPNVYLLDGLRRQADESGWAVVTPDTSPRGAGVNISVVMPLGGGASFYSDWTQPPWASGPYQWETF  132 (316)
T ss_pred             CCCEEEEECCCCCCCCCEEECCCHHHHHHHCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCHHHH
T ss_conf             98779981788889773366165444343168699657877555777765013568735500232456544564208899


Q ss_pred             -CCCCCCCCC-CCCC----CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCC-CCCH
Q ss_conf             -222222222-2222----22222344344431013332102356523896288563311035699999986311-1100
Q gi|254780166|r   85 -AADAVSLLE-HLGI----SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLP-SIDE  157 (261)
Q Consensus        85 -~~di~~~i~-~l~~----~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  157 (261)
                       ..++-.+++ +...    ++-.++||||||.=|+.+|+++|++++++.-.++  .+.+....-..   ..+... .-..
T Consensus       133 l~~ELP~~~~~~f~~~~~~~~~aI~G~SMGG~GAl~lA~~~pd~f~~~sS~Sg--~~~~s~~~~~~---~~~~~~~g~~~  207 (316)
T COG0627         133 LTQELPALWEAAFPADGTGDGRAIAGHSMGGYGALKLALKHPDRFKSASSFSG--ILSPSSPWGPT---LAMGDPWGGKA  207 (316)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHHHHCCCCCCCEEECCCC--CCCCCCCCCCC---HHCCCCCCCCC
T ss_conf             98774699998666555667731489851437777776509450113101465--20666554410---00136435536


Q ss_pred             HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCC-C---HHHHHHHCC----CCE
Q ss_conf             00111000000003476654135677765410122001210035760699847888788-0---799999679----979
Q gi|254780166|r  158 VQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG-S---PQELMSFIP----SSQ  229 (261)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~-~---~~~l~~~~p----~~~  229 (261)
                      .....+..-   ......++.......+........... .....++++-.|..|.+.. .   .+.+.+.+.    ...
T Consensus       208 ~~~~~G~~~---~~~w~~~D~~~~~~~l~~~~~~~~~~~-~~~~~~~~~d~g~ad~~~~~~~~~~~~~~~a~~~~g~~~~  283 (316)
T COG0627         208 FNAMLGPDS---DPAWQENDPLSLIEKLVANANTRIWVY-GGSPPELLIDNGPADFFLAANNLSTRAFAEALRAAGIPNG  283 (316)
T ss_pred             HHHHCCCCC---CCCCCCCCHHHHHHHHHHCCCCCCEEC-CCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCE
T ss_conf             887418886---644362683677877653035321002-5678875543244204555246578999999975389960


Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             9998888738434848999999999875168
Q gi|254780166|r  230 YLNICRRDHLLAVGDKQFKQGVVNFYANELR  260 (261)
Q Consensus       230 ~~~i~~~gH~~~~e~p~~~~~i~~Fl~~~~~  260 (261)
                      +...++.+|--.+= ..+.+..+.|++..+.
T Consensus       284 ~~~~~~G~Hsw~~w-~~~l~~~~~~~a~~l~  313 (316)
T COG0627         284 VRDQPGGDHSWYFW-ASQLADHLPWLAGALG  313 (316)
T ss_pred             EEECCCCCCCHHHH-HHHHHHHHHHHHHHHC
T ss_conf             57579997776999-9999999999998855


No 134
>COG4099 Predicted peptidase [General function prediction only]
Probab=97.83  E-value=7.7e-05  Score=47.86  Aligned_cols=123  Identities=18%  Similarity=0.233  Sum_probs=75.6

Q ss_pred             CCEEEEEECCCCEEEEEEECCC------CC-CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC-CCCC
Q ss_conf             6407999349949999996489------98-78999987888800122179999999868989999647655422-2222
Q gi|254780166|r    3 NEVKFFRSWRKYQFAFYDVGDK------DA-PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS-DKSY   74 (261)
Q Consensus         3 ~~~~~~~~~dG~~l~y~~~g~~------~~-~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S-~~~~   74 (261)
                      +...|+.+..|.+|.|.-+-++      .- |-|||+||.|......      ...+. .|.--++++.+-+++= -.|+
T Consensus       161 ~a~~f~d~~tgneLkYrly~Pkdy~pdkky~PLvlfLHgagq~g~dn------~~~l~-sg~gaiawa~pedqcfVlAPQ  233 (387)
T COG4099         161 QAVEFYDESTGNELKYRLYTPKDYAPDKKYYPLVLFLHGAGQGGSDN------DKVLS-SGIGAIAWAGPEDQCFVLAPQ  233 (387)
T ss_pred             HHEEEECCCCCCEEEEEEECCCCCCCCCCCCCEEEEEECCCCCCCHH------HHHHH-CCCCCEEEECCCCCEEEECCC
T ss_conf             12486342568555588735666688876453799994488777415------66663-586513561566743897146


Q ss_pred             ----------CCCCCCCCCCCCCCC-CCCCCCCCC--CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCC
Q ss_conf             ----------222222122222222-222222222--22223443444310133321023565238962885
Q gi|254780166|r   75 ----------IENDYRLVFMAADAV-SLLEHLGIS--KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS  133 (261)
Q Consensus        75 ----------~~~~~s~~~~~~di~-~~i~~l~~~--~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~  133 (261)
                                ....+ ....++-+. .+.++.+++  ++-++|.|+||.-++.++.++|+.+++.++++...
T Consensus       234 y~~if~d~e~~t~~~-l~~~idli~~vlas~ynID~sRIYviGlSrG~~gt~al~~kfPdfFAaa~~iaG~~  304 (387)
T COG4099         234 YNPIFADSEEKTLLY-LIEKIDLILEVLASTYNIDRSRIYVIGLSRGGFGTWALAEKFPDFFAAAVPIAGGG  304 (387)
T ss_pred             CCCCCCCCCCCCCHH-HHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCHHHHHHHHHCCHHHHEEEEECCCC
T ss_conf             552124432352135-78999999999853357562138999626763456898775805442134634788


No 135
>pfam11339 DUF3141 Protein of unknown function (DUF3141). This family of proteins with unknown function appears to be restricted to Proteobacteria.
Probab=97.82  E-value=0.00022  Score=45.14  Aligned_cols=208  Identities=15%  Similarity=0.222  Sum_probs=103.9

Q ss_pred             CCCCCEEEEE-----CC--CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8998789999-----87--8888001221799999998689899996476554222222222222122222222222222
Q gi|254780166|r   23 DKDAPTILLI-----HG--LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL   95 (261)
Q Consensus        23 ~~~~~~vv~i-----HG--~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l   95 (261)
                      ++.++|+|.|     ||  .||-..     +..+-.-..+|+-||-+-+.     ..|..  .-|+++...-..+++++.
T Consensus        65 D~~kRP~vViDPRAGHGpGIGGFK~-----DSeVGvAL~~GHPvYFV~F~-----p~P~p--GQTl~DV~~Aea~Fv~~V  132 (581)
T pfam11339        65 DPTKRPFVVIDPRAGHGPGIGGFKP-----DSEIGVALRAGHPCYFVGFL-----PDPEP--GQTLEDVMRAEAAFLREV  132 (581)
T ss_pred             CCCCCCEEEECCCCCCCCCCCCCCC-----CCHHHHHHHCCCCEEEEEEC-----CCCCC--CCCHHHHHHHHHHHHHHH
T ss_conf             8888985997998888998778874-----20888998669986999874-----69989--888999999999999999


Q ss_pred             -----CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC----CCHH---------HHHHHHHH-H------
Q ss_conf             -----222222234434443101333210235652389628856331----1035---------69999998-6------
Q gi|254780166|r   96 -----GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD----SDVV---------DWQSLIDS-F------  150 (261)
Q Consensus        96 -----~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~----~~~~---------~~~~~~~~-~------  150 (261)
                           +..|.+++|.+.||+-++.+|+.+|+.+--+|+.++.-..-.    ...+         .|.....+ +      
T Consensus       133 ~~~HP~a~kP~viGNCQaGWa~~~lAA~~pdl~GPivlnGaPlSYWaG~~G~NPMRY~gGllGGsW~a~l~sDLG~G~FD  212 (581)
T pfam11339       133 IELHPDAPKPAVIGNCQAGWALLMLAALRPDLFGPIIVAGAPLSYWAGVRGKNPMRYSGGLLGGSWLTALTSDLGNGRFD  212 (581)
T ss_pred             HHHCCCCCCCEEEECCHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHCCCCEEC
T ss_conf             98489999986894168999999998528787687666488741016777899514540453108899998761698115


Q ss_pred             ---HCCCCCHHHH---HHHHHHCCCCCCCCCCC-HHHHHHHHHHH---------------------------CCCCCHHH
Q ss_conf             ---3111100001---11000000003476654-13567776541---------------------------01220012
Q gi|254780166|r  151 ---LLPSIDEVQN---PLGKKFRKFADLDPGND-LKALASCLSMI---------------------------RKPFCQDD  196 (261)
Q Consensus       151 ---~~~~~~~~~~---~~~~~~~~~~~~~~~~~-~~~~~~~~~~~---------------------------~~~~~~~~  196 (261)
                         ....++.+..   ...|.+..+++.+.... +..|.+++...                           ......-+
T Consensus       213 GA~LVqNFE~LNPant~W~KyY~Lya~vDtE~~RfLeFErWWgg~~~ln~~Ei~~Iv~nLFVGNrL~~g~~~~~~G~~~D  292 (581)
T pfam11339       213 GAWLVQNFENLNPANTLWGKYYNLYAKVDTEAPRFLEFERWWGGHVLLNGEEIQWIVDNLFVGNRLATGELRTSDGRRID  292 (581)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEECCHHHHHHHHHHHHCCCCCCCCCEECCCCCEEE
T ss_conf             08998665505901567887656653267642444447665185143279999999987530240035825638995753


Q ss_pred             HHCCCCCEEEEEECCCCCCCCHHH---HHHHCCC-------CE---EEEECCCCCCCCC
Q ss_conf             100357606998478887880799---9996799-------79---9998888738434
Q gi|254780166|r  197 LYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPS-------SQ---YLNICRRDHLLAV  242 (261)
Q Consensus       197 l~~i~~P~l~i~G~~D~~~~~~~~---l~~~~p~-------~~---~~~i~~~gH~~~~  242 (261)
                      |++|+.|+.+++...|.++|+.+.   +.+..++       .+   +.+-+..||+..+
T Consensus       293 Lr~IrsPIvvFaS~GDNITPPqQAL~WI~dlY~~~~ei~a~gQ~IVY~~H~~vGHLGIF  351 (581)
T pfam11339       293 LRNIRSPIVVFCSYGDNITPPQQALNWIADLYADVEEIRAHGQTIVYCVHESVGHLGIF  351 (581)
T ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHCCHHHHCCCHHHHHHCCCEEEEEECCCCCCEEEE
T ss_conf             43267888999336888999657756288764899999858987999856987736778


No 136
>pfam00756 Esterase Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
Probab=97.79  E-value=3.1e-05  Score=50.22  Aligned_cols=49  Identities=24%  Similarity=0.196  Sum_probs=35.9

Q ss_pred             CCCCCCCCCCCC-CC---CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCC
Q ss_conf             222222222222-22---22222344344431013332102356523896288
Q gi|254780166|r   84 MAADAVSLLEHL-GI---SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG  132 (261)
Q Consensus        84 ~~~di~~~i~~l-~~---~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~  132 (261)
                      +++++...++.. ..   .+..+.|+||||..|+.++.++|+++.+++..++.
T Consensus        93 l~~el~p~i~~~y~~~~~~~~ai~G~SmGG~~Al~~al~~Pd~F~~~~~~Sg~  145 (243)
T pfam00756        93 LTQELPPLLDANFPTAPDGDRALAGQSMGGLGALYLALHYPDRFGSVSSFSPI  145 (243)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             99999999998578578767179852876999999999682530623130886


No 137
>KOG3847 consensus
Probab=97.78  E-value=8.1e-05  Score=47.73  Aligned_cols=41  Identities=29%  Similarity=0.539  Sum_probs=34.7

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
Q ss_conf             87899998788880012217999999986898999964765542
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK   69 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~   69 (261)
                      -|.|||-||.|++..   .|....-.||.+||-|.+++.|.+-.
T Consensus       118 ~PvvvFSHGLggsRt---~YSa~c~~LAShG~VVaavEHRD~SA  158 (399)
T KOG3847         118 YPVVVFSHGLGGSRT---LYSAYCTSLASHGFVVAAVEHRDRSA  158 (399)
T ss_pred             CCEEEEECCCCCCHH---HHHHHHHHHHHCCEEEEEEECCCCCC
T ss_conf             658999346663034---39887664754725999750256752


No 138
>KOG3101 consensus
Probab=97.62  E-value=0.00012  Score=46.68  Aligned_cols=128  Identities=22%  Similarity=0.238  Sum_probs=74.6

Q ss_pred             CCEEEEEECCCCEEEEEEEC-------------CC----C--CCEEEEECCCCCCCHHHHHHHHHHHH-HHHCCCEEEEE
Q ss_conf             64079993499499999964-------------89----9--87899998788880012217999999-98689899996
Q gi|254780166|r    3 NEVKFFRSWRKYQFAFYDVG-------------DK----D--APTILLIHGLASSVQTNWLFSGWIQL-LCDQGFRVIAF   62 (261)
Q Consensus         3 ~~~~~~~~~dG~~l~y~~~g-------------~~----~--~~~vv~iHG~~~~~~~~~~~~~~~~~-l~~~g~~vi~~   62 (261)
                      .+++-++..+|.+.-|.+..             ++    +  -|++.++.|..++.+.+ .-+.-++. -.++|+-|+++
T Consensus         2 ~~vssnk~f~G~q~vy~H~S~tl~c~Mtf~vylPp~a~~~k~~P~lf~LSGLTCT~~Nf-i~Ksg~qq~As~hgl~vV~P   80 (283)
T KOG3101           2 KQVSSNKCFGGRQKVYKHNSNTLKCSMTFGVYLPPDAPRGKRCPVLFYLSGLTCTHENF-IEKSGFQQQASKHGLAVVAP   80 (283)
T ss_pred             CCCCCCCCCCCEEEEEECCCCCCCCCEEEEEECCCCCCCCCCCCEEEEECCCCCCCHHH-HHHHHHHHHHHHCCEEEECC
T ss_conf             40134643266346651156643441689886588765688686689842774451546-76656777675458599888


Q ss_pred             CCCCCCCCCCCC-C-------------------CCCCCCCC-CCCCCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             476554222222-2-------------------22222122-22222222222----22222222344344431013332
Q gi|254780166|r   63 DNLGHGKSDKSY-I-------------------ENDYRLVF-MAADAVSLLEH----LGISKVHVMGYSMGARIACSMVL  117 (261)
Q Consensus        63 D~~G~G~S~~~~-~-------------------~~~~s~~~-~~~di~~~i~~----l~~~~~~liGhS~Gg~ia~~~a~  117 (261)
                      |..-.|.--... .                   ...|.+=+ .++++..+++.    +...++.+.||||||.=|+..+.
T Consensus        81 DTSPRG~~v~g~~eswDFG~GAGFYvnAt~epw~~~yrMYdYv~kELp~~l~~~~~pld~~k~~IfGHSMGGhGAl~~~L  160 (283)
T KOG3101          81 DTSPRGVEVAGDDESWDFGQGAGFYVNATQEPWAKHYRMYDYVVKELPQLLNSANVPLDPLKVGIFGHSMGGHGALTIYL  160 (283)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHCCEECCCCCCCCEEEEEE
T ss_conf             99987653579854333467742588245156764230899999998887321566556034205403567776279997


Q ss_pred             HCCCCCCCEEEECC
Q ss_conf             10235652389628
Q gi|254780166|r  118 FYPSYVRSVILGGV  131 (261)
Q Consensus       118 ~~p~~v~~lvl~~~  131 (261)
                      +.|++.+++...++
T Consensus       161 kn~~kykSvSAFAP  174 (283)
T KOG3101         161 KNPSKYKSVSAFAP  174 (283)
T ss_pred             CCCCCCCCEECCCC
T ss_conf             28320130100046


No 139
>pfam05705 DUF829 Eukaryotic protein of unknown function (DUF829). This family consists of several uncharacterized eukaryotic proteins.
Probab=97.60  E-value=0.00047  Score=43.18  Aligned_cols=213  Identities=12%  Similarity=0.041  Sum_probs=96.8

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC--CCCCCC
Q ss_conf             89999878888001221799999998689899996476554222222222222122222222222222-222--222234
Q gi|254780166|r   28 TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL-GIS--KVHVMG  104 (261)
Q Consensus        28 ~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l-~~~--~~~liG  104 (261)
                      |+|++=||.++..-  -.....+...+.|++++.+-.+-.-..-    +. -.+...++.+...+... ..+  ++.+=.
T Consensus         1 Plvil~gW~gA~~~--hl~KY~~~Y~~~g~~il~~~~~~~~~~~----~~-~~~~~~~~~l~~~l~~~~~~~~~~il~H~   73 (239)
T pfam05705         1 PLVLLLGWLGARPK--HLAKYSDLYTRPGPDILVITSPPRDLLW----PT-KGLAPGLDKLLELLSESQRSEYWPILFHV   73 (239)
T ss_pred             CEEEEEECCCCCHH--HHHHHHHHHHCCCCEEEEEECCHHHHCC----CC-CCCHHHHHHHHHHHHHCCCCCCCCEEEEE
T ss_conf             98999867899699--9999999997289849999579899703----12-01069999999987540158998689999


Q ss_pred             CCCCCCCHHHHHHH-------CC---CCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHH-HHHHHHHHCC---CC
Q ss_conf             43444310133321-------02---35652389628856331103569999998631111000-0111000000---00
Q gi|254780166|r  105 YSMGARIACSMVLF-------YP---SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEV-QNPLGKKFRK---FA  170 (261)
Q Consensus       105 hS~Gg~ia~~~a~~-------~p---~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~---~~  170 (261)
                      .|.||.........       ++   .+++++|+-+ .|..... ....+.....+........ .......+..   ..
T Consensus        74 FSnGG~~~~~~l~~~~~~~~~~~~~~~~i~g~I~DS-~Pg~~~~-~~~~~a~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  151 (239)
T pfam05705        74 FSNGGPILYLCLLAALQDRTKFGKLLPRVKGQVWDS-APGIGHY-HGAVGAFAAALPKLSKVASLLRALLLLALAVYLLA  151 (239)
T ss_pred             EECCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECC-CCCCCCH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             606069999999999983556566565547999418-9977657-88899999871776257778999999999999999


Q ss_pred             CC-CCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHC--C--CCEEEEECCCCCCCCC-
Q ss_conf             34-766541356777654101220012100357606998478887880--79999967--9--9799998888738434-
Q gi|254780166|r  171 DL-DPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFI--P--SSQYLNICRRDHLLAV-  242 (261)
Q Consensus       171 ~~-~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~--p--~~~~~~i~~~gH~~~~-  242 (261)
                      .. .......  ..    ..............+|-|++..+.|.+++.  .++.++..  .  ..+.+.++++.|..|+ 
T Consensus       152 ~~~~~~~~~~--~~----~~~~~~~~~~~~~~~p~lylYS~~D~li~~~dvE~~~~~~r~~G~~V~~~~f~~S~Hv~H~r  225 (239)
T pfam05705       152 LLILFLPSVA--SH----SRRSLNDLANTPLPAPQLYLYSKADEVIPWRDVERHIEEARQRGVSVTSVCFEDSPHVGHMR  225 (239)
T ss_pred             HHHHCCCCHH--HH----HHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHH
T ss_conf             9997288489--99----99998666418999966999708999729999999999999769968999718984563776


Q ss_pred             CCH-HHHHHHHHHH
Q ss_conf             848-9999999998
Q gi|254780166|r  243 GDK-QFKQGVVNFY  255 (261)
Q Consensus       243 e~p-~~~~~i~~Fl  255 (261)
                      +.| ++.+++.+|.
T Consensus       226 ~~p~~Y~~~v~~fw  239 (239)
T pfam05705       226 KHPDRYWPKVVEFW  239 (239)
T ss_pred             HCHHHHHHHHHHHC
T ss_conf             19999999999769


No 140
>KOG1551 consensus
Probab=97.60  E-value=0.00064  Score=42.37  Aligned_cols=226  Identities=11%  Similarity=0.042  Sum_probs=114.4

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC----C----------C
Q ss_conf             8789999878888001221799999998689899996476554222222222222122222222----2----------2
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAV----S----------L   91 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~----~----------~   91 (261)
                      ++..+++-|.|. +.. ..-..+...+.+++...+.+.-|=||+-. |......+++. +.|+.    +          +
T Consensus       113 ~~lcl~~a~tgd-h~y-~rr~~L~~p~~k~~i~tmvle~pfYgqr~-p~~q~~~~Le~-vtDlf~mG~A~I~E~~~lf~W  188 (371)
T KOG1551         113 ADLCLSWALTGD-HVY-TRRLVLSKPINKREIATMVLEKPFYGQRV-PEEQIIHMLEY-VTDLFKMGRATIQEFVKLFTW  188 (371)
T ss_pred             CCEEEEEEECCC-CEE-EEEEEECCCHHHHCCHHEEEECCCCCCCC-CHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCC
T ss_conf             771489850577-316-75234148235302021244055445668-88999999998-789998608999999986464


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCC--CCCCCCHHHH--HHHHHHHHCCCCCHHHHHHH-HHH
Q ss_conf             222222222223443444310133321023565238962885--6331103569--99999863111100001110-000
Q gi|254780166|r   92 LEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS--VLYDSDVVDW--QSLIDSFLLPSIDEVQNPLG-KKF  166 (261)
Q Consensus        92 i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~--~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~-~~~  166 (261)
                      =++.+..+..++|-||||-+|....+.++.-|+-+=.-+...  ..........  .......-............ ..+
T Consensus       189 s~~~g~g~~~~~g~Smgg~~a~~vgS~~q~Pva~~p~l~~~~asvs~teg~l~~~~s~~~~~~~~t~~~~~~~r~p~Q~~  268 (371)
T KOG1551         189 SSADGLGNLNLVGRSMGGDIANQVGSLHQKPVATAPCLNSSKASVSATEGLLLQDTSKMKRFNQTTNKSGYTSRNPAQSY  268 (371)
T ss_pred             CCCCCCCCCEEEEEECCCHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCHHHH
T ss_conf             30137566305642035178876401688875002333665452665420331204777763257304456550710568


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCC-----EEEEEECCCCCCCC--HHHHHHHCCCCEEEEECCCCCC
Q ss_conf             0000347665413567776541012200121003576-----06998478887880--7999996799799998888738
Q gi|254780166|r  167 RKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVP-----VLIAVGSQDDLAGS--PQELMSFIPSSQYLNICRRDHL  239 (261)
Q Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P-----~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~~gH~  239 (261)
                      ....+....|........|+...+  -...+.+..+|     +.++.+++|..++.  ...+.+..|++++..++ +||.
T Consensus       269 ~~~~~~~srn~~~E~~~~Mr~vmd--~~T~v~~fp~Pvdpsl~ivv~A~~D~Yipr~gv~~lQ~~WPg~eVr~~e-gGHV  345 (371)
T KOG1551         269 HLLSKEQSRNSRKESLIFMRGVMD--ECTHVANFPVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEVRYLE-GGHV  345 (371)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHH--HHCHHHCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHCCCCEEEEEE-CCCE
T ss_conf             998887621352889999999887--6011330777899876999983377522255747789748997799961-5743


Q ss_pred             CCC--CCHHHHHHHHHHHHHH
Q ss_conf             434--8489999999998751
Q gi|254780166|r  240 LAV--GDKQFKQGVVNFYANE  258 (261)
Q Consensus       240 ~~~--e~p~~~~~i~~Fl~~~  258 (261)
                      -.+  .+..+..+|.+-|-+.
T Consensus       346 sayl~k~dlfRR~I~d~L~R~  366 (371)
T KOG1551         346 SAYLFKQDLFRRAIVDGLDRL  366 (371)
T ss_pred             EEEEHHCHHHHHHHHHHHHHH
T ss_conf             201010308999999988766


No 141
>pfam05577 Peptidase_S28 Serine carboxypeptidase S28. These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase.
Probab=97.58  E-value=0.00014  Score=46.38  Aligned_cols=108  Identities=20%  Similarity=0.238  Sum_probs=69.9

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCC--CCC---CCCCCCCCCCCCCCCCC
Q ss_conf             4899878999987888800122179999999868-98999964765542222222--222---22122222222222222
Q gi|254780166|r   22 GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ-GFRVIAFDNLGHGKSDKSYI--END---YRLVFMAADAVSLLEHL   95 (261)
Q Consensus        22 g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~-g~~vi~~D~~G~G~S~~~~~--~~~---~s~~~~~~di~~~i~~l   95 (261)
                      .++++|.+|++-|= ++....+.-...+..++++ +=-++..++|=||.|-...+  .++   .|.++...|+..+++.+
T Consensus        25 ~~~ggPifly~gGE-~~~~~~~~~~g~~~~lA~~~~a~~v~lEHRYYG~S~P~~~~s~enL~yLt~~QALaD~a~Fi~~~  103 (433)
T pfam05577        25 YRNGGPIFLMIGGE-GPESASWVRNGHWLDLAKEFGALVFSLEHRFYGQSKPIGDLSTANLRYLSSLQALADVASFIKAM  103 (433)
T ss_pred             ECCCCCEEEEECCC-CCCCCCCCCCCHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             46999789998998-76752311362899999983996999851035036688998811236478999999999999999


Q ss_pred             C-------CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEC
Q ss_conf             2-------2222223443444310133321023565238962
Q gi|254780166|r   96 G-------ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG  130 (261)
Q Consensus        96 ~-------~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~  130 (261)
                      +       -.+++++|-|+||.++.-+-.+||+.+.+.+..+
T Consensus       104 k~~~~~~~~~pwI~~GGSY~G~LaAw~R~kYP~~v~ga~ASS  145 (433)
T pfam05577       104 NQKFNGLSSSKWITFGGSYSGSLAAWARKKYPHLVVGAVASS  145 (433)
T ss_pred             HHHCCCCCCCCEEEECCCCHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             986378899998998786087999999986888179999634


No 142
>COG1770 PtrB Protease II [Amino acid transport and metabolism]
Probab=97.55  E-value=0.0016  Score=40.10  Aligned_cols=220  Identities=19%  Similarity=0.164  Sum_probs=117.0

Q ss_pred             CEEEEEECCCCEEEE----EEE--CCCCCCEEEEECCC-CCCCHHHHHHHHHHHHHHHCCCEEEEE-CCCCCCCCC----
Q ss_conf             407999349949999----996--48998789999878-888001221799999998689899996-476554222----
Q gi|254780166|r    4 EVKFFRSWRKYQFAF----YDV--GDKDAPTILLIHGL-ASSVQTNWLFSGWIQLLCDQGFRVIAF-DNLGHGKSD----   71 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y----~~~--g~~~~~~vv~iHG~-~~~~~~~~~~~~~~~~l~~~g~~vi~~-D~~G~G~S~----   71 (261)
                      +..+....||.++..    ...  -++++|.++..=|- |.+...  .|....-.|.++|| |+++ ..||=|+-.    
T Consensus       420 ~riwa~a~dgv~VPVSLvyrkd~~~~g~~p~lLygYGaYG~s~~p--~Fs~~~lSLlDRGf-iyAIAHVRGGgelG~~WY  496 (682)
T COG1770         420 RRIWATADDGVQVPVSLVYRKDTKLDGSAPLLLYGYGAYGISMDP--SFSIARLSLLDRGF-VYAIAHVRGGGELGRAWY  496 (682)
T ss_pred             EEEEEECCCCEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCC--CCCCCEEEEECCCE-EEEEEEEECCCCCCHHHH
T ss_conf             999887589808417999941566789985799995345655786--64412422001726-999999506643475788


Q ss_pred             --CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECC----CCCCCCCCHHHH
Q ss_conf             --222222222122222222222222--222222234434443101333210235652389628----856331103569
Q gi|254780166|r   72 --KSYIENDYRLVFMAADAVSLLEHL--GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV----GSVLYDSDVVDW  143 (261)
Q Consensus        72 --~~~~~~~~s~~~~~~di~~~i~~l--~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~----~~~~~~~~~~~~  143 (261)
                        +....+..|+.|+.+-...++++-  .-+.+.++|-|-||+++-..+...|++++++|+.-|    ...+..+...  
T Consensus       497 e~GK~l~K~NTf~DFIa~a~~Lv~~g~~~~~~i~a~GGSAGGmLmGav~N~~P~lf~~iiA~VPFVDvltTMlD~slP--  574 (682)
T COG1770         497 EDGKLLNKKNTFTDFIAAARHLVKEGYTSPDRIVAIGGSAGGMLMGAVANMAPDLFAGIIAQVPFVDVLTTMLDPSLP--  574 (682)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHCHHHHHHEEECCCCCCHHHHHCCCCCC--
T ss_conf             734455333647889999999997176782415896357234899999861846543124327733312320387789--


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCC-CCEEEEEECCCCCCC---CHH
Q ss_conf             9999986311110000111000000003476654135677765410122001210035-760699847888788---079
Q gi|254780166|r  144 QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRID-VPVLIAVGSQDDLAG---SPQ  219 (261)
Q Consensus       144 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~-~P~l~i~G~~D~~~~---~~~  219 (261)
                            +......++..|.              + ..+..++   ..++.-+.+..-. -|+|++.|..|+.+.   +++
T Consensus       575 ------LT~~E~~EWGNP~--------------d-~e~y~yi---kSYSPYdNV~a~~YP~ilv~~Gl~D~rV~YwEpAK  630 (682)
T COG1770         575 ------LTVTEWDEWGNPL--------------D-PEYYDYI---KSYSPYDNVEAQPYPAILVTTGLNDPRVQYWEPAK  630 (682)
T ss_pred             ------CCCCCHHHHCCCC--------------C-HHHHHHH---HHCCCHHCCCCCCCCCEEEECCCCCCCCCCCHHHH
T ss_conf             ------8852034307977--------------7-8899998---62593321455788836897034578614520789


Q ss_pred             HHHHH---CCCCEEEEE---CCCCCCCCCCCHHHHHHHH
Q ss_conf             99996---799799998---8887384348489999999
Q gi|254780166|r  220 ELMSF---IPSSQYLNI---CRRDHLLAVGDKQFKQGVV  252 (261)
Q Consensus       220 ~l~~~---~p~~~~~~i---~~~gH~~~~e~p~~~~~i~  252 (261)
                      .+++.   -.+....++   -++||-..-.+.+..+.+.
T Consensus       631 WvAkLR~~~td~~plLlkt~M~aGHgG~SgRf~~lee~A  669 (682)
T COG1770         631 WVAKLRELKTDGNPLLLKTNMDAGHGGASGRFQRLEEIA  669 (682)
T ss_pred             HHHHHHHCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHH
T ss_conf             999876413689717998413465787787368899999


No 143
>COG3150 Predicted esterase [General function prediction only]
Probab=97.50  E-value=0.00034  Score=44.00  Aligned_cols=184  Identities=16%  Similarity=0.229  Sum_probs=95.1

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99998788880012217999999986898999964765542222222222221222222222222222222222344344
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMG  108 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~G  108 (261)
                      ++.+|||-+|..+ ..-.-+.+.+. +..+-+.+       |. |..+  .+.....+.++.++...+-....|+|-|+|
T Consensus         2 ilYlHGFnSSP~s-hka~~~~q~~~-~~~~~i~y-------~~-p~l~--h~p~~a~~ele~~i~~~~~~~p~ivGssLG   69 (191)
T COG3150           2 ILYLHGFNSSPGS-HKAVLLLQFID-EDVRDIEY-------ST-PHLP--HDPQQALKELEKAVQELGDESPLIVGSSLG   69 (191)
T ss_pred             EEEEECCCCCCCC-HHHHHHHHHHH-CCCCCCEE-------EC-CCCC--CCHHHHHHHHHHHHHHCCCCCCEEEEECCH
T ss_conf             4788257899600-89999999874-01553042-------15-8899--899999999999999718998548860521


Q ss_pred             CCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             43101333210235652389628856331103569999998631111000011100000000347665413567776541
Q gi|254780166|r  109 ARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI  188 (261)
Q Consensus       109 g~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  188 (261)
                      |+.+..++.++.  ++.++ ++|  ...+.     +.....     +...+.+...           ..+.-........
T Consensus        70 GY~At~l~~~~G--irav~-~NP--av~P~-----e~l~gy-----lg~~en~ytg-----------~~y~le~~hI~~l  123 (191)
T COG3150          70 GYYATWLGFLCG--IRAVV-FNP--AVRPY-----ELLTGY-----LGRPENPYTG-----------QEYVLESRHIATL  123 (191)
T ss_pred             HHHHHHHHHHHC--CHHHH-CCC--CCCCH-----HHHHHH-----CCCCCCCCCC-----------CEEEEEHHHHHHH
T ss_conf             789999998708--66541-487--66823-----666413-----0798888776-----------4687305448888


Q ss_pred             CCCCCHHHHHCCCCC-EEEEEECC-CCCCCCHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             012200121003576-06998478-887880799999679979999888873843484899999999987
Q gi|254780166|r  189 RKPFCQDDLYRIDVP-VLIAVGSQ-DDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYA  256 (261)
Q Consensus       189 ~~~~~~~~l~~i~~P-~l~i~G~~-D~~~~~~~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~Fl~  256 (261)
                          ...++..++.| .+++.... |++... ++..+..+.+...+.++..|-+ .+=....+.|+.|..
T Consensus       124 ----~~~~~~~l~~p~~l~lL~qtgDEvLDy-r~a~a~y~~~~~~V~dgg~H~F-~~f~~~l~~i~aF~g  187 (191)
T COG3150         124 ----CVLQFRELNRPRCLVLLSQTGDEVLDY-RQAVAYYHPCYEIVWDGGDHKF-KGFSRHLQRIKAFKG  187 (191)
T ss_pred             ----HHHHCCCCCCCCEEEEECCCCCHHHHH-HHHHHHHHHHHHEEECCCCCCC-CCHHHHHHHHHHHHC
T ss_conf             ----875132037985798600144077779-9999975335534552897553-335675799999861


No 144
>pfam08386 Abhydrolase_4 TAP-like protein. This is a family of putative bacterial peptidases and hydrolases that bear similarity to a tripeptidyl aminopeptidase isolated from Streptomyces lividans. A member of this family is thought to be involved in the C-terminal processing of propionicin F, a bacteriocidin characterized from Propionibacterium freudenreichii.
Probab=97.50  E-value=0.00029  Score=44.39  Aligned_cols=59  Identities=17%  Similarity=0.216  Sum_probs=50.4

Q ss_pred             CCCCEEEEEECCCCCCCC--HHHHHHHCCCCEEEEECCCCCCCCCC-CHHHHHHHHHHHHHH
Q ss_conf             357606998478887880--79999967997999988887384348-489999999998751
Q gi|254780166|r  200 IDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLNICRRDHLLAVG-DKQFKQGVVNFYANE  258 (261)
Q Consensus       200 i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~~~~i~~~gH~~~~e-~p~~~~~i~~Fl~~~  258 (261)
                      -..|+|++.|+.|+.+|.  ++.+++.+++++++++++.||-.... .+.+.+.+.+||.+-
T Consensus        33 ~~~p~Lvv~~~~Dp~TP~~~a~~~a~~l~~s~lvt~~g~GH~~~~~~s~Cv~~~v~~yL~~g   94 (103)
T pfam08386        33 GAPPVLLVQGEGDPATPYEGARALARALGNAVLVTVNGAGHGAYLGGNKCVDKAVDAYLLTG   94 (103)
T ss_pred             CCCCEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCEEECCCCHHHHHHHHHHHHCC
T ss_conf             99998897467788861999999999779955998737996262178843999999997579


No 145
>pfam10340 DUF2424 Protein of unknown function (DUF2424). This is a family of proteins conserved in yeasts. The function is not known.
Probab=97.31  E-value=0.0017  Score=39.85  Aligned_cols=102  Identities=17%  Similarity=0.205  Sum_probs=54.5

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHC-----CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC
Q ss_conf             9878999987888800122179999999868-----9899996476554222222222222122222222----222222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQ-----GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAV----SLLEHL   95 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~-----g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~----~~i~~l   95 (261)
                      ..|.++++||.|-...   .+..++..|..-     .-.++..|+.=.     ...++.+....+.-+..    .+....
T Consensus       121 ~DpVLiY~HGGGy~L~---~~~~~lv~l~~l~~~~~~~sIli~DYslT-----~~~~~~~~yP~Ql~e~l~~Y~~lv~~~  192 (374)
T pfam10340       121 VDPILLYYHGGGFALK---LIPVTLVFLNNLGKYFPDMAILVSDYTVT-----ANCPQSYTYPLQVLQCLAVYDYLTLTK  192 (374)
T ss_pred             CCCEEEEEECCEEEEC---CCHHHHHHHHHHHHHCCCCEEEEEECCEE-----CCCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             7968999827755761---32256569999997578754999702000-----357667866168999999999998705


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHC-----CCCCCCEEEECCCCC
Q ss_conf             222222234434443101333210-----235652389628856
Q gi|254780166|r   96 GISKVHVMGYSMGARIACSMVLFY-----PSYVRSVILGGVGSV  134 (261)
Q Consensus        96 ~~~~~~liGhS~Gg~ia~~~a~~~-----p~~v~~lvl~~~~~~  134 (261)
                      +.+++.|+|-|-||.+++.+...-     +-.-+++++++|.-.
T Consensus       193 G~kni~LmGDSAGGNL~L~~l~yL~~~~~~~~Pk~~i~ISPWvN  236 (374)
T pfam10340       193 GCKNVTLMGDSAGGNLVLNILLYLHKCNKVVLPKKAIAISPWLN  236 (374)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCEEEECCCCC
T ss_conf             76169997237762378999999986397658871488646545


No 146
>pfam10142 PhoPQ_related PhoPQ-activated pathogenicity-related protein. Members of this family of bacterial proteins are involved in the virulence of some pathogenic proteobacteria.
Probab=97.13  E-value=0.0028  Score=38.61  Aligned_cols=149  Identities=13%  Similarity=0.135  Sum_probs=86.9

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             22222222344344431013332102356523896288563311035699999986311110000111000000003476
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDP  174 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  174 (261)
                      ..++++++.|.|-=|+.++..|+- +.||.+++=+-..-.   ......+...+...     .....+.....  .....
T Consensus       165 ~~i~~FvV~GaSKRGWttWltaa~-D~RV~ai~P~Vid~l---n~~~~~~h~~~~yG-----~ws~a~~dY~~--~gi~~  233 (360)
T pfam10142       165 IKIKKFVVTGASKRGWTTWLTAAV-DPRVAAIAPMVIDIL---NMRAQLKHQYESYG-----NWSEALKDYVA--EGIDE  233 (360)
T ss_pred             CCCHHEEEECCCCHHHHHHHHHHC-CCCEEEEEEEEECCC---CCHHHHHHHHHHHC-----CCCHHHHHHHH--CCCHH
T ss_conf             860116994545210898887641-756147976887044---60899999999756-----89667776777--18333


Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCE-EEEECCCCCCCCCCCHHHHHHH
Q ss_conf             6541356777654101220012100357606998478887880--799999679979-9998888738434848999999
Q gi|254780166|r  175 GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQ-YLNICRRDHLLAVGDKQFKQGV  251 (261)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~-~~~i~~~gH~~~~e~p~~~~~i  251 (261)
                      .-+...+...+.....+..+   .++++|-+++.|..|++..+  .+..-..+|+-+ +..+|++||-..-  ....+.+
T Consensus       234 ~l~t~~f~~L~~ivDP~~Y~---~rl~~PKyiinatgDeFf~pDs~~~y~~~L~G~K~lryvPN~~H~l~~--~~~~~~l  308 (360)
T pfam10142       234 QLNTPAFKQLLQIVDPYSYR---QRLTIPKYIINATGDEFFVPDSTNFYFDDLPGEKALRYVPNASHGLIN--TKVLESL  308 (360)
T ss_pred             HHCCHHHHHHHHHCCHHHHH---HHCCCCEEEEECCCCCCCCCCCCHHHHHCCCCCEEEEECCCCCCCCCC--HHHHHHH
T ss_conf             30897899998860827568---627856189844789630468434556148986469976889877651--2389999


Q ss_pred             HHHHHHHC
Q ss_conf             99987516
Q gi|254780166|r  252 VNFYANEL  259 (261)
Q Consensus       252 ~~Fl~~~~  259 (261)
                      ..|+.+.+
T Consensus       309 ~sf~~~~~  316 (360)
T pfam10142       309 VPFFKRVQ  316 (360)
T ss_pred             HHHHHHHH
T ss_conf             99999997


No 147
>pfam02450 LACT Lecithin:cholesterol acyltransferase. Lecithin:cholesterol acyltransferase (LACT) is involved in extracellular metabolism of plasma lipoproteins, including cholesterol.
Probab=97.11  E-value=0.00011  Score=46.96  Aligned_cols=80  Identities=20%  Similarity=0.262  Sum_probs=52.4

Q ss_pred             HHHHHHHHHHHHHCCCEE-----EE-ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCH
Q ss_conf             221799999998689899-----99-6476554222222222222122222222222222---22222223443444310
Q gi|254780166|r   42 NWLFSGWIQLLCDQGFRV-----IA-FDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL---GISKVHVMGYSMGARIA  112 (261)
Q Consensus        42 ~~~~~~~~~~l~~~g~~v-----i~-~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l---~~~~~~liGhS~Gg~ia  112 (261)
                      .+.|..+++.|++.||.-     -+ ||+|     -.+.     ..+++-..+..+||..   +-+|++|+||||||.+.
T Consensus        64 ~~~~~~li~~L~~~GY~~~~~l~~ApYDwR-----~~p~-----~~~~yf~~LK~lIE~~y~~ng~kVvli~HSmG~~~~  133 (382)
T pfam02450        64 YWIWHKVVKNLVNIGYERNKTVSAAPYDWR-----LSPA-----ERDDYFKKLKQLIEEALKLSGQKVVLIGHSMGNLLV  133 (382)
T ss_pred             CEEHHHHHHHHHHCCCCCCCEEEECCCCCC-----CCCH-----HHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCHHH
T ss_conf             250999999999809878971330663324-----6840-----566899999999999999709869999757852899


Q ss_pred             HHHHHHCCC------CCCCEEEECC
Q ss_conf             133321023------5652389628
Q gi|254780166|r  113 CSMVLFYPS------YVRSVILGGV  131 (261)
Q Consensus       113 ~~~a~~~p~------~v~~lvl~~~  131 (261)
                      +.+....+.      .|++.|.+++
T Consensus       134 ~~FL~~~~~~~W~dk~I~~~i~i~~  158 (382)
T pfam02450       134 LYFLLWVEAEGWKDQHIDAFISLGA  158 (382)
T ss_pred             HHHHHHCCCCCHHHHHHHHEECCCC
T ss_conf             9997525312078886775231343


No 148
>pfam11144 DUF2920 Protein of unknown function (DUF2920). This bacterial family of proteins has no known function.
Probab=96.99  E-value=0.0022  Score=39.18  Aligned_cols=159  Identities=18%  Similarity=0.101  Sum_probs=70.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCC---CHHHHHHHHHHCCCCCCCCC
Q ss_conf             222234434443101333210235652389628856331103569999998631111---00001110000000034766
Q gi|254780166|r   99 KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSI---DEVQNPLGKKFRKFADLDPG  175 (261)
Q Consensus        99 ~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~  175 (261)
                      +++++|+|.||++|...|--.|-.|.+++=.+. ......... +.+..........   ..........+.+..+....
T Consensus       185 p~I~~G~SyGGYLa~L~AKIAPw~vdgVIDNSs-~a~p~~~~I-~GrE~~~~~~~~~~~~~~~~~i~~~~~~KT~Wt~n~  262 (403)
T pfam11144       185 PVILIGSSYGGYLANLIAKIAPWYVDGVIDNSS-YALPLLRYI-FGREIDYTEYICFADFFFFKHIRLYCFDKTYWTRNK  262 (403)
T ss_pred             CEEEECCCCHHHHHHHHHHHCCCCCCEEEECCC-CCCHHHHHH-CCEECCCCEEECCCCCCCCCCEEEEEEECCCCCCCC
T ss_conf             889987783899999998748320257982465-645135653-250036412330235443586479997223123578


Q ss_pred             CCHHHHHHHHHHHCCCCCHHH---HHCC-CCCE-EEEEECCCCCCCCH--HHHHHHC----CCCEEEEE-----------
Q ss_conf             541356777654101220012---1003-5760-69984788878807--9999967----99799998-----------
Q gi|254780166|r  176 NDLKALASCLSMIRKPFCQDD---LYRI-DVPV-LIAVGSQDDLAGSP--QELMSFI----PSSQYLNI-----------  233 (261)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~---l~~i-~~P~-l~i~G~~D~~~~~~--~~l~~~~----p~~~~~~i-----------  233 (261)
                      +.+..+.......+.....+.   .++. .-|. ..-++..|...|..  +++.+.+    =++++.++           
T Consensus       263 ~sp~~F~~a~~~IR~~Ln~~HL~iqs~y~~~~~yvsYHs~~D~~~p~~~K~~l~~~~~~lgfda~l~likdes~IDGkFI  342 (403)
T pfam11144       263 NSPYYFSNARYLIRAILNKDHLIIQSNYNPNTIYVSYHSIKDELAPAKDKEELYDILKELGFDATLHLIKDESQIDGKFI  342 (403)
T ss_pred             CCCCCCCHHHHHHHHHCCHHHHHHHHCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCHHHCCCCEE
T ss_conf             98555566889998760887999986448972899984245667897899999999997699638987347555464013


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             88873843484899999999987516
Q gi|254780166|r  234 CRRDHLLAVGDKQFKQGVVNFYANEL  259 (261)
Q Consensus       234 ~~~gH~~~~e~p~~~~~i~~Fl~~~~  259 (261)
                      ++-.|-.-+....+...-+.-+++++
T Consensus       343 K~L~HGmgis~k~lf~KeLp~mlek~  368 (403)
T pfam11144       343 KNLEHGMGISMKALFKKELPLILEKL  368 (403)
T ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             05554579778999986628999975


No 149
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.
Probab=96.94  E-value=0.0014  Score=40.37  Aligned_cols=122  Identities=15%  Similarity=0.127  Sum_probs=62.1

Q ss_pred             ECCCCEEEEEE-EC---CCCCCEEEEECCCCCCCHH--HHHHHHHHHHHHHCCCEEEEECCC----CCCCCCCCCCCCCC
Q ss_conf             34994999999-64---8998789999878888001--221799999998689899996476----55422222222222
Q gi|254780166|r   10 SWRKYQFAFYD-VG---DKDAPTILLIHGLASSVQT--NWLFSGWIQLLCDQGFRVIAFDNL----GHGKSDKSYIENDY   79 (261)
Q Consensus        10 ~~dG~~l~y~~-~g---~~~~~~vv~iHG~~~~~~~--~~~~~~~~~~l~~~g~~vi~~D~~----G~G~S~~~~~~~~~   79 (261)
                      +.|-..+..+. ..   +..-|.+|+|||.+-...+  .+....++  ...++.=||++.+|    |+=.+.....+.++
T Consensus        75 sEDCL~LNV~~P~~~~~~~~lPV~v~ihGG~f~~Gs~~~~~~~~~~--~~~~~vVvVt~nYRLg~~GFl~~~~~~~~gN~  152 (493)
T cd00312          75 SEDCLYLNVYTPKNTKPGNSLPVMVWIHGGGFMFGSGSLYPGDGLA--REGDNVIVVSINYRLGVLGFLSTGDIELPGNY  152 (493)
T ss_pred             CCCCCEEEEEECCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHH--HCCCCEEEEEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             7758978988899988889973799974897763787777956898--65999799963464464546668987788753


Q ss_pred             CCCCCC---CCCCCCCCCCCC--CCCCCCCCCCCCCCHHHHHHHC--CCCCCCEEEECCCC
Q ss_conf             212222---222222222222--2222234434443101333210--23565238962885
Q gi|254780166|r   80 RLVFMA---ADAVSLLEHLGI--SKVHVMGYSMGARIACSMVLFY--PSYVRSVILGGVGS  133 (261)
Q Consensus        80 s~~~~~---~di~~~i~~l~~--~~~~liGhS~Gg~ia~~~a~~~--p~~v~~lvl~~~~~  133 (261)
                      .+.|+.   ++|++=|..+|-  ++|.|+|+|-||.-+..+....  ..++++.|+.+...
T Consensus       153 Gl~Dq~~AL~WV~~nI~~FGGDP~~VTi~G~SAGa~sv~~ll~sp~~~gLF~raI~~SG~~  213 (493)
T cd00312         153 GLKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSA  213 (493)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCHHCEEECCCCHHHHHHHHHHCCCCHHHHHHHHHCCCCC
T ss_conf             1578999999999999982898067167012508889999986843038888898707886


No 150
>KOG2541 consensus
Probab=96.90  E-value=0.0048  Score=37.17  Aligned_cols=103  Identities=23%  Similarity=0.366  Sum_probs=56.6

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-CCCC
Q ss_conf             987899998788880012217999999986-898999964765542222222222221222222222222222-2-2222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG-I-SKVH  101 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~-~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~-~-~~~~  101 (261)
                      +.-|+|+.||.+.+..+ .....+.+.+.+ .|.-+++.|. |-|  ..  ...---+.++++.+++.+.... + +-++
T Consensus        22 s~~P~ii~HGigd~c~~-~~~~~~~q~l~~~~g~~v~~lei-g~g--~~--~s~l~pl~~Qv~~~ce~v~~m~~lsqGyn   95 (296)
T KOG2541          22 SPVPVIVWHGIGDSCSS-LSMANLTQLLEELPGSPVYCLEI-GDG--IK--DSSLMPLWEQVDVACEKVKQMPELSQGYN   95 (296)
T ss_pred             CCCCEEEEECCCCCCCC-CHHHHHHHHHHHCCCCEEEEEEE-CCC--CC--HHHHCCHHHHHHHHHHHHHCCHHCCCCEE
T ss_conf             56878998056765355-21789999998689971699980-487--31--43322499999999999841212167637


Q ss_pred             CCCCCCCCCCHHHHHHHCCC-CCCCEE-EECCCC
Q ss_conf             23443444310133321023-565238-962885
Q gi|254780166|r  102 VMGYSMGARIACSMVLFYPS-YVRSVI-LGGVGS  133 (261)
Q Consensus       102 liGhS~Gg~ia~~~a~~~p~-~v~~lv-l~~~~~  133 (261)
                      ++|.|.||.++..++...|+ .+.++| +.++..
T Consensus        96 ivg~SQGglv~Raliq~cd~ppV~n~ISL~gPha  129 (296)
T KOG2541          96 IVGYSQGGLVARALIQFCDNPPVKNFISLGGPHA  129 (296)
T ss_pred             EEEECCCCHHHHHHHHHCCCCCCCEEEECCCCCC
T ss_conf             9997443299999998678987431575168757


No 151
>pfam05677 DUF818 Chlamydia CHLPS protein (DUF818). This family consists of several Chlamydia CHLPS proteins, the function of which are unknown.
Probab=96.83  E-value=0.0053  Score=36.96  Aligned_cols=91  Identities=19%  Similarity=0.183  Sum_probs=54.7

Q ss_pred             CCCEEEEECCCCCCCHHH---HHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----
Q ss_conf             987899998788880012---2179999999868-9899996476554222222222222122222222222222-----
Q gi|254780166|r   25 DAPTILLIHGLASSVQTN---WLFSGWIQLLCDQ-GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL-----   95 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~---~~~~~~~~~l~~~-g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l-----   95 (261)
                      ..+.++.--|.....+.-   ...+.++..+++. |=+++.|++||-+.|.++.     +.+.+++-.++.+.++     
T Consensus       136 ~dRWmLiSlGns~~lE~ra~~~~~dd~~~~~Ak~~~sNiLVfNYPGVmsS~G~~-----sr~~l~kayqacvryLrD~~~  210 (364)
T pfam05677       136 PDRWMLISLGNSDCLEERAMIGLKKSSWQRLAKLIGANILVFNYPGVMSSTGSI-----TRENLAKAYQACVRYLRDKEQ  210 (364)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCC-----CHHHHHHHHHHHHHHHHCCCC
T ss_conf             860699974781466547888257569999999746888998078622578988-----989999999999999753766


Q ss_pred             --CCCCCCCCCCCCCCCCHHHHHHHCC
Q ss_conf             --2222222344344431013332102
Q gi|254780166|r   96 --GISKVHVMGYSMGARIACSMVLFYP  120 (261)
Q Consensus        96 --~~~~~~liGhS~Gg~ia~~~a~~~p  120 (261)
                        +.++++-.|||+||.+-......++
T Consensus       211 Gp~AkqII~YGySlG~~vQa~AL~~~~  237 (364)
T pfam05677       211 GPGAKQIIAYGYSLGGLVQAEALSKEV  237 (364)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHCCC
T ss_conf             887301454112410578888874387


No 152
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]
Probab=96.67  E-value=0.005  Score=37.07  Aligned_cols=52  Identities=15%  Similarity=0.182  Sum_probs=38.5

Q ss_pred             CCCCCCCCC-C--CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC
Q ss_conf             222222222-2--222222234434443101333210235652389628856331
Q gi|254780166|r   86 ADAVSLLEH-L--GISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD  137 (261)
Q Consensus        86 ~di~~~i~~-l--~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~  137 (261)
                      +++.-++++ .  +-++-.++|||+||.+++.....+|+.+....++++.-.+..
T Consensus       122 ~~lkP~Ie~~y~~~~~~~~i~GhSlGGLfvl~aLL~~p~~F~~y~~~SPSlWw~n  176 (264)
T COG2819         122 EQLKPFIEARYRTNSERTAIIGHSLGGLFVLFALLTYPDCFGRYGLISPSLWWHN  176 (264)
T ss_pred             HHHHHHHHCCCCCCCCCCEEEEECCHHHHHHHHHHCCCCHHCEEEEECCHHHHCC
T ss_conf             8667888600636865515652041038889998628303203466161454278


No 153
>KOG1202 consensus
Probab=96.64  E-value=0.019  Score=33.57  Aligned_cols=214  Identities=12%  Similarity=0.100  Sum_probs=103.9

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             89987899998788880012217999999986898999964765542222222222221222222222222222-22222
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG-ISKVH  101 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~-~~~~~  101 (261)
                      ....|++.|+|..-+.+.   .    ++.++.+ -     ..|.||.--....+.+ |++..++-...-+.+++ .+++.
T Consensus      2120 ~se~~~~Ffv~pIEG~tt---~----l~~la~r-l-----e~PaYglQ~T~~vP~d-Sies~A~~yirqirkvQP~GPYr 2185 (2376)
T KOG1202        2120 QSEEPPLFFVHPIEGFTT---A----LESLASR-L-----EIPAYGLQCTEAVPLD-SIESLAAYYIRQIRKVQPEGPYR 2185 (2376)
T ss_pred             CCCCCCEEEEECCCCCHH---H----HHHHHHH-C-----CCCCHHHHCCCCCCCC-HHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             036895599813332127---7----8999863-5-----7771232203557800-59999999999987328899846


Q ss_pred             CCCCCCCCCCHHHHHHHC--CCCCCCEEEECCCCCCCCCCHH------------HHHHHH-HHHHC--CC----------
Q ss_conf             234434443101333210--2356523896288563311035------------699999-98631--11----------
Q gi|254780166|r  102 VMGYSMGARIACSMVLFY--PSYVRSVILGGVGSVLYDSDVV------------DWQSLI-DSFLL--PS----------  154 (261)
Q Consensus       102 liGhS~Gg~ia~~~a~~~--p~~v~~lvl~~~~~~~~~~~~~------------~~~~~~-~~~~~--~~----------  154 (261)
                      ++|+|+|+.++..+|..-  .+....+++.+..|.+...-..            ..+... ..+..  ..          
T Consensus      2186 l~GYSyG~~l~f~ma~~Lqe~~~~~~lillDGspty~~~Y~~~yr~~~~~g~~~~~es~~l~~f~~~~advdy~~~~~~L 2265 (2376)
T KOG1202        2186 LAGYSYGACLAFEMASQLQEQQSPAPLILLDGSPTYVLAYTQSYRAKLTDGCENEAESEALCYFGQQFADVDYNRLLELL 2265 (2376)
T ss_pred             EECCCHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             51132247899999999875237884799669629999999999987088767066778999999997216599999997


Q ss_pred             --CCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCC-CH---HHHHCCCCCEEEEEECCCC-CCCCHHHHHHHC-C
Q ss_conf             --10000111000000003476654135677765410122-00---1210035760699847888-788079999967-9
Q gi|254780166|r  155 --IDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF-CQ---DDLYRIDVPVLIAVGSQDD-LAGSPQELMSFI-P  226 (261)
Q Consensus       155 --~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~---~~l~~i~~P~l~i~G~~D~-~~~~~~~l~~~~-p  226 (261)
                        ...++..+.+..+.+..... .+++.++...+.+.... ..   ..-.++...+.++..+... .......+++.. .
T Consensus      2266 l~~~~~~~rv~k~vd~~~~~~~-q~~eti~~aa~~f~~Kl~lae~Ykp~~k~~~~v~Lira~~~~A~l~eDY~l~evc~~ 2344 (2376)
T KOG1202        2266 LPLPGWEERVAKAVDLIIKSHQ-QDRETIKFAARSFYYKLLLAEQYKPKAKLHGNVTLIRAKTGGAYLGEDYGLKEVCDG 2344 (2376)
T ss_pred             HCCCCHHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCEEEEEECCCCCEECCCCCHHHHCCC
T ss_conf             1588769999999999986436-899999999999999987653247243337737999726787421344385663367


Q ss_pred             CCEEEEECCCCCCCCCCCH--HHHHHHH
Q ss_conf             9799998888738434848--9999999
Q gi|254780166|r  227 SSQYLNICRRDHLLAVGDK--QFKQGVV  252 (261)
Q Consensus       227 ~~~~~~i~~~gH~~~~e~p--~~~~~i~  252 (261)
                      .+++.+++| .|--++|..  +..+.|+
T Consensus      2345 ~vevh~veG-dHrTfle~ssl~tie~il 2371 (2376)
T KOG1202        2345 KVEVHVVEG-DHRTFLEGSSLETIESIL 2371 (2376)
T ss_pred             CEEEEEEEC-CCCCCCCCCCHHHHHHHH
T ss_conf             615999704-643114775228999998


No 154
>KOG4372 consensus
Probab=96.60  E-value=0.0026  Score=38.81  Aligned_cols=101  Identities=16%  Similarity=0.197  Sum_probs=53.9

Q ss_pred             CCCCEEEEEEECCCCCCEEEEECCCCC-CCHHHHHHHHHHHHHHHCCCEEEEECCCCCC-CCCCCCCCCCCCCCCCCCCC
Q ss_conf             499499999964899878999987888-8001221799999998689899996476554-22222222222212222222
Q gi|254780166|r   11 WRKYQFAFYDVGDKDAPTILLIHGLAS-SVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG-KSDKSYIENDYRLVFMAADA   88 (261)
Q Consensus        11 ~dG~~l~y~~~g~~~~~~vv~iHG~~~-~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G-~S~~~~~~~~~s~~~~~~di   88 (261)
                      .+..++.+ ....++.--||+.||.-+ +..   .|...+...+.+ +.=.....+|+- -+..+.+-.++==+..++++
T Consensus        66 ~~~w~~p~-~~~~k~~HLvVlthGi~~~~~~---~~~~~~~~~~kk-~p~~~iv~~g~~~~~~~T~~Gv~~lG~Rla~~~  140 (405)
T KOG4372          66 EDLWDLPY-SFPTKPKHLVVLTHGLHGADME---YWKEKIEQMTKK-MPDKLIVVRGKMNNMCQTFDGVDVLGERLAEEV  140 (405)
T ss_pred             CCCCCCCC-CCCCCCCEEEEECCCCCCCCHH---HHHHHHHHHHCC-CCCCEEEEECCCCCHHHCCCCCEEEECCCHHHH
T ss_conf             22202786-6556796379961555543589---999877765217-975168650334421221456344210207887


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             2222222222222234434443101333
Q gi|254780166|r   89 VSLLEHLGISKVHVMGYSMGARIACSMV  116 (261)
Q Consensus        89 ~~~i~~l~~~~~~liGhS~Gg~ia~~~a  116 (261)
                      .+.+....++++.++|||+||.++..+.
T Consensus       141 ~e~~~~~si~kISfvghSLGGLvar~AI  168 (405)
T KOG4372         141 KETLYDYSIEKISFVGHSLGGLVARYAI  168 (405)
T ss_pred             HHHHHCCCCCEEEEEEEECCCEEEEEEE
T ss_conf             6543015543000455415772246787


No 155
>pfam07082 DUF1350 Protein of unknown function (DUF1350). This family consists of several hypothetical proteins from both cyanobacteria and plants. Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis.
Probab=96.54  E-value=0.024  Score=33.08  Aligned_cols=189  Identities=17%  Similarity=0.226  Sum_probs=90.7

Q ss_pred             EEEEECCC-CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC----CC----CCCCCCCCC
Q ss_conf             89999878-8880012217999999986898999964765542222222222221222222----22----222222222
Q gi|254780166|r   28 TILLIHGL-ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD----AV----SLLEHLGIS   98 (261)
Q Consensus        28 ~vv~iHG~-~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~d----i~----~~i~~l~~~   98 (261)
                      .|=|+-|. -+++. ...|..+.+.|+++||.|++.-+.= |          ++-...+++    .+    .+.+..+..
T Consensus        19 vIhFiGGaf~ga~P-~vtYr~lLe~L~~~g~~ViAtpy~~-~----------fDH~~iA~~v~~~F~~~~~~L~~~~g~~   86 (250)
T pfam07082        19 WIHFLGGAFVATAP-QLTYRWLLEHLGEAGYVVIATPFVN-T----------FDHGAIALSVLNKFEYALERLVHRGGYP   86 (250)
T ss_pred             EEEEECCHHHCCCC-HHHHHHHHHHHHHCCCEEEEECCCC-C----------CCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99970766542682-8899999999987896899923678-9----------8779999999999999999999734998


Q ss_pred             ----CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             ----2222344344431013332102356523896288563311035699999986311110000111000000003476
Q gi|254780166|r   99 ----KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDP  174 (261)
Q Consensus        99 ----~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  174 (261)
                          ++.-+|||+|+.+-+...+.++..-++.++++-..........    ..+.+        ...+.      .+..|
T Consensus        87 ~~~LPv~gvGHSlGckLhLLi~s~~~~~R~gniliSFNN~~A~~aIP----ll~~l--------~~~l~------~EF~P  148 (250)
T pfam07082        87 PAYLPIYGLGHSMGCKLHLLIGSLYDVERAGNILMAFNNYPAKQAIP----WMDNF--------GTALS------VEFTP  148 (250)
T ss_pred             CCCCCEECCCCCCCCHHHEEECCCCCCCCCCCEEEECCCCCHHHCCC----HHHHH--------CCCCC------CCCCC
T ss_conf             44475231343323165413223467875531354306843564272----59871--------84335------74346


Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCC---HHHHHHHCCC-CEEEEECCCCCCCCCCCH-----
Q ss_conf             6541356777654101220012100357606998478887880---7999996799-799998888738434848-----
Q gi|254780166|r  175 GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS---PQELMSFIPS-SQYLNICRRDHLLAVGDK-----  245 (261)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~---~~~l~~~~p~-~~~~~i~~~gH~~~~e~p-----  245 (261)
                        .++...+.   .     +..+ . .-.+|+|.=++|.+--+   .+.+....++ ++...++| .|.-...+.     
T Consensus       149 --sP~ET~~l---i-----~~~Y-~-v~rnLLIkF~~D~IDqt~~L~~~L~~R~~~~~~~~~L~G-~HlTP~~q~l~wq~  215 (250)
T pfam07082       149 --SPTETNHL---I-----QERY-P-VRRNLLIKFQNDDIDQTARLRSILRAKFGDMVTALKLPG-NHLTPLGQDLKWQT  215 (250)
T ss_pred             --CHHHHHHH---H-----HHHC-C-CCCCEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEECCC-CCCCCCCCCCCCCC
T ss_conf             --87999999---9-----9705-8-866358883798854659999998632468626898789-87785667767555


Q ss_pred             --HH--HHHHHHHHHHHC
Q ss_conf             --99--999999987516
Q gi|254780166|r  246 --QF--KQGVVNFYANEL  259 (261)
Q Consensus       246 --~~--~~~i~~Fl~~~~  259 (261)
                        +|  .+++-.|++..+
T Consensus       216 g~~ftP~Dai~Q~~k~~~  233 (250)
T pfam07082       216 GAEFSPLDALGQWIKQSL  233 (250)
T ss_pred             CCCCCCHHHHHHHHHHHH
T ss_conf             885683488999999988


No 156
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism]
Probab=96.48  E-value=0.0012  Score=40.68  Aligned_cols=123  Identities=18%  Similarity=0.163  Sum_probs=66.4

Q ss_pred             ECCCCEEEEE--EECCCCCCEEEEECCCCCC--CHHHHHHHHHHHHHHHCC-CEEEEECCCC--CCCCCCCCCC------
Q ss_conf             3499499999--9648998789999878888--001221799999998689-8999964765--5422222222------
Q gi|254780166|r   10 SWRKYQFAFY--DVGDKDAPTILLIHGLASS--VQTNWLFSGWIQLLCDQG-FRVIAFDNLG--HGKSDKSYIE------   76 (261)
Q Consensus        10 ~~dG~~l~y~--~~g~~~~~~vv~iHG~~~~--~~~~~~~~~~~~~l~~~g-~~vi~~D~~G--~G~S~~~~~~------   76 (261)
                      +.|...+..+  +...++.|.+|+|||.+-.  +.+...++  -..|+++| +-|+++++|=  .|.=+.+...      
T Consensus        76 sEDCL~LNIwaP~~~a~~~PVmV~IHGG~y~~Gs~s~~~yd--gs~La~~g~vVvVSvNYRLG~lGfL~~~~~~~~~~~~  153 (491)
T COG2272          76 SEDCLYLNIWAPEVPAEKLPVMVYIHGGGYIMGSGSEPLYD--GSALAARGDVVVVSVNYRLGALGFLDLSSLDTEDAFA  153 (491)
T ss_pred             CCCCEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCC--HHHHHHCCCEEEEEECCCCCCCEEEEHHHCCCCCCCC
T ss_conf             65440587612688888885799994661036877664458--6889754987999857624550012004205654433


Q ss_pred             CCCCCCCC---CCCCCCCCCCCCC--CCCCCCCCCCCCCCHHHHHH--HCCCCCCCEEEECCCCC
Q ss_conf             22221222---2222222222222--22222344344431013332--10235652389628856
Q gi|254780166|r   77 NDYRLVFM---AADAVSLLEHLGI--SKVHVMGYSMGARIACSMVL--FYPSYVRSVILGGVGSV  134 (261)
Q Consensus        77 ~~~s~~~~---~~di~~~i~~l~~--~~~~liGhS~Gg~ia~~~a~--~~p~~v~~lvl~~~~~~  134 (261)
                      .+..+.|+   .+.+.+-|+.++-  ++|.|+|+|-||+.++.+.+  .....++++|+-++...
T Consensus       154 ~n~Gl~DqilALkWV~~NIe~FGGDp~NVTl~GeSAGa~si~~Lla~P~AkGLF~rAi~~Sg~~~  218 (491)
T COG2272         154 SNLGLLDQILALKWVRDNIEAFGGDPQNVTLFGESAGAASILTLLAVPSAKGLFHRAIALSGAAS  218 (491)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHCCCCCHHHHHHHHHHCCCCC
T ss_conf             55138999999999999899848996314786205107999886627650178999998578877


No 157
>pfam00135 COesterase Carboxylesterase.
Probab=96.40  E-value=0.0025  Score=38.85  Aligned_cols=121  Identities=17%  Similarity=0.160  Sum_probs=62.7

Q ss_pred             CCCCEEEEEE-EC-C--CCCCEEEEECCCCCCCHHH--HHHHHHHHHHHHCCCEEEEECCC----CCCCCCCCCCCCCCC
Q ss_conf             4994999999-64-8--9987899998788880012--21799999998689899996476----554222222222222
Q gi|254780166|r   11 WRKYQFAFYD-VG-D--KDAPTILLIHGLASSVQTN--WLFSGWIQLLCDQGFRVIAFDNL----GHGKSDKSYIENDYR   80 (261)
Q Consensus        11 ~dG~~l~y~~-~g-~--~~~~~vv~iHG~~~~~~~~--~~~~~~~~~l~~~g~~vi~~D~~----G~G~S~~~~~~~~~s   80 (261)
                      .|=..|..+. .+ .  ..-|.+|+|||.+-...+.  ..+.. ...+++++.=||++.+|    |+=.+.....+.++.
T Consensus        89 EDCL~LNV~~P~~~~~~~~lPV~v~ihGG~f~~Gs~~~~~~~~-~~~~~~~~vIvVt~nYRLg~fGFl~~~~~~~~gN~G  167 (517)
T pfam00135        89 EDCLYLNVYTPKLASEGKNLPVMVWIHGGGFQSGSASLDDYDG-PDLAASEDVVVVTINYRLGALGFLSTGDSELPGNAG  167 (517)
T ss_pred             CCCCEEEEEECCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCC-HHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             7589789887899888899648999916863106788866664-577612997999857735634355679888887532


Q ss_pred             CCCCC---CCCCCCCCCCCC--CCCCCCCCCCCCCCHHHHHHH--CCCCCCCEEEECCC
Q ss_conf             12222---222222222222--222223443444310133321--02356523896288
Q gi|254780166|r   81 LVFMA---ADAVSLLEHLGI--SKVHVMGYSMGARIACSMVLF--YPSYVRSVILGGVG  132 (261)
Q Consensus        81 ~~~~~---~di~~~i~~l~~--~~~~liGhS~Gg~ia~~~a~~--~p~~v~~lvl~~~~  132 (261)
                      +.|+.   +.|++=|..+|-  ++|.|+|+|-||.-+..+...  ...++++.|+.+..
T Consensus       168 l~Dq~~AL~WV~~nI~~FGGDP~~VTi~G~SAGa~sv~~ll~sp~~~gLF~~aI~qSG~  226 (517)
T pfam00135       168 LLDQVLALRWVKDNIAAFGGDPDNVTLFGESAGAASVSLLLLSPLSRGLFHRAILMSGS  226 (517)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHHHHCCCCHHHHHHHHHCCCC
T ss_conf             79999999999999998388987489977632888887887494413767737751688


No 158
>KOG2182 consensus
Probab=96.37  E-value=0.0089  Score=35.60  Aligned_cols=110  Identities=18%  Similarity=0.250  Sum_probs=74.8

Q ss_pred             ECCCCCCEEEEECCCCCCCH-----HHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCC------CCCCCCCCCCC
Q ss_conf             64899878999987888800-----12217999999986898999964765542222222222------22122222222
Q gi|254780166|r   21 VGDKDAPTILLIHGLASSVQ-----TNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND------YRLVFMAADAV   89 (261)
Q Consensus        21 ~g~~~~~~vv~iHG~~~~~~-----~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~------~s~~~~~~di~   89 (261)
                      +-.+++|..++|-|=|.-..     ....|..++.++   |=.|+-.+.|=||.|- |..+..      .|.+....|+.
T Consensus        81 ~~~~~gPiFLmIGGEgp~~~~wv~~~~~~~~~~Akkf---gA~v~~lEHRFYG~S~-P~~~~st~nlk~LSs~QALaDla  156 (514)
T KOG2182          81 WAKPGGPIFLMIGGEGPESDKWVGNENLTWLQWAKKF---GATVFQLEHRFYGQSS-PIGDLSTSNLKYLSSLQALADLA  156 (514)
T ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHH---CCEEEEEEEECCCCCC-CCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             1369996699976778778873356760699999982---9826886400036677-88877640056660898999899


Q ss_pred             CCCCCCCC-------CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             22222222-------22222344344431013332102356523896288563
Q gi|254780166|r   90 SLLEHLGI-------SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL  135 (261)
Q Consensus        90 ~~i~~l~~-------~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~  135 (261)
                      ++|++++.       .+++.+|-|+-|.++.=+=..||+.+.+-|.. .+|..
T Consensus       157 ~fI~~~n~k~n~~~~~~WitFGgSYsGsLsAW~R~~yPel~~GsvAS-Sapv~  208 (514)
T KOG2182         157 EFIKAMNAKFNFSDDSKWITFGGSYSGSLSAWFREKYPELTVGSVAS-SAPVL  208 (514)
T ss_pred             HHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHCCHHHEEECCC-CCCEE
T ss_conf             99999876527778997699788770089999987583454343014-65346


No 159
>pfam06441 EHN Epoxide hydrolase N terminus. This family represents the N-terminal region of the eukaryotic epoxide hydrolase protein. Epoxide hydrolases (EC:3.3.2.3) comprise a group of functionally related enzymes that catalyse the addition of water to oxirane compounds (epoxides), thereby usually generating vicinal trans-diols. EHs have been found in all types of living organisms, including mammals, invertebrates, plants, fungi and bacteria. In animals, the major interest in EH is directed towards their detoxification capacity for epoxides since they are important safeguards against the cytotoxic and genotoxic potential of oxirane derivatives that are often reactive electrophiles because of the high tension of the three-membered ring system and the strong polarisation of the C--O bonds. This is of significant relevance because epoxides are frequent intermediary metabolites which arise during the biotransformation of foreign compounds. This family is often found in conjunction with pf
Probab=96.23  E-value=0.0072  Score=36.15  Aligned_cols=35  Identities=29%  Similarity=0.391  Sum_probs=27.0

Q ss_pred             EEEEECCCCEEEEEEEC--CCCCCEEEEECCCCCCCH
Q ss_conf             79993499499999964--899878999987888800
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVG--DKDAPTILLIHGLASSVQ   40 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g--~~~~~~vv~iHG~~~~~~   40 (261)
                      .|-++.+|..|||....  ++++.|+||+||++||.-
T Consensus        66 ~f~t~I~g~~iHFih~~s~~~~aiPLll~HGWPgSf~  102 (108)
T pfam06441        66 QFTTEIDGLDIHFIHVRSKGPDAIPLLLTHGWPGSFL  102 (108)
T ss_pred             CEEEEECCEEEEEEEEECCCCCCEEEEEECCCCCCHH
T ss_conf             5499974888999997479999706899589997187


No 160
>KOG3967 consensus
Probab=96.15  E-value=0.011  Score=35.07  Aligned_cols=107  Identities=20%  Similarity=0.243  Sum_probs=60.2

Q ss_pred             CCEEEEECCCCCCCHHHHHHH-------------HHHHHHHHCCCEEEEECCCCCC-CCCCCCCCCCC--CCCCCCC-CC
Q ss_conf             878999987888800122179-------------9999998689899996476554-22222222222--2122222-22
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFS-------------GWIQLLCDQGFRVIAFDNLGHG-KSDKSYIENDY--RLVFMAA-DA   88 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~-------------~~~~~l~~~g~~vi~~D~~G~G-~S~~~~~~~~~--s~~~~~~-di   88 (261)
                      ...+|+|||.|--....|.-.             +.+..-.+.||.|+..+---.- .-++..++..|  +....++ -.
T Consensus       101 ~kLlVLIHGSGvVrAGQWARrLIIN~~Ld~GTQiPyi~rAv~~Gygviv~N~N~~~kfye~k~np~kyirt~veh~~yvw  180 (297)
T KOG3967         101 QKLLVLIHGSGVVRAGQWARRLIINEDLDSGTQIPYIKRAVAEGYGVIVLNPNRERKFYEKKRNPQKYIRTPVEHAKYVW  180 (297)
T ss_pred             CCEEEEEECCCEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEECCCHHHHHHHCCCCCCHHCCCHHHHHHHHH
T ss_conf             21599992682576045766652036634577570899998738767996775124555423583000266278899999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC--CCCCCEEEECCC
Q ss_conf             22222222222222344344431013332102--356523896288
Q gi|254780166|r   89 VSLLEHLGISKVHVMGYSMGARIACSMVLFYP--SYVRSVILGGVG  132 (261)
Q Consensus        89 ~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p--~~v~~lvl~~~~  132 (261)
                      ..++.-...+.+.++.||+||...+.+..++|  ++|.++.|.++.
T Consensus       181 ~~~v~pa~~~sv~vvahsyGG~~t~~l~~~f~~d~~v~aialTDs~  226 (297)
T KOG3967         181 KNIVLPAKAESVFVVAHSYGGSLTLDLVERFPDDESVFAIALTDSA  226 (297)
T ss_pred             HHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCCCCCEEEEEEECCC
T ss_conf             9985415764489998323772489999864886545789850454


No 161
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion]
Probab=96.12  E-value=0.0053  Score=36.95  Aligned_cols=178  Identities=16%  Similarity=0.151  Sum_probs=93.1

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC
Q ss_conf             8789999878888001221799999998689899996476554222222222222122222222222222----222222
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL----GISKVH  101 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l----~~~~~~  101 (261)
                      ...-||..|=|+=.+   .=+.....|+++|+.|+-+|-.-|=.|++       +.+..++|+-.++.+.    +.+++.
T Consensus       260 d~~av~~SGDGGWr~---lDk~v~~~l~~~gvpVvGvdsLRYfW~~r-------tPe~~a~Dl~r~i~~y~~~w~~~~~~  329 (456)
T COG3946         260 DTVAVFYSGDGGWRD---LDKEVAEALQKQGVPVVGVDSLRYFWSER-------TPEQIAADLSRLIRFYARRWGAKRVL  329 (456)
T ss_pred             CEEEEEEECCCCHHH---HHHHHHHHHHHCCCCEEEEEHHHHHHCCC-------CHHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             569999836873656---44999999997799556430023551568-------97888777999999998863764389


Q ss_pred             CCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHH--HHHHHHCCCCCCCCCCCHH
Q ss_conf             23443444310133321023565238962885633110356999999863111100001--1100000000347665413
Q gi|254780166|r  102 VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQN--PLGKKFRKFADLDPGNDLK  179 (261)
Q Consensus       102 liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~  179 (261)
                      |+|+|+|+-+.-..-.+-|...                    +..+.....-.+.....  .....|......       
T Consensus       330 liGySfGADvlP~~~n~L~~~~--------------------r~~v~~~~ll~l~~~~~fe~~v~gWlg~~~~-------  382 (456)
T COG3946         330 LIGYSFGADVLPFAYNRLPPAT--------------------RQRVRMVSLLGLGRTADFEISVEGWLGMAGE-------  382 (456)
T ss_pred             EEEECCCCHHHHHHHHHCCHHH--------------------HHHHHHHHHHHCCCCCEEEEEEEEEECCCCC-------
T ss_conf             9960466404689987588778--------------------8899999997415543279999655303776-------


Q ss_pred             HHHHHHHHHCCCCCHHHHHCCC-CCEEEEEECCCC--CCCCHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             5677765410122001210035-760699847888--788079999967997999988887384348489999999998
Q gi|254780166|r  180 ALASCLSMIRKPFCQDDLYRID-VPVLIAVGSQDD--LAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFY  255 (261)
Q Consensus       180 ~~~~~~~~~~~~~~~~~l~~i~-~P~l~i~G~~D~--~~~~~~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~Fl  255 (261)
                               ...+.-+++.+|. .-+.+|.|.+|+  .+|..+     -.+.+++.+||+.|| --+-..+...|++=+
T Consensus       383 ---------g~~~~~~~~~~l~~~~v~CiYG~~e~d~~Cp~l~-----~~~~~~v~lpGgHHF-d~dy~~la~~il~~~  446 (456)
T COG3946         383 ---------GAGDVVPDIAKLPLARVQCIYGQEEKDTACPSLK-----AKGVDTVKLPGGHHF-DGDYEKLAKAILQGM  446 (456)
T ss_pred             ---------CCCCCCHHHHHCCCCEEEEEECCCCCCCCCCCCH-----HHCCEEEECCCCCCC-CCCHHHHHHHHHHHH
T ss_conf             ---------7777642555077440688745766556687641-----114346744787666-752899999999988


No 162
>COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism]
Probab=96.05  E-value=0.051  Score=31.08  Aligned_cols=105  Identities=17%  Similarity=0.127  Sum_probs=70.8

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             87899998788880012217999999986898999964765542222222222221222222222222222222222344
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGY  105 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGh  105 (261)
                      .|.|+.+-...|++  .+.....++.|... ..|+.-|+..-  .--|.....+.++++++-+.+.++.++-+ +++++.
T Consensus       103 dPkvLivapmsGH~--aTLLR~TV~alLp~-~~vyitDW~dA--r~Vp~~~G~FdldDYIdyvie~~~~~Gp~-~hv~aV  176 (415)
T COG4553         103 DPKVLIVAPMSGHY--ATLLRGTVEALLPY-HDVYITDWVDA--RMVPLEAGHFDLDDYIDYVIEMINFLGPD-AHVMAV  176 (415)
T ss_pred             CCEEEEEECCCCCH--HHHHHHHHHHHCCC-CCEEEEECCCC--CEEECCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEE
T ss_conf             97089983266307--99998889986655-64468531221--34432467766788999999999973999-747887


Q ss_pred             CCCCC-----CHHHHHHHCCCCCCCEEEECCCCCCC
Q ss_conf             34443-----10133321023565238962885633
Q gi|254780166|r  106 SMGAR-----IACSMVLFYPSYVRSVILGGVGSVLY  136 (261)
Q Consensus       106 S~Gg~-----ia~~~a~~~p~~v~~lvl~~~~~~~~  136 (261)
                      +.-+.     +++..+...|..-+++++.+......
T Consensus       177 CQP~vPvLAAisLM~~~~~p~~PssMtlmGgPIDaR  212 (415)
T COG4553         177 CQPTVPVLAAISLMEEDGDPNVPSSMTLMGGPIDAR  212 (415)
T ss_pred             ECCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCCC
T ss_conf             069824999999997529999973456515754345


No 163
>KOG2369 consensus
Probab=95.98  E-value=0.0016  Score=39.99  Aligned_cols=72  Identities=17%  Similarity=0.194  Sum_probs=47.9

Q ss_pred             HHHHHHHHHHHHCCCE------EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCH
Q ss_conf             2179999999868989------9996476554222222222222122222222222222----22222223443444310
Q gi|254780166|r   43 WLFSGWIQLLCDQGFR------VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL----GISKVHVMGYSMGARIA  112 (261)
Q Consensus        43 ~~~~~~~~~l~~~g~~------vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l----~~~~~~liGhS~Gg~ia  112 (261)
                      +.|..+++.+..-||.      -..||+|= +    ....+  ..+.+..++...+|..    +-+|++|++||||+.+.
T Consensus       124 ~~w~~~i~~lv~~GYe~~~~l~ga~YDwRl-s----~~~~e--~rd~yl~kLK~~iE~~~~~~G~kkVvlisHSMG~l~~  196 (473)
T KOG2369         124 WYWHELIENLVGIGYERGKTLFGAPYDWRL-S----YHNSE--ERDQYLSKLKKKIETMYKLNGGKKVVLISHSMGGLYV  196 (473)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEECCCCCHHH-C----CCCHH--HHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHH
T ss_conf             999999999876172168625505533300-5----68755--7779999999999999987289746999537741799


Q ss_pred             HHHHHHCCC
Q ss_conf             133321023
Q gi|254780166|r  113 CSMVLFYPS  121 (261)
Q Consensus       113 ~~~a~~~p~  121 (261)
                      +.+...+++
T Consensus       197 lyFl~w~~~  205 (473)
T KOG2369         197 LYFLKWVEA  205 (473)
T ss_pred             HHHHHCCCC
T ss_conf             998740653


No 164
>KOG2183 consensus
Probab=95.94  E-value=0.0047  Score=37.26  Aligned_cols=101  Identities=22%  Similarity=0.226  Sum_probs=63.4

Q ss_pred             CCCCEEEEECCCCCCCHHH-----HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC---------CCCCCCCCCC
Q ss_conf             9987899998788880012-----2179999999868989999647655422222222222---------2122222222
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTN-----WLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY---------RLVFMAADAV   89 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~-----~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~---------s~~~~~~di~   89 (261)
                      +++.||+|--|.-|+.+.+     ++|+ +++.+   +=-+|-.+.|=||+|- |.....|         +.++-..|..
T Consensus        78 ~g~gPIffYtGNEGdie~Fa~ntGFm~D-~Ap~~---~AllVFaEHRyYGeS~-PFG~~s~k~~~hlgyLtseQALADfA  152 (492)
T KOG2183          78 KGEGPIFFYTGNEGDIEWFANNTGFMWD-LAPEL---KALLVFAEHRYYGESL-PFGSQSYKDARHLGYLTSEQALADFA  152 (492)
T ss_pred             CCCCCEEEEECCCCCHHHHHHCCCHHHH-HHHHH---CCEEEEEEHHCCCCCC-CCCCHHCCCHHHHCCCCHHHHHHHHH
T ss_conf             7987669994785218888741215876-43763---7527974400046677-88530005746541110898899999


Q ss_pred             CCCCCCCC------CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEE
Q ss_conf             22222222------22222344344431013332102356523896
Q gi|254780166|r   90 SLLEHLGI------SKVHVMGYSMGARIACSMVLFYPSYVRSVILG  129 (261)
Q Consensus        90 ~~i~~l~~------~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~  129 (261)
                      +++..++-      .+|+.+|-|+||+++.=+-.+||..+.+....
T Consensus       153 ~ll~~lK~~~~a~~~pvIafGGSYGGMLaAWfRlKYPHiv~GAlAa  198 (492)
T KOG2183         153 ELLTFLKRDLSAEASPVIAFGGSYGGMLAAWFRLKYPHIVLGALAA  198 (492)
T ss_pred             HHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHCCHHHHHHHHHC
T ss_conf             9999986322300295899547225699999971170666415651


No 165
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II; InterPro: IPR011287   This entry represents the class II subfamily of poly(R)-hydroxyalkanoate synthases, which polymerises hydroxyacyl-CoAs, typically with six to fourteen carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids . These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell.; GO: 0008415 acyltransferase activity, 0042619 poly-hydroxybutyrate biosynthetic process.
Probab=95.93  E-value=0.048  Score=31.23  Aligned_cols=210  Identities=10%  Similarity=0.152  Sum_probs=112.7

Q ss_pred             CCCEEEEECC-------CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             9878999987-------8888001221799999998689899996476554222222222222122222222222222--
Q gi|254780166|r   25 DAPTILLIHG-------LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL--   95 (261)
Q Consensus        25 ~~~~vv~iHG-------~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l--   95 (261)
                      -+.|++.++.       |-.|.     -+.++++..+.+-.|+.+-+|     ..+.....+.+..+++-+.+.++..  
T Consensus       214 ~ArPLLvVPPQINKfYiFDLSp-----~~S~~~Y~Lk~~~Q~F~iSWR-----NP~~~~REWGLStYv~AL~~A~~~~~~  283 (560)
T TIGR01839       214 HARPLLVVPPQINKFYIFDLSP-----EKSFVQYALKNQLQVFIISWR-----NPDKAHREWGLSTYVDALEEAVDAVRA  283 (560)
T ss_pred             CCCCEEECCCCCCCEEEEECCC-----HHHHHHHHHHCCCEEEEEEEC-----CCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             0552043388766347760374-----267999997528808999605-----987101325406799999999999875


Q ss_pred             --CCCCCCCCCCCCCCCCHHHH----HHHCCC-CCCCEEE-ECCCCC--------CCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             --22222223443444310133----321023-5652389-628856--------3311035699999986311110000
Q gi|254780166|r   96 --GISKVHVMGYSMGARIACSM----VLFYPS-YVRSVIL-GGVGSV--------LYDSDVVDWQSLIDSFLLPSIDEVQ  159 (261)
Q Consensus        96 --~~~~~~liGhS~Gg~ia~~~----a~~~p~-~v~~lvl-~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~  159 (261)
                        |-+.+-++|-+-||.....+    ++++.. +|+++++ ++....        ..+....+-.++ .+.-.+.++..+
T Consensus       284 ItG~~d~Nl~GACaGGlT~aAL~GHl~~~~~~RkV~s~T~LVSlLDs~~~~~~~LF~DEQTlEaaKR-~SYQ~GVLdG~e  362 (560)
T TIGR01839       284 ITGSRDLNLLGACAGGLTVAALLGHLQAKRQLRKVNSLTYLVSLLDSKMESPAALFADEQTLEAAKR-RSYQAGVLDGSE  362 (560)
T ss_pred             HCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHH-HHHHCCCCCHHH
T ss_conf             1488760011015147899999989999753021456777777663145664011100345666532-344215645234


Q ss_pred             --HHHH--HH----HCCC-CCCCCCCC----------------HHHHHHHH-HHH-----------CCCCCHHHHHCCCC
Q ss_conf             --1110--00----0000-03476654----------------13567776-541-----------01220012100357
Q gi|254780166|r  160 --NPLG--KK----FRKF-ADLDPGND----------------LKALASCL-SMI-----------RKPFCQDDLYRIDV  202 (261)
Q Consensus       160 --~~~~--~~----~~~~-~~~~~~~~----------------~~~~~~~~-~~~-----------~~~~~~~~l~~i~~  202 (261)
                        +.++  +.    |..+ .....++.                +.++..-+ ..+           .--...-+|+++.+
T Consensus       363 ~AkvFAWMRPNDLIWNYWVNNYLLG~~PP~FDILyWN~D~TRLPAA~HGdLld~FK~NPLTrP~aLEVcGTpiDL~~V~~  442 (560)
T TIGR01839       363 MAKVFAWMRPNDLIWNYWVNNYLLGKEPPAFDILYWNNDTTRLPAAFHGDLLDLFKSNPLTRPDALEVCGTPIDLKKVKL  442 (560)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEECCCCEECCEEEE
T ss_conf             67665106866220243455453068768112553058886673665336999961378889876032365000130434


Q ss_pred             CEEEEEECCCCCCC--CHHHHHHHCCCCEEEEECCCCCCC-CCCCH
Q ss_conf             60699847888788--079999967997999988887384-34848
Q gi|254780166|r  203 PVLIAVGSQDDLAG--SPQELMSFIPSSQYLNICRRDHLL-AVGDK  245 (261)
Q Consensus       203 P~l~i~G~~D~~~~--~~~~l~~~~p~~~~~~i~~~gH~~-~~e~p  245 (261)
                      ...-+.|.+|.++|  ...+-+..+.+-+-.++.++||.- .+.+|
T Consensus       443 D~f~vAG~~DHITPW~avYRSA~LlGG~~~FvLsNSGHIQSIlNPP  488 (560)
T TIGR01839       443 DSFSVAGTNDHITPWDAVYRSALLLGGKRRFVLSNSGHIQSILNPP  488 (560)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCEEECCCCC
T ss_conf             4565347778878427898888870895479873477222201811


No 166
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism]
Probab=95.75  E-value=0.016  Score=34.09  Aligned_cols=183  Identities=15%  Similarity=0.075  Sum_probs=90.9

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCC----EEEEECCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCC-C
Q ss_conf             987899998788880012217999999986898----99996476554222222222222----12222222222222-2
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGF----RVIAFDNLGHGKSDKSYIENDYR----LVFMAADAVSLLEH-L   95 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~----~vi~~D~~G~G~S~~~~~~~~~s----~~~~~~di~~~i~~-l   95 (261)
                      .-|.+++.||--  .-.+.....+++.+..+|-    -++-+|.-   +... ....-+.    ....+.++.=.++. +
T Consensus        97 k~pvl~~~DG~~--~~~~g~i~~~~dsli~~g~i~pai~vgid~~---d~~~-R~~~~~~n~~~~~~L~~eLlP~v~~~y  170 (299)
T COG2382          97 KYPVLYLQDGQD--WFRSGRIPRILDSLIAAGEIPPAILVGIDYI---DVKK-RREELHCNEAYWRFLAQELLPYVEERY  170 (299)
T ss_pred             CCCEEEEECCHH--HHHCCCHHHHHHHHHHCCCCCCCEEEECCCC---CHHH-HHHHHCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             354799963288--8863876899999997087888469811877---7899-998825608999999988666421217


Q ss_pred             C----CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCC
Q ss_conf             2----222222344344431013332102356523896288563311035699999986311110000111000000003
Q gi|254780166|r   96 G----ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFAD  171 (261)
Q Consensus        96 ~----~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  171 (261)
                      .    -+.-+|.|-|+||.+++..+..||+++..++.-++..........                 .......      
T Consensus       171 p~~~~a~~r~LaG~SlGG~vsL~agl~~Pe~FG~V~s~Sps~~~~~~~~~-----------------~~~~~~~------  227 (299)
T COG2382         171 PTSADADGRVLAGDSLGGLVSLYAGLRHPERFGHVLSQSGSFWWTPLDTQ-----------------PQGEVAE------  227 (299)
T ss_pred             CCCCCCCCCEEECCCCCCHHHHHHHHCCCHHHCEEECCCCCCCCCCCCCC-----------------CCCCHHH------
T ss_conf             64323777578403623299999984592332223214886556754432-----------------2110121------


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHCC----CCEEEEECCCCCCCCCCCHHH
Q ss_conf             4766541356777654101220012100357606998478887880799999679----979999888873843484899
Q gi|254780166|r  172 LDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIP----SSQYLNICRRDHLLAVGDKQF  247 (261)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~p----~~~~~~i~~~gH~~~~e~p~~  247 (261)
                                        ..........-..-++...++.+.+.++.+++++.+.    ...+..++| ||--..=+|.+
T Consensus       228 ------------------~l~~~~a~~~~~~~~l~~g~~~~~~~~pNr~L~~~L~~~g~~~~yre~~G-gHdw~~Wr~~l  288 (299)
T COG2382         228 ------------------SLKILHAIGTDERIVLTTGGEEGDFLRPNRALAAQLEKKGIPYYYREYPG-GHDWAWWRPAL  288 (299)
T ss_pred             ------------------HHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEECCC-CCCHHHHHHHH
T ss_conf             ------------------10023236763047860477631113665999999986698513665479-97646757889


Q ss_pred             HHHHHHHH
Q ss_conf             99999998
Q gi|254780166|r  248 KQGVVNFY  255 (261)
Q Consensus       248 ~~~i~~Fl  255 (261)
                      .+.+...+
T Consensus       289 ~~~L~~l~  296 (299)
T COG2382         289 AEGLQLLL  296 (299)
T ss_pred             HHHHHHHH
T ss_conf             99999860


No 167
>TIGR01840 esterase_phb esterase, PHB depolymerase family; InterPro: IPR010126   This entry describes a group of lipases of the ab-hydrolase family. They include bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, and feruloyl esterases from fungi.; GO: 0005576 extracellular region.
Probab=95.66  E-value=0.011  Score=35.13  Aligned_cols=167  Identities=16%  Similarity=0.155  Sum_probs=88.3

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHH----HHHHHHHC-CCEEEEECCCCCCCCCCCC--CCCCCCCC------CCCCCCCCC
Q ss_conf             98789999878888001221799----99999868-9899996476554222222--22222212------222222222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSG----WIQLLCDQ-GFRVIAFDNLGHGKSDKSY--IENDYRLV------FMAADAVSL   91 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~----~~~~l~~~-g~~vi~~D~~G~G~S~~~~--~~~~~s~~------~~~~di~~~   91 (261)
                      .+|-||-|||=+.++.....=..    -+..+|++ ||-|++|...+.--+.+..  .-..+..+      ..+.+|+++
T Consensus        17 ~raLV~~LHGC~QTAs~~~~~~GdnGyNW~~~A~~YGf~~vaP~~~~~~~~~~~~sGCw~wf~~~h~~R~~Ge~~~l~~l   96 (231)
T TIGR01840        17 KRALVLALHGCGQTASAYVIDKGDNGYNWKAAADKYGFVVVAPEQTSSNSSNKQASGCWDWFETEHRARGTGEVVSLKQL   96 (231)
T ss_pred             CCCEEEEECCCCCCCCHHHHHCCCCCHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             97347762277411112545168876207889855896886142027666542345565777755567777652789999


Q ss_pred             CCCC------CC--CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             2222------22--222223443444310133321023565238962885633110356999999863111100001110
Q gi|254780166|r   92 LEHL------GI--SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLG  163 (261)
Q Consensus        92 i~~l------~~--~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (261)
                      |+++      .|  .++.+-|.|-||....-++..|||.+++.--++..+.-......      ..+...     ..   
T Consensus        97 i~~~~~~~~~~IDP~rvyvTGLSaGGgmT~V~~~t~PdvFAg~A~~aG~pyG~a~~~~------~~~~~~-----~~---  162 (231)
T TIGR01840        97 IDAVKADTNYSIDPNRVYVTGLSAGGGMTAVLGATYPDVFAGGASNAGLPYGEASSSI------SALPKM-----SH---  162 (231)
T ss_pred             HHHHHCCCCCCCCCCEEEEEEECCHHHHHHHHHHCCCCHHHHHCCCCCCCCCCCCCCC------CCCCCC-----CC---
T ss_conf             9997347788638854588421423899998874056355310112578746542100------057788-----88---


Q ss_pred             HHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH
Q ss_conf             0000000347665413567776541012200121003576069984788878807
Q gi|254780166|r  164 KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP  218 (261)
Q Consensus       164 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~  218 (261)
                                  ...+...+.....+.... +.-....+|+.+++|+.|..|.+.
T Consensus       163 ------------~~~~~~~~~~~~~~g~~s-~~~~~~pIP~~v~~G~~D~TV~~~  204 (231)
T TIGR01840       163 ------------STAKTAAEVGRLVRGSQS-EYNGPTPIPMSVVHGDADYTVLPG  204 (231)
T ss_pred             ------------CCCCCHHHHHHHHCCCCC-CCCCCCCCEEEEEECCCCCCCCCC
T ss_conf             ------------766327888787606656-777788861278777857502510


No 168
>COG2830 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=95.35  E-value=0.12  Score=28.81  Aligned_cols=182  Identities=13%  Similarity=0.167  Sum_probs=85.8

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCCE-EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8999987888800122179999999868989-999647655422222222222212222222222222222222223443
Q gi|254780166|r   28 TILLIHGLASSVQTNWLFSGWIQLLCDQGFR-VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYS  106 (261)
Q Consensus        28 ~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~-vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS  106 (261)
                      .||..-|||+....   ...+   ..++.+. +++||+...        .-++++.             ....+-||++|
T Consensus        13 LIvyFaGwgtpps~---v~HL---ilpeN~dl~lcYDY~dl--------~ldfDfs-------------Ay~hirlvAwS   65 (214)
T COG2830          13 LIVYFAGWGTPPSA---VNHL---ILPENHDLLLCYDYQDL--------NLDFDFS-------------AYRHIRLVAWS   65 (214)
T ss_pred             EEEEEECCCCCHHH---HHHC---CCCCCCCEEEEEEHHHC--------CCCCCHH-------------HHHHHHHHHHH
T ss_conf             99998347898788---7440---27887747999602223--------7665524-------------43312322346


Q ss_pred             CCCCCHHHHHHHCCCCCCCEEEECCCCCCCC-C---CHHHHHHHHHHHHCCCCCHHHHHHHH---HHCCC--CCCCCCCC
Q ss_conf             4443101333210235652389628856331-1---03569999998631111000011100---00000--03476654
Q gi|254780166|r  107 MGARIACSMVLFYPSYVRSVILGGVGSVLYD-S---DVVDWQSLIDSFLLPSIDEVQNPLGK---KFRKF--ADLDPGND  177 (261)
Q Consensus       107 ~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~-~---~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~--~~~~~~~~  177 (261)
                      ||-.+|-++....  ++++-+.++.....-+ +   ....+......+.....-..+...-.   .++.+  ....+...
T Consensus        66 MGVwvAeR~lqg~--~lksatAiNGTgLpcDds~GIp~AIF~gTL~nl~e~nr~kFerricg~k~~l~~yq~f~~rp~~e  143 (214)
T COG2830          66 MGVWVAERVLQGI--RLKSATAINGTGLPCDDSFGIPPAIFKGTLENLTENNRLKFERRICGDKASLEDYQIFPARPFLE  143 (214)
T ss_pred             HHHHHHHHHHHHC--CCCCEEEECCCCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHCCCCCHHHH
T ss_conf             7799999998116--61101345477888654579888999878850350127899998754601112321567671789


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCC
Q ss_conf             13567776541012200121003576069984788878807999996799799998888738434
Q gi|254780166|r  178 LKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV  242 (261)
Q Consensus       178 ~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~~~~~~i~~~gH~~~~  242 (261)
                      .+.-....-++...+.+.++-.-+   -.+.|..|++.|+..+-+-..+.|.+..|.+ +|+.+.
T Consensus       144 Ih~El~alfa~i~Qdrr~dli~W~---ka~v~skDkIFpp~nq~ayw~~rc~v~ei~g-~H~~F~  204 (214)
T COG2830         144 IHQELTALFAMIQQDRRTDLILWD---KAYVGSKDKIFPPANQHAYWNARCAVIEING-EHYLFS  204 (214)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH---HHHCCCCCCCCCCCCHHHHHCCCEEEEEECC-CCEEEE
T ss_conf             999999999998501112343023---4430677720697306666400206888358-606776


No 169
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism]
Probab=95.22  E-value=0.021  Score=33.35  Aligned_cols=94  Identities=18%  Similarity=0.150  Sum_probs=56.0

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHH----------------HHHHCCCEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98789999878888001221799999----------------9986898999964-765542222222222221222222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQ----------------LLCDQGFRVIAFD-NLGHGKSDKSYIENDYRLVFMAAD   87 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~----------------~l~~~g~~vi~~D-~~G~G~S~~~~~~~~~s~~~~~~d   87 (261)
                      +.|.++.+.|.+|++.....+-.+-+                .+...+ .++-+| -.|-|.|....+...-+++...+|
T Consensus       100 ~rPvi~wlNGGPGcSS~~g~l~elGP~rI~~~~~P~~~~NP~SW~~~a-dLvFiDqPvGTGfS~a~~~e~~~d~~~~~~D  178 (498)
T COG2939         100 NRPVIFWLNGGPGCSSVTGLLGELGPKRIQSGTSPSYPDNPGSWLDFA-DLVFIDQPVGTGFSRALGDEKKKDFEGAGKD  178 (498)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCC-CEEEEECCCCCCCCCCCCCCCCCCHHCCCHH
T ss_conf             786699966889717655356633983630799999999942201477-5699716766674545542112231002112


Q ss_pred             CCCCCCCC--------C-CCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             22222222--------2-22222234434443101333210
Q gi|254780166|r   88 AVSLLEHL--------G-ISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        88 i~~~i~~l--------~-~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      +..+.+.+        + ..+.+|+|-|+||.-+..+|..-
T Consensus       179 ~~~~~~~f~~~fp~~~r~~~~~~L~GESYgg~yip~~A~~L  219 (498)
T COG2939         179 VYSFLRLFFDKFPHYARLLSPKFLAGESYGGHYIPVFAHEL  219 (498)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             99999999999898765047606730452102568999999


No 170
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=95.00  E-value=0.037  Score=31.91  Aligned_cols=180  Identities=19%  Similarity=0.215  Sum_probs=88.3

Q ss_pred             CCCEEEEEEECCCCCCEEEEECCCCCCCHH---HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             994999999648998789999878888001---221799999998689899996476554222222222222122222--
Q gi|254780166|r   12 RKYQFAFYDVGDKDAPTILLIHGLASSVQT---NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA--   86 (261)
Q Consensus        12 dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~---~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~--   86 (261)
                      =+..+.|-.+|-.+.|.|||-..-| ....   .-....+++.+ ++| ++-.+.+.|-- |+.- -.......+.++  
T Consensus        13 L~RdMel~ryGHaG~pVvvFpts~G-rf~eyed~G~v~ala~fi-e~G-~vQlft~~gld-sESf-~a~h~~~adr~~rH   87 (227)
T COG4947          13 LNRDMELNRYGHAGIPVVVFPTSGG-RFNEYEDFGMVDALASFI-EEG-LVQLFTLSGLD-SESF-LATHKNAADRAERH   87 (227)
T ss_pred             CCCHHHHHHCCCCCCCEEEEECCCC-CCHHHHHCCCHHHHHHHH-HCC-CEEEEEECCCC-HHHH-HHHCCCHHHHHHHH
T ss_conf             3630455641678973799766998-512345300289999998-608-27999843643-6767-65237878888988


Q ss_pred             --CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             --222222222222222234434443101333210235652389628856331103569999998631111000011100
Q gi|254780166|r   87 --DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGK  164 (261)
Q Consensus        87 --di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (261)
                        --..++++.-....++-|.||||+.+..+..++|+..+++|..+......            .+.           +.
T Consensus        88 ~AyerYv~eEalpgs~~~sgcsmGayhA~nfvfrhP~lftkvialSGvYdar------------dff-----------g~  144 (227)
T COG4947          88 RAYERYVIEEALPGSTIVSGCSMGAYHAANFVFRHPHLFTKVIALSGVYDAR------------DFF-----------GG  144 (227)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHEECHHHHHHHEEECCEEEHH------------HHC-----------CC
T ss_conf             9999999986647974315335356654313101816755330120130178------------860-----------55


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHCCC
Q ss_conf             000000347665413567776541012200121003576069984788878807999996799
Q gi|254780166|r  165 KFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPS  227 (261)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~l~~~~p~  227 (261)
                      .+..-.-   -|.+.   .++........-+++++|++  .+..|..|++.+..+++.+.+.+
T Consensus       145 yyddDv~---ynsP~---dylpg~~dp~~l~rlr~~~~--vfc~G~e~~~L~~~~~L~~~l~d  199 (227)
T COG4947         145 YYDDDVY---YNSPS---DYLPGLADPFRLERLRRIDM--VFCIGDEDPFLDNNQHLSRLLSD  199 (227)
T ss_pred             CCCCCEE---ECCHH---HHCCCCCCHHHHHHHHHCCE--EEEECCCCCCCCCHHHHHHHHCC
T ss_conf             4368423---25865---64567758699999864117--88805766566536899998441


No 171
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional
Probab=94.81  E-value=0.05  Score=31.16  Aligned_cols=105  Identities=17%  Similarity=0.215  Sum_probs=55.7

Q ss_pred             CCCEEEEECCC--CCCCHHHHHHHHHHHHHHHCCC----EEEEECCCCCC-CC-CCCCCCCCCCCCCCCCCCCCCCCC-C
Q ss_conf             98789999878--8880012217999999986898----99996476554-22-222222222212222222222222-2
Q gi|254780166|r   25 DAPTILLIHGL--ASSVQTNWLFSGWIQLLCDQGF----RVIAFDNLGHG-KS-DKSYIENDYRLVFMAADAVSLLEH-L   95 (261)
Q Consensus        25 ~~~~vv~iHG~--~~~~~~~~~~~~~~~~l~~~g~----~vi~~D~~G~G-~S-~~~~~~~~~s~~~~~~di~~~i~~-l   95 (261)
                      ..|.+|++-|-  ....    .....+..+..+|-    .++.+|-.+-. ++ +-+- +..| ...+++++.-.+.+ .
T Consensus       191 ~~PLlvL~DG~~w~~~~----~~~~~Ld~l~~~g~ipp~~~v~id~~d~~~R~~eL~~-n~~f-~~~l~~eLLP~~~~~~  264 (398)
T PRK10439        191 ERPLAVLLDGQFWAQSM----PVWPALTSLTHRGQLPPAVYVLIDAIDTTHRSQELPC-NADF-WLAVQQELLPQVRAIA  264 (398)
T ss_pred             CCCEEEEECHHHHCCCC----CHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHCCC-CHHH-HHHHHHHHHHHHHHHC
T ss_conf             76569996208950038----8789999999759999629999678986787766499-8889-9999998889999876


Q ss_pred             C----CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             2----222222344344431013332102356523896288563
Q gi|254780166|r   96 G----ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL  135 (261)
Q Consensus        96 ~----~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~  135 (261)
                      +    -++.++.|.|+||.-|+..|..+|+++..++-.+.....
T Consensus       265 ~~~~~~~~TvVaGqS~GGLaAl~aaL~~Pe~FG~VlsqSGSfWW  308 (398)
T PRK10439        265 PFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSFWW  308 (398)
T ss_pred             CCCCCCCCEEEECCCCCHHHHHHHHHHCCCCCCEEEECCCCEEC
T ss_conf             88878423599635730699999998492312766874652111


No 172
>KOG1282 consensus
Probab=93.42  E-value=0.14  Score=28.57  Aligned_cols=116  Identities=15%  Similarity=0.167  Sum_probs=65.0

Q ss_pred             CCCEEEEEEEC---C-CCCCEEEEECCCCCCCHHHHHHHHHHHHHHH------------------CCCEEEEECCC-CCC
Q ss_conf             99499999964---8-9987899998788880012217999999986------------------89899996476-554
Q gi|254780166|r   12 RKYQFAFYDVG---D-KDAPTILLIHGLASSVQTNWLFSGWIQLLCD------------------QGFRVIAFDNL-GHG   68 (261)
Q Consensus        12 dG~~l~y~~~g---~-~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~------------------~g~~vi~~D~~-G~G   68 (261)
                      .|.+++|+-..   + .+.|.||.+.|.+|+.-.    ...+.++-+                  +--.++-.|.| |-|
T Consensus        55 ~~~~LFYwf~eS~~~P~~dPlvLWLnGGPGCSSl----~G~~~E~GPf~v~~~G~tL~~N~ySWnk~aNiLfLd~PvGvG  130 (454)
T KOG1282          55 EGRQLFYWFFESENNPETDPLVLWLNGGPGCSSL----GGLFEENGPFRVKYNGKTLYLNPYSWNKEANILFLDQPVGVG  130 (454)
T ss_pred             CCCEEEEEEEECCCCCCCCCEEEEECCCCCCCCH----HHHHHHCCCEEECCCCCCCEECCCCCCCCCCEEEEECCCCCC
T ss_conf             7846899999725799889789994799871120----225550477277679982215875303415279972687677


Q ss_pred             CCCCCCCCCCC--CCCCCCCCCCCCCCC----C---CCCCCCCCCCCCCCCCHHHHHHHC----------CCCCCCEEEE
Q ss_conf             22222222222--212222222222222----2---222222234434443101333210----------2356523896
Q gi|254780166|r   69 KSDKSYIENDY--RLVFMAADAVSLLEH----L---GISKVHVMGYSMGARIACSMVLFY----------PSYVRSVILG  129 (261)
Q Consensus        69 ~S~~~~~~~~~--s~~~~~~di~~~i~~----l---~~~~~~liGhS~Gg~ia~~~a~~~----------p~~v~~lvl~  129 (261)
                      .|-.. .+.++  +.+..++|...++..    .   .-.++.+.|-|++|...-.+|..-          +-.++++++.
T Consensus       131 FSYs~-~~~~~~~~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IG  209 (454)
T KOG1282         131 FSYSN-TSSDYKTGDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGESYAGHYVPALAQEILKGNKKCCKPNINLKGYAIG  209 (454)
T ss_pred             CCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHCHHHCCCCEEEECCCCCCEEHHHHHHHHHHCCCCCCCCCCCCEEEEEC
T ss_conf             63347-87767678488899999999999996954307986896146566440999999985564466884140578953


Q ss_pred             CCC
Q ss_conf             288
Q gi|254780166|r  130 GVG  132 (261)
Q Consensus       130 ~~~  132 (261)
                      ++.
T Consensus       210 Ng~  212 (454)
T KOG1282         210 NGL  212 (454)
T ss_pred             CCC
T ss_conf             755


No 173
>KOG1516 consensus
Probab=93.33  E-value=0.052  Score=31.02  Aligned_cols=122  Identities=16%  Similarity=0.104  Sum_probs=59.4

Q ss_pred             EECCCCEEEEEEEC-CCC--CCEEEEECCCCCCCHHHHHH--HHHHHHHHHCCCEEEEECCC----CCCCCCCCCCCCCC
Q ss_conf             93499499999964-899--87899998788880012217--99999998689899996476----55422222222222
Q gi|254780166|r    9 RSWRKYQFAFYDVG-DKD--APTILLIHGLASSVQTNWLF--SGWIQLLCDQGFRVIAFDNL----GHGKSDKSYIENDY   79 (261)
Q Consensus         9 ~~~dG~~l~y~~~g-~~~--~~~vv~iHG~~~~~~~~~~~--~~~~~~l~~~g~~vi~~D~~----G~G~S~~~~~~~~~   79 (261)
                      .+.|-..+..+.-. ...  -|++|++||.+-...+...+  ......+..++.=|+++.+|    |+.-......+.++
T Consensus        92 ~sEDCLylNV~tp~~~~~~~~pV~V~iHGG~~~~gs~~~~~~~~~~~~~~~~~VVvVt~~YRLG~lGF~st~d~~~~gN~  171 (545)
T KOG1516          92 GSEDCLYLNVYTPQGCSESKLPVMVYIHGGGFQFGSASSFEIISPAYVLLLKDVVVVTINYRLGPLGFLSTGDSAAPGNL  171 (545)
T ss_pred             CCCCCCEEEEECCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHCCHHHCCCCCEEEEEEEEEEEEEEECCCCCCCCCCHH
T ss_conf             67887556553465234358975999807850027621123305201115688899985220031152235887788618


Q ss_pred             CCCCCC---CCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHC--CCCCCCEEEEC
Q ss_conf             212222---22222222222--22222234434443101333210--23565238962
Q gi|254780166|r   80 RLVFMA---ADAVSLLEHLG--ISKVHVMGYSMGARIACSMVLFY--PSYVRSVILGG  130 (261)
Q Consensus        80 s~~~~~---~di~~~i~~l~--~~~~~liGhS~Gg~ia~~~a~~~--p~~v~~lvl~~  130 (261)
                      .+.|++   +.+..-|...+  .+++.++|||-||..+..+...-  ..++.+.|..+
T Consensus       172 gl~Dq~~AL~wv~~~I~~FGGdp~~VTl~G~saGa~~v~~l~~Sp~s~~LF~~aI~~S  229 (545)
T KOG1516         172 GLFDQLLALRWVKDNIPSFGGDPKNVTLFGHSAGAASVSLLTLSPHSRGLFHKAISMS  229 (545)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCHHHHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             8899999999998366666899710578641589999998725853555677641066


No 174
>pfam05576 Peptidase_S37 PS-10 peptidase S37. These serine proteases have been found in Streptomyces species.
Probab=93.19  E-value=0.17  Score=27.98  Aligned_cols=103  Identities=17%  Similarity=0.127  Sum_probs=73.2

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC---CCCC
Q ss_conf             9878999987888800122179999999868989999647655422222-22222221222222222222222---2222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS-YIENDYRLVFMAADAVSLLEHLG---ISKV  100 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~-~~~~~~s~~~~~~di~~~i~~l~---~~~~  100 (261)
                      +.|+|++--|++.+..- ..-.+  ..|...  +-|.++.|=++.|... .+-...++++-+.|.+.+.+.++   -++.
T Consensus        62 ~rPtVl~T~GY~~~~~p-~r~Ep--T~Lld~--NqvsvE~RfF~~SrP~p~DWs~Lti~qAA~D~Hrv~~A~k~iY~gkW  136 (448)
T pfam05576        62 NRPTVFYTGGYNVSTNP-SRREP--TQIVDG--NQVSMEYRYFTPSRPAPADWSKLDIWQAASDQHRIFKALKPLYSKNW  136 (448)
T ss_pred             CCCEEEEECCCCCCCCC-CCCCC--HHHCCC--CEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             88638984573555786-64573--121156--44688874115898998880230096640467899999886457863


Q ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCEEE-ECCC
Q ss_conf             2234434443101333210235652389-6288
Q gi|254780166|r  101 HVMGYSMGARIACSMVLFYPSYVRSVIL-GGVG  132 (261)
Q Consensus       101 ~liGhS~Gg~ia~~~a~~~p~~v~~lvl-~~~~  132 (261)
                      +--|-|-||+.++.+-.-||+-+.+.|- +++.
T Consensus       137 iSTG~SKGGmTa~y~rrFyP~DvD~tVaYVAP~  169 (448)
T pfam05576       137 ISTGGSKGGMTATYYERFYPRDMDGVVAYVAPN  169 (448)
T ss_pred             EECCCCCCCEEEEEEEEECCCCCCEEEEEECCC
T ss_conf             543667785346877321887778566512575


No 175
>KOG2521 consensus
Probab=92.91  E-value=0.65  Score=24.51  Aligned_cols=233  Identities=14%  Similarity=0.153  Sum_probs=107.2

Q ss_pred             ECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--C
Q ss_conf             64899878999987888800122179999999868989999647655422222222222212222222222222222--2
Q gi|254780166|r   21 VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGI--S   98 (261)
Q Consensus        21 ~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~--~   98 (261)
                      .|.....+||++=||.+..+-  .....+....++||.++.+-.|-+-.. -+......++....+-+.+++...+.  .
T Consensus        33 ~g~~s~k~Iv~~~gWag~~~r--~l~ky~~~Yq~~g~~~~~~tap~~~~~-~~~s~~~~sl~~~~~~l~~L~~~~~~~~~  109 (350)
T KOG2521          33 NGGESEKPIVVLLGWAGAIDR--NLMKYSKIYQDKGYIVVRITAPCPSVF-LSASRRILSLSLASTRLSELLSDYNSDPC  109 (350)
T ss_pred             CCCCCCCCEEEEEEECCCCCH--HHHHHHHHHHCCCCEEEEECCCCCCCC-CCCCCCCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             477752567999501554404--699999987507836999567653002-21136650166889899987665147767


Q ss_pred             CCCCCCCCCCCCCHHHHH-H---HC-C---CCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCC--
Q ss_conf             222234434443101333-2---10-2---356523896288563311035699999986311110000111000000--
Q gi|254780166|r   99 KVHVMGYSMGARIACSMV-L---FY-P---SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRK--  168 (261)
Q Consensus        99 ~~~liGhS~Gg~ia~~~a-~---~~-p---~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  168 (261)
                      ++++--.|+||...+... .   ++ |   +...+++. ++.+.........+..-..   .........+......-  
T Consensus       110 pi~fh~FS~ng~~~~~si~~~~~~~~~~~~~~~~~~~f-dS~p~~~~~~~~~~a~~~~---~~~~~~~~~~~~~~~~i~~  185 (350)
T KOG2521         110 PIIFHVFSGNGVRLMYSISLQLIKHEPKAAQLSGGIIF-DSAPARSSPVQLGWAVSFS---SPPDDYVARWARLNYHITL  185 (350)
T ss_pred             CEEEEEECCCCEEEHHHHHHHHHHCCCHHHHHCCCCEE-ECCCCCCCHHHHCCEECCC---CCCHHHHHHHHHCCEEEEE
T ss_conf             43799724786664578999876447356764588358-5156524421205322001---3751567888735758888


Q ss_pred             CCCCCC---CCCHHHHHHHHHHHCCCCCH----HHHHCCCCCEEEEEECCCCCCCCH--HHHHHH----CCCCEEEEECC
Q ss_conf             003476---65413567776541012200----121003576069984788878807--999996----79979999888
Q gi|254780166|r  169 FADLDP---GNDLKALASCLSMIRKPFCQ----DDLYRIDVPVLIAVGSQDDLAGSP--QELMSF----IPSSQYLNICR  235 (261)
Q Consensus       169 ~~~~~~---~~~~~~~~~~~~~~~~~~~~----~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~----~p~~~~~~i~~  235 (261)
                      +.....   ......+.......+.....    ++-.....+.+.+.+..|.+++..  +++++.    --+.+.+-+.+
T Consensus       186 ~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~r~~~~~~~~~~~~ly~~s~~d~v~~~~~ie~f~~~~~~~g~~v~s~~~~d  265 (350)
T KOG2521         186 LTMAGNEGGAYLLGPLAEKISMSRKYHFLDRYEEQRNELPWNQLYLYSDNDDVLPADEIEKFIALRREKGVNVKSVKFKD  265 (350)
T ss_pred             EEEEECCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             77630121012212322016023414778899764440443423644785612228889999999985085479742167


Q ss_pred             CCCCCCCC--CHHHHHHHHHHHHHHCC
Q ss_conf             87384348--48999999999875168
Q gi|254780166|r  236 RDHLLAVG--DKQFKQGVVNFYANELR  260 (261)
Q Consensus       236 ~gH~~~~e--~p~~~~~i~~Fl~~~~~  260 (261)
                      +-|..++-  +..+.+.+.+|+.+.+.
T Consensus       266 s~H~~h~r~~p~~y~~~~~~Fl~~~~~  292 (350)
T KOG2521         266 SEHVAHFRSFPKTYLKKCSEFLRSVIS  292 (350)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             640234001938899999999984155


No 176
>pfam01764 Lipase_3 Lipase (class 3).
Probab=92.64  E-value=0.014  Score=34.40  Aligned_cols=35  Identities=26%  Similarity=0.223  Sum_probs=23.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             22222222222222222234434443101333210
Q gi|254780166|r   85 AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        85 ~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      .+.+..++++....++.+.|||+||.+|..++...
T Consensus        50 ~~~l~~~~~~~~~~~l~itGHSLGGa~A~l~a~~l   84 (141)
T pfam01764        50 LEELKRLLEKYPDYKIVVTGHSLGGALASLAAADL   84 (141)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             99999999978997699980565789999999999


No 177
>pfam04083 Abhydro_lipase ab-hydrolase associated lipase region.
Probab=92.08  E-value=0.28  Score=26.67  Aligned_cols=38  Identities=24%  Similarity=0.316  Sum_probs=27.8

Q ss_pred             CEEEEEECCCCEEEEEEECC-------CCCCEEEEECCCCCCCHH
Q ss_conf             40799934994999999648-------998789999878888001
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGD-------KDAPTILLIHGLASSVQT   41 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~-------~~~~~vv~iHG~~~~~~~   41 (261)
                      |.-...|.||+-+..+....       ..+|+|+|.||+.+|+.+
T Consensus        13 E~h~V~T~DGYiL~l~RIp~~~~~~~~~~~p~Vll~HGL~~sS~~   57 (62)
T pfam04083        13 EEHEVTTEDGYILTLHRIPPGGNSNGKGGKPVVLLQHGLLASSAD   57 (62)
T ss_pred             EEEEEECCCCCEEEEEECCCCCCCCCCCCCCEEEEEEECCCCCCE
T ss_conf             489998288819999975888888776889849998302236657


No 178
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=92.00  E-value=0.63  Score=24.58  Aligned_cols=116  Identities=17%  Similarity=0.294  Sum_probs=69.0

Q ss_pred             EEEEECC---CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCC
Q ss_conf             8999987---888800122179999999868989999647655422222222222212-------222222222222222
Q gi|254780166|r   28 TILLIHG---LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV-------FMAADAVSLLEHLGI   97 (261)
Q Consensus        28 ~vv~iHG---~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~-------~~~~di~~~i~~l~~   97 (261)
                      .+|+=-|   .|.+-++-|+-..-+..|.+.||.+|-++.  ..++    ...||++.       ...+++..+++.-+.
T Consensus       576 ~lvlGSGp~RIGqgvEFDYc~Vh~~~aLr~~Gye~ImiN~--NPET----VSTDyD~sDrLYFEplt~E~Vm~I~e~E~~  649 (1089)
T TIGR01369       576 VLVLGSGPNRIGQGVEFDYCCVHAVLALREAGYETIMINY--NPET----VSTDYDTSDRLYFEPLTFEDVMNIIELEKP  649 (1089)
T ss_pred             EEEECCCCEECCCCEEEHHHHHHHHHHHHHCCCEEEEEEC--CCCC----CCCCHHHHHHCCCCCCCCCCCEEHEEECCC
T ss_conf             8998784514066312056789999999872995999977--8997----436666510115876350310011000586


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCCC-EEEECCCCCCCC--CCHHHHHHHHHHHHCCC
Q ss_conf             2222234434443101333210235652-389628856331--10356999999863111
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFYPSYVRS-VILGGVGSVLYD--SDVVDWQSLIDSFLLPS  154 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~p~~v~~-lvl~~~~~~~~~--~~~~~~~~~~~~~~~~~  154 (261)
                      +-|++   |+||+++..+|..=-+  ++ +-+.|+.+...+  .+-..|....+.+..+.
T Consensus       650 ~GVIV---q~GGQtp~nlA~~L~~--~GG~~iLGTS~~~ID~AEDR~kFs~~l~~Lgi~Q  704 (1089)
T TIGR01369       650 EGVIV---QFGGQTPLNLAKELEE--AGGVPILGTSPESIDRAEDREKFSELLDELGIPQ  704 (1089)
T ss_pred             CEEEE---ECCCHHHHHHHHHHHH--CCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCC
T ss_conf             67999---7487326789999997--0893173688578751318679999997158798


No 179
>pfam06850 PHB_depo_C PHB de-polymerase C-terminus. This family represents the C-terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase. This degrades PHB granules to oligomers and monomers of 3-hydroxy-butyric acid.
Probab=91.89  E-value=0.068  Score=30.35  Aligned_cols=63  Identities=22%  Similarity=0.260  Sum_probs=45.1

Q ss_pred             HHHHCCC-CCEEEEEECCCCCCCCHH-----HHHHHCCCC--EEEEECCCCCCCCCCCH----HHHHHHHHHHHH
Q ss_conf             1210035-760699847888788079-----999967997--99998888738434848----999999999875
Q gi|254780166|r  195 DDLYRID-VPVLIAVGSQDDLAGSPQ-----ELMSFIPSS--QYLNICRRDHLLAVGDK----QFKQGVVNFYAN  257 (261)
Q Consensus       195 ~~l~~i~-~P~l~i~G~~D~~~~~~~-----~l~~~~p~~--~~~~i~~~gH~~~~e~p----~~~~~i~~Fl~~  257 (261)
                      -+++.|+ +|++.+-|+.|.++++.+     .+...+|..  +..+.+++||...+.-+    ++.-.|.+|+.+
T Consensus       127 Vd~~aI~~taLltvEGe~DDIsg~GQT~AA~~LC~glp~~~k~~~~~~g~GHYGlF~G~rwr~~i~P~i~~fi~~  201 (203)
T pfam06850       127 VDLSAITRVALMTVEGENDDISGLGQTKAALDLCTGIPADRKAHHMQPGVGHYGVFNGSRFREEIYPLIRDFIRE  201 (203)
T ss_pred             CCHHHHHHHHHHEECCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHHHHHHH
T ss_conf             268983210021012665666762889999998627999998887068999256415666764351899999986


No 180
>cd00519 Lipase_3 Lipase (class 3).  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation .  The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=90.08  E-value=0.052  Score=31.05  Aligned_cols=32  Identities=28%  Similarity=0.268  Sum_probs=22.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             22222222222222234434443101333210
Q gi|254780166|r   88 AVSLLEHLGISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        88 i~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      +...+++...-++.+.|||+||.+|..++...
T Consensus       118 ~~~~~~~~p~~~i~vTGHSLGgalA~L~a~~l  149 (229)
T cd00519         118 LKSALKQYPDYKIIVTGHSLGGALASLLALDL  149 (229)
T ss_pred             HHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH
T ss_conf             99999878995699964670689999999999


No 181
>cd00741 Lipase Lipase.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation", the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=90.08  E-value=0.036  Score=31.98  Aligned_cols=25  Identities=32%  Similarity=0.272  Sum_probs=20.7

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             2222222234434443101333210
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      ....++++.|||+||.+|..++..-
T Consensus        25 ~p~~~l~vtGHSLGgalA~l~a~~l   49 (153)
T cd00741          25 YPDYKIHVTGHSLGGALAGLAGLDL   49 (153)
T ss_pred             CCCCEEEEEEECHHHHHHHHHHHHH
T ss_conf             8997799996362789999999999


No 182
>pfam05277 DUF726 Protein of unknown function (DUF726). This family consists of several uncharacterized eukaryotic proteins.
Probab=88.87  E-value=0.25  Score=26.99  Aligned_cols=43  Identities=30%  Similarity=0.462  Sum_probs=28.8

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHH----H-CCCCCCCEEEECCCCCCCC
Q ss_conf             22222222344344431013332----1-0235652389628856331
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACSMVL----F-YPSYVRSVILGGVGSVLYD  137 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~~a~----~-~p~~v~~lvl~~~~~~~~~  137 (261)
                      ++..++.|+|+|+|+.+......    + .-..|..++|++.+.....
T Consensus       215 ~G~RPVtLvG~SlGARvI~~cL~~La~~~~~glVe~vvl~GaP~~~~~  262 (343)
T pfam05277       215 LGVRPVTLIGFSLGARVIFYCLLELAKRKAYGLIENVILLGAPATSDA  262 (343)
T ss_pred             CCCCCEEEEEECHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCH
T ss_conf             899985899636138999999999974667773448999778887987


No 183
>pfam11187 DUF2974 Protein of unknown function (DUF2974). This bacterial family of proteins has no known function.
Probab=87.63  E-value=0.15  Score=28.26  Aligned_cols=44  Identities=14%  Similarity=0.052  Sum_probs=29.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC----CCCCCEEEECCCC
Q ss_conf             22222222222222344344431013332102----3565238962885
Q gi|254780166|r   89 VSLLEHLGISKVHVMGYSMGARIACSMVLFYP----SYVRSVILGGVGS  133 (261)
Q Consensus        89 ~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p----~~v~~lvl~~~~~  133 (261)
                      ..+++... +++.|.|||-||.+|...|+..+    +||.++...+.+.
T Consensus        76 ~~~~~~~~-~~i~l~GHSKGGNLA~YAa~~~~~~~~~rI~~vys~DGPG  123 (224)
T pfam11187        76 NKILAHYP-GPIYLGGHSKGGNLAVYAAANAEPDLQDRIIKIYSFDGPG  123 (224)
T ss_pred             HHHHHHCC-CCEEEEECCCHHHHHHHHHHCCCHHHHHHHEEEECCCCCC
T ss_conf             99998779-9789995481678999999719986874632894258999


No 184
>pfam06259 DUF1023 Alpha/beta hydrolase of unknown function (DUF1023). Family of uncharacterized proteins found in Actinobacteria. Members of this family have an alpha/beta hydrolase fold.
Probab=87.61  E-value=0.17  Score=28.04  Aligned_cols=114  Identities=20%  Similarity=0.116  Sum_probs=60.1

Q ss_pred             EEEEECCCC--CCEEEEECCCCCCCHHHH-HH----HHHHHHH---H---HCCCEEEEECCCCCCCCCCCCCCC-CCC--
Q ss_conf             999964899--878999987888800122-17----9999999---8---689899996476554222222222-222--
Q gi|254780166|r   17 AFYDVGDKD--APTILLIHGLASSVQTNW-LF----SGWIQLL---C---DQGFRVIAFDNLGHGKSDKSYIEN-DYR--   80 (261)
Q Consensus        17 ~y~~~g~~~--~~~vv~iHG~~~~~~~~~-~~----~~~~~~l---~---~~g~~vi~~D~~G~G~S~~~~~~~-~~s--   80 (261)
                      .-.-.|+.+  .-..|++.|.+.+..... .+    ..+...+   .   ..+-++=.+-+.||   +.|.... .-.  
T Consensus         8 aava~Gd~dtA~~Vav~VPG~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AvI~WlGY---daP~~~~~~a~~~   84 (177)
T pfam06259         8 AAVVVGDLDTADRVSVTVPGVDTTTRRTVATMVAEARGLRAEAAAAREAAGWPNAVAVIAWLGY---TPPSGGLWDVATD   84 (177)
T ss_pred             EEEEECCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC---CCCCCCCCCCCCC
T ss_conf             9999689675566799878999875222441245688999999998763178998589997787---7998765354580


Q ss_pred             --CCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCC
Q ss_conf             --12222222222222222-----2222234434443101333210235652389628856
Q gi|254780166|r   81 --LVFMAADAVSLLEHLGI-----SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV  134 (261)
Q Consensus        81 --~~~~~~di~~~i~~l~~-----~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~  134 (261)
                        -+.-+.+|..+++.|.-     .++.++|||+|+.++-.. ++....+..+|+.++...
T Consensus        85 ~~A~~ga~~L~~F~~gL~a~~~~~~~~tv~GHSYGStv~G~A-a~~g~~vDd~v~~GSPG~  144 (177)
T pfam06259        85 DLARAGAPRLNRLLRDLRATTVPGQHLTLFGHSYGSLVCGLA-LDDGSPVSDIVLYGSPGT  144 (177)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHH-HHCCCCCCEEEEECCCCC
T ss_conf             799998999999999875015899976899744436789998-626898652899779998


No 185
>KOG2029 consensus
Probab=84.23  E-value=0.14  Score=28.56  Aligned_cols=21  Identities=29%  Similarity=0.360  Sum_probs=16.5

Q ss_pred             CCCCCCCCCCCCCCHHHHHHH
Q ss_conf             222223443444310133321
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLF  118 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~  118 (261)
                      .+++.+||||||.++-.+...
T Consensus       526 RPivwI~HSmGGLl~K~lLld  546 (697)
T KOG2029         526 RPIVWIGHSMGGLLAKKLLLD  546 (697)
T ss_pred             CCEEEEECCCCHHHHHHHHHH
T ss_conf             835997146421899999988


No 186
>pfam01083 Cutinase Cutinase.
Probab=83.67  E-value=0.38  Score=25.93  Aligned_cols=50  Identities=24%  Similarity=0.159  Sum_probs=34.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC------CCCCCCEEEEC
Q ss_conf             122222222222222222222234434443101333210------23565238962
Q gi|254780166|r   81 LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY------PSYVRSVILGG  130 (261)
Q Consensus        81 ~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~------p~~v~~lvl~~  130 (261)
                      ..++.+.+....++.--.|++|.|+|.|+.+.-..+..-      .++|+++|+.+
T Consensus        64 ~~~~~~~~~~~~~~CP~tkiVl~GYSQGA~Vv~~a~~~~~l~~~~~~~V~AvvlfG  119 (179)
T pfam01083        64 INDAARLVNSAASKCPNTKIVLGGYSQGAAVMDNAICGGGLPAAVADKVKAVVLFG  119 (179)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHCCCCCCHHHHHHEEEEEEEC
T ss_conf             99999999999963999728986416068998765226889977872367899953


No 187
>pfam11288 DUF3089 Protein of unknown function (DUF3089). This family of proteins has no known function.
Probab=82.97  E-value=0.14  Score=28.55  Aligned_cols=75  Identities=15%  Similarity=-0.020  Sum_probs=42.8

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCC-CC--CCCCCCCCCCCCCCCCCCCCC----CCCCCC-CCCCCCCCCCCCCCHHHH
Q ss_conf             1799999998689899996476554-22--222222222212222222222----222222-222223443444310133
Q gi|254780166|r   44 LFSGWIQLLCDQGFRVIAFDNLGHG-KS--DKSYIENDYRLVFMAADAVSL----LEHLGI-SKVHVMGYSMGARIACSM  115 (261)
Q Consensus        44 ~~~~~~~~l~~~g~~vi~~D~~G~G-~S--~~~~~~~~~s~~~~~~di~~~----i~~l~~-~~~~liGhS~Gg~ia~~~  115 (261)
                      ....|+..|.+.+ +|++|-+|=-- .|  +.......-.++.-.+||.+.    +++.+- .+++|+|||.|+..+.++
T Consensus        34 ~~~~QAs~F~~~~-~vyAP~YRQat~~~~~~~~~~~~~~a~~~AY~DV~~AF~~yl~~~n~grPfILagHSQGs~h~~rL  112 (201)
T pfam11288        34 VLRAQASPFNEVC-RVFAPRYRQATLGAFLATDRGEASAALDLAYSDVRRAFDAYLANDNGGRPFILAGHSQGALHLLRL  112 (201)
T ss_pred             HHHHHHHHHHCCC-CCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHH
T ss_conf             9999988997028-534716888788887414431038999988999999999999965999967999835689999999


Q ss_pred             HHHC
Q ss_conf             3210
Q gi|254780166|r  116 VLFY  119 (261)
Q Consensus       116 a~~~  119 (261)
                      ....
T Consensus       113 l~e~  116 (201)
T pfam11288       113 LREE  116 (201)
T ss_pred             HHHH
T ss_conf             9988


No 188
>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB; InterPro: IPR014132   This entry describes the YbaN protein family, also called PdaB and SpoVIE, of Gram-positive bacteria. Although ybaN null mutants have only a mild sporulation defect, ybaN/ytrI double mutants show drastically reduced sporulation efficiencies. This synthetic defect suggests the role of this sigmaE-controlled gene in sporulation had been masked by functional redundancy. Members of this family are homologous to a characterised polysaccharide deacetylase; the exact function this protein family is unknown..
Probab=80.29  E-value=2.5  Score=20.99  Aligned_cols=40  Identities=10%  Similarity=0.101  Sum_probs=31.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCC---EEE
Q ss_conf             22222222222222222222234434443101333210235652---389
Q gi|254780166|r   82 VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS---VIL  128 (261)
Q Consensus        82 ~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~---lvl  128 (261)
                      ++.+..+..+|+..+++.+.+       -+.-..|.+||+.++.   ++=
T Consensus        18 ~~~~~~IL~~L~~~~vk~ATF-------FlsG~Wae~hPelvk~lveI~~   60 (198)
T TIGR02764        18 NQYTEPILDTLKEEDVKNATF-------FLSGSWAERHPELVKELVEIVK   60 (198)
T ss_pred             CCCCCHHHHHHHHCCCCCCCC-------EEEHHHHHCCHHHHHHHHHHHH
T ss_conf             443006766676558853330-------2431576127789999999984


No 189
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]
Probab=79.35  E-value=4.4  Score=19.58  Aligned_cols=94  Identities=18%  Similarity=0.185  Sum_probs=48.6

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC-CCCCCCCCCC--CCCCCCCCCCCCC-CC-----CCCCCC-------
Q ss_conf             179999999868989999647655422222222-2222122222--2222222222222-22-----234434-------
Q gi|254780166|r   44 LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE-NDYRLVFMAA--DAVSLLEHLGISK-VH-----VMGYSM-------  107 (261)
Q Consensus        44 ~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~-~~~s~~~~~~--di~~~i~~l~~~~-~~-----liGhS~-------  107 (261)
                      .-...+..|.++||.|+.+|-.-.|..+.-... ..+-..+..+  -+.+++++.+++- +|     .+|-|+       
T Consensus        12 IGSHtv~~Ll~~G~~vvV~DNL~~g~~~~v~~~~~~f~~gDi~D~~~L~~vf~~~~idaViHFAa~~~VgESv~~Pl~Yy   91 (329)
T COG1087          12 IGSHTVRQLLKTGHEVVVLDNLSNGHKIALLKLQFKFYEGDLLDRALLTAVFEENKIDAVVHFAASISVGESVQNPLKYY   91 (329)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHCCCCEEEECCCCHHHHHHHHHHCCCCEEEECCCCCCCCHHHHCHHHHH
T ss_conf             68999999997898489995688788888602048568833431999999998649988998730043234441878888


Q ss_pred             ----CCCCHHHHHHHCCCCCCCEEEECCCCCCCCC
Q ss_conf             ----4431013332102356523896288563311
Q gi|254780166|r  108 ----GARIACSMVLFYPSYVRSVILGGVGSVLYDS  138 (261)
Q Consensus       108 ----Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~  138 (261)
                          +|.+.+.-+.+. ..++.+|+.++......+
T Consensus        92 ~NNv~gTl~Ll~am~~-~gv~~~vFSStAavYG~p  125 (329)
T COG1087          92 DNNVVGTLNLIEAMLQ-TGVKKFIFSSTAAVYGEP  125 (329)
T ss_pred             HHCHHHHHHHHHHHHH-HCCCEEEEECCCHHCCCC
T ss_conf             6030869999999998-299769992430103899


No 190
>KOG4388 consensus
Probab=77.44  E-value=2  Score=21.67  Aligned_cols=97  Identities=19%  Similarity=0.184  Sum_probs=50.2

Q ss_pred             CCEEE-EECCCCCCCHH----HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCC
Q ss_conf             87899-99878888001----22179999999868989999647655422222222222212222---222222222222
Q gi|254780166|r   26 APTIL-LIHGLASSVQT----NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA---ADAVSLLEHLGI   97 (261)
Q Consensus        26 ~~~vv-~iHG~~~~~~~----~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~---~di~~~i~~l~~   97 (261)
                      .+.+| -+||.|--+.+    ..+...|+..|   |--|+.+|+.     -.|..+.+--++...   -++..=.+.++.
T Consensus       395 S~sli~HcHGGGfVAqsSkSHE~YLr~Wa~aL---~cPiiSVdYS-----LAPEaPFPRaleEv~fAYcW~inn~allG~  466 (880)
T KOG4388         395 SRSLIVHCHGGGFVAQSSKSHEPYLRSWAQAL---GCPIISVDYS-----LAPEAPFPRALEEVFFAYCWAINNCALLGS  466 (880)
T ss_pred             CCEEEEEECCCCEEEECCCCCCHHHHHHHHHH---CCCEEEEEEC-----CCCCCCCCCHHHHHHHHHHHHHCCHHHHCC
T ss_conf             86179996388346104554337999999980---9976876504-----477899972789999999998567887476


Q ss_pred             --CCCCCCCCCCCCCCHHHHHHHC---CCC-CCCEEEEC
Q ss_conf             --2222234434443101333210---235-65238962
Q gi|254780166|r   98 --SKVHVMGYSMGARIACSMVLFY---PSY-VRSVILGG  130 (261)
Q Consensus        98 --~~~~liGhS~Gg~ia~~~a~~~---p~~-v~~lvl~~  130 (261)
                        ++++++|-|-||.+.+..+.+.   .-| -.+|+++=
T Consensus       467 TgEriv~aGDSAGgNL~~~VaLr~i~~gvRvPDGl~laY  505 (880)
T KOG4388         467 TGERIVLAGDSAGGNLCFTVALRAIAYGVRVPDGLMLAY  505 (880)
T ss_pred             CCCEEEEECCCCCCCEEEHHHHHHHHHCCCCCCCEEEEC
T ss_conf             553489842678761550147899984787898537854


No 191
>KOG4569 consensus
Probab=76.32  E-value=0.42  Score=25.64  Aligned_cols=36  Identities=25%  Similarity=0.228  Sum_probs=25.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             222222222222222222223443444310133321
Q gi|254780166|r   83 FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF  118 (261)
Q Consensus        83 ~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~  118 (261)
                      .+.+++..+++...-=++.+-|||+||.+|...|..
T Consensus       156 ~~~~~~~~L~~~~~~~~i~vTGHSLGgAlA~laa~~  191 (336)
T KOG4569         156 GLDAELRRLIELYPNYSIWVTGHSLGGALASLAALD  191 (336)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             899999999986899679994068708989999999


No 192
>KOG2385 consensus
Probab=75.93  E-value=1.5  Score=22.29  Aligned_cols=43  Identities=28%  Similarity=0.353  Sum_probs=29.2

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHH-----CCCCCCCEEEECCCCCCCC
Q ss_conf             222222223443444310133321-----0235652389628856331
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACSMVLF-----YPSYVRSVILGGVGSVLYD  137 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~~a~~-----~p~~v~~lvl~~~~~~~~~  137 (261)
                      +|..++.|+|+|+|+.+.......     .-..|..++|.+++.....
T Consensus       444 qG~RPVTLVGFSLGARvIf~CL~~Lakkke~~iIEnViL~GaPv~~k~  491 (633)
T KOG2385         444 QGNRPVTLVGFSLGARVIFECLLELAKKKEVGIIENVILFGAPVPTKA  491 (633)
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCH
T ss_conf             589862576303215799999999864145451323566068765778


No 193
>pfam07519 Tannase Tannase and feruloyl esterase. This family includes fungal tannase and feruloyl esterase. It also includes several bacterial homologues of unknown function.
Probab=75.39  E-value=5.7  Score=18.90  Aligned_cols=57  Identities=9%  Similarity=0.127  Sum_probs=40.3

Q ss_pred             CCEEEEEECCCCCCCCH------HHHHHHCCC--------CEEEEECCCCCCCCCCCH---HHHHHHHHHHHHH
Q ss_conf             76069984788878807------999996799--------799998888738434848---9999999998751
Q gi|254780166|r  202 VPVLIAVGSQDDLAGSP------QELMSFIPS--------SQYLNICRRDHLLAVGDK---QFKQGVVNFYANE  258 (261)
Q Consensus       202 ~P~l~i~G~~D~~~~~~------~~l~~~~p~--------~~~~~i~~~gH~~~~e~p---~~~~~i~~Fl~~~  258 (261)
                      -.+|+.+|..|..+++.      +++.+.++.        .|+.++||.+|+.--.-|   ....++.+|..+-
T Consensus       330 GKLi~~HG~aD~~i~~~~ti~Yy~~v~~~~g~~~~~~~dF~Rlf~vPGm~HC~gG~gp~~~d~l~aL~~WVE~G  403 (451)
T pfam07519       330 GKLILYHGTADPSVSPASTIRYYESVVAKMGEALAATEDFYRFFLVPGMAHCGGGAGPSGVDNLTAMVDWVENG  403 (451)
T ss_pred             CCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHCC
T ss_conf             80899816777775850589999999998276635433311123248853247998888768899999998389


No 194
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only]
Probab=72.24  E-value=6.8  Score=18.44  Aligned_cols=44  Identities=20%  Similarity=0.240  Sum_probs=33.6

Q ss_pred             HHCCCCCEEEEEECCCCCCCC--HHHHHHHCCCCE-EEEECCCCCCC
Q ss_conf             100357606998478887880--799999679979-99988887384
Q gi|254780166|r  197 LYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQ-YLNICRRDHLL  240 (261)
Q Consensus       197 l~~i~~P~l~i~G~~D~~~~~--~~~l~~~~p~~~-~~~i~~~gH~~  240 (261)
                      ..++.+|-.++.|..|.+..+  +....+.+|+-+ +..+|+..|..
T Consensus       325 ~~RLalpKyivnaSgDdff~pDsa~lYyd~LPG~kaLrmvPN~~H~~  371 (507)
T COG4287         325 QLRLALPKYIVNASGDDFFVPDSANLYYDDLPGEKALRMVPNDPHNL  371 (507)
T ss_pred             HHHCCCCCEEECCCCCCCCCCCCCCEEECCCCCCEEEEECCCCCCHH
T ss_conf             12125430133166885237774301110488732256278972014


No 195
>TIGR00976 /NonD hydrolase CocE/NonD family protein; InterPro: IPR005674    This family includes the cocaine esterase CocE, several glutaryl-7-ACA acylases, and the putative diester hydrolase NonD of Streptomyces griseus (all hydrolases). This family shows extensive, low-level similarity to a family of xaa-pro dipeptidyl-peptidases, and to many other hydrolases.; GO: 0016787 hydrolase activity, 0008152 metabolic process.
Probab=68.69  E-value=3.7  Score=20.03  Aligned_cols=116  Identities=18%  Similarity=0.225  Sum_probs=69.1

Q ss_pred             ECCCCEEEE---EEECCC---CCCEEEEECCCCCCCHHHH-----HH---------------------HHHHHHHHHCCC
Q ss_conf             349949999---996489---9878999987888800122-----17---------------------999999986898
Q gi|254780166|r   10 SWRKYQFAF---YDVGDK---DAPTILLIHGLASSVQTNW-----LF---------------------SGWIQLLCDQGF   57 (261)
Q Consensus        10 ~~dG~~l~y---~~~g~~---~~~~vv~iHG~~~~~~~~~-----~~---------------------~~~~~~l~~~g~   57 (261)
                      ..||.+++.   ...+.+   ..|.+++.+.++......+     .+                     ...-..+..+||
T Consensus         3 ~~~g~~~~~~~~~p~~~~~~~~~p~~~~~~p~~~~~~~~~~g~~w~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~   82 (663)
T TIGR00976         3 TRDGTRLAADLYLPAGGGEKEPLPALLSRTPYGKDAGLAWPGNRWTFPQYRLLREGWGGTGPALTGLDKTEPAWFVAEGY   82 (663)
T ss_pred             CCCCCEEEEEEECCCCCCCCCCCCEEEEECCCCCHHCCCCCCCCCCCHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHCCC
T ss_conf             65540432000024455432345346752343300112567753335246776521576530011100123112321562


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CC--CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEE
Q ss_conf             999964765542222222222221222222222222---22--22222223443444310133321023565238
Q gi|254780166|r   58 RVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLE---HL--GISKVHVMGYSMGARIACSMVLFYPSYVRSVI  127 (261)
Q Consensus        58 ~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~---~l--~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lv  127 (261)
                      .++..|.+|.|.|++......  ..+...|..++++   ..  ....+..+|.|+-+......+...+..++.++
T Consensus        83 ~~~~~d~~g~~~~~g~~~~~~--~~~~~~d~~~~~~w~~~~~w~~g~~~~~g~~~~~~~~~~~~~~~~~~~~~~~  155 (663)
T TIGR00976        83 AVVVQDTRGRGGSEGEWDLLG--WSDEAEDGYDLLDWLAKQPWCDGNVGLLGLSYLGVTQWLAAALKPPALRAIA  155 (663)
T ss_pred             EEEEEECCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHHHHCCCCCCEEECCCHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             588730234655544423355--5210002678877765301246630000111356778887522775202310


No 196
>PRK13768 GTPase; Provisional
Probab=66.60  E-value=9.1  Score=17.72  Aligned_cols=64  Identities=20%  Similarity=0.237  Sum_probs=38.2

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCC
Q ss_conf             8999987888800122179999999868989999647655422222222222----21222222222222222222
Q gi|254780166|r   28 TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY----RLVFMAADAVSLLEHLGISK   99 (261)
Q Consensus        28 ~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~----s~~~~~~di~~~i~~l~~~~   99 (261)
                      -.+++=|-+||..+. ......+++...+++|..+++-      ......+|    ++.+.++ +.++++++++++
T Consensus         3 ~~~~ViGpaGSGKsT-~~~~l~~~l~~~~r~~~vvNLD------PA~e~~pY~~~iDIRd~i~-~~dVM~~~~LGP   70 (253)
T PRK13768          3 YIVFFLGTAGSGKTT-LVGALSDWLEEQGYDVAIVNLD------PAVEYLPYKPDIDVREYVS-AREIMRKYGLGP   70 (253)
T ss_pred             EEEEEECCCCCCHHH-HHHHHHHHHHHCCCCEEEEECC------CCCCCCCCCCCCCHHHHCC-HHHHHHHHCCCC
T ss_conf             189998999998899-9999999999769975999789------8665899998863786178-999998819896


No 197
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD; InterPro: IPR014128   The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM) , .; GO: 0000746 conjugation.
Probab=64.43  E-value=10  Score=17.46  Aligned_cols=36  Identities=25%  Similarity=0.395  Sum_probs=30.6

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             9998788880012217999999986898999964765
Q gi|254780166|r   30 LLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG   66 (261)
Q Consensus        30 v~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G   66 (261)
                      +++||..|+..+. ....++...-.+|=++|.||--|
T Consensus       211 ~L~~GTtG~GKs~-~lr~LL~~iR~rGd~AIiYDkgC  246 (613)
T TIGR02759       211 ILIHGTTGSGKSV-ALRKLLRWIRQRGDRAIIYDKGC  246 (613)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHHHCCCEEEEEECCC
T ss_conf             2664541743899-99999999986398589982574


No 198
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase; InterPro: IPR006233   Cystathionine beta-lyase (alternate name: beta-cystathionase) is one of several pyridoxal-dependent enzymes of cysteine, methionine, and homocysteine metabolism. This enzyme is involved in the biosynthesis of Met from Cys .; GO: 0004121 cystathionine beta-lyase activity, 0006520 amino acid metabolic process, 0005737 cytoplasm.
Probab=61.36  E-value=2.2  Score=21.39  Aligned_cols=10  Identities=10%  Similarity=0.268  Sum_probs=3.4

Q ss_pred             CCCCCCCCCC
Q ss_conf             2344344431
Q gi|254780166|r  102 VMGYSMGARI  111 (261)
Q Consensus       102 liGhS~Gg~i  111 (261)
                      ++=.-|.+.+
T Consensus       177 miDNTWaagl  186 (389)
T TIGR01324       177 MIDNTWAAGL  186 (389)
T ss_pred             EEECCCCCHH
T ss_conf             9636302001


No 199
>TIGR03131 malonate_mdcH malonate decarboxylase, epsilon subunit. Members of this protein family are the epsilon subunit of malonate decarboxylase. This subunit has malonyl-CoA/dephospho-CoA acyltransferase activity. Malonate decarboxylase may be a soluble enzyme, or linked to membrane subunits and active as a sodium pump. The epsilon subunit is closely related to the malonyl CoA-acyl carrier protein (ACP) transacylase family described by TIGR00128, but acts on an ACP subunit of malonate decarboxylase that has an unusual coenzyme A derivative as its prothetic group.
Probab=61.28  E-value=1.6  Score=22.24  Aligned_cols=28  Identities=29%  Similarity=0.210  Sum_probs=22.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             2222222222222344344431013332
Q gi|254780166|r   90 SLLEHLGISKVHVMGYSMGARIACSMVL  117 (261)
Q Consensus        90 ~~i~~l~~~~~~liGhS~Gg~ia~~~a~  117 (261)
                      +++...++++..++|||+|-+.|+..+-
T Consensus        68 ~~l~~~g~~P~~v~GHSlGE~aA~~~AG   95 (295)
T TIGR03131        68 RALLALLPRPSAVAGYSVGEYAAAVVAG   95 (295)
T ss_pred             HHHHHCCCCCCEEEECCHHHHHHHHHCC
T ss_conf             9999649988889767775899999839


No 200
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I; InterPro: IPR011908    This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria .; GO: 0016757 transferase activity transferring glycosyl groups, 0009103 lipopolysaccharide biosynthetic process.
Probab=61.14  E-value=11  Score=17.10  Aligned_cols=39  Identities=23%  Similarity=0.412  Sum_probs=16.6

Q ss_pred             CCCCEEEEECCCCCCCHH--HHHHHHHHHHHH-HCC-CEEEEE
Q ss_conf             998789999878888001--221799999998-689-899996
Q gi|254780166|r   24 KDAPTILLIHGLASSVQT--NWLFSGWIQLLC-DQG-FRVIAF   62 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~--~~~~~~~~~~l~-~~g-~~vi~~   62 (261)
                      +++|.+||+|+..=....  ...|..+++.|. ++| ..++.+
T Consensus       202 k~~py~vllHaTSR~dK~WP~~~W~~l~~~L~e~~gy~~~~Lp  244 (359)
T TIGR02193       202 KDAPYAVLLHATSRDDKKWPEERWRELARLLLEERGYLQIVLP  244 (359)
T ss_pred             CCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             7889689821445002358678999999997056992798726


No 201
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.; GO: 0005525 GTP binding, 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=60.24  E-value=6.1  Score=18.72  Aligned_cols=55  Identities=18%  Similarity=0.329  Sum_probs=36.0

Q ss_pred             CCCCCCCCCC---CCCCCCCCCHHHHHH-HCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             2222222222---344344431013332-10235652389628856331103569999998631
Q gi|254780166|r   93 EHLGISKVHV---MGYSMGARIACSMVL-FYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLL  152 (261)
Q Consensus        93 ~~l~~~~~~l---iGhS~Gg~ia~~~a~-~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~  152 (261)
                      |..++.-|++   =|||-||.-....|+ +-|     +|+|+++.-+.+-+..+.+.++.+++.
T Consensus       258 ~~~~vGSvIiTKLDGHAkGGGALSAVAATKsP-----iiFIGTGEhv~d~E~F~~~~FvskLLG  316 (453)
T TIGR01425       258 DSVEVGSVIITKLDGHAKGGGALSAVAATKSP-----IIFIGTGEHVDDFEIFDAEPFVSKLLG  316 (453)
T ss_pred             HCCCCEEEEEECCCCCCCCCHHHHHHHHHCCC-----EEEECCCCCCCCCCCCCCCCHHHHHCC
T ss_conf             00350038875156776762378898753597-----798137750276057899714775402


No 202
>PRK10279 hypothetical protein; Provisional
Probab=59.60  E-value=1.5  Score=22.28  Aligned_cols=30  Identities=23%  Similarity=0.358  Sum_probs=16.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             222222222222223443444310133321
Q gi|254780166|r   89 VSLLEHLGISKVHVMGYSMGARIACSMVLF  118 (261)
Q Consensus        89 ~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~  118 (261)
                      ...+++.++..-.+.|.|+|+.++..||+.
T Consensus        24 l~aLee~gI~id~I~GtS~GAivga~yA~g   53 (300)
T PRK10279         24 INALKKVGIEIDIVAGCSIGSLVGAAYACD   53 (300)
T ss_pred             HHHHHHCCCCCCEEEEECHHHHHHHHHHCC
T ss_conf             999998699977898407999999999879


No 203
>pfam09949 DUF2183 Uncharacterized conserved protein (DUF2183). This domain, found in various hypothetical bacterial proteins, has no known function.
Probab=59.52  E-value=10  Score=17.37  Aligned_cols=86  Identities=15%  Similarity=0.149  Sum_probs=49.0

Q ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CHHHHHHH
Q ss_conf             221799999998689899996476554222222222222122222222222222222222234434443---10133321
Q gi|254780166|r   42 NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGAR---IACSMVLF  118 (261)
Q Consensus        42 ~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~---ia~~~a~~  118 (261)
                      |-.+..+.+.+..++|--=.+.++-+|-+........ ..+.=.+.+..+++.+.-.+++|||-| |-.   +=..++.+
T Consensus        10 wnly~~l~~Fl~~~~~P~G~l~Lr~~~~~~~~~~~~~-~~~hK~~~i~~il~~fP~~kfiLiGDs-gq~DpeiY~~ia~~   87 (100)
T pfam09949        10 WNLYPFLRRFLERNGFPPGPLLLRDWGPSLLGFFRSG-AQSHKRDAIERILRDFPDRKFILIGDS-GQHDPEIYAEIARE   87 (100)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEHHCCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCHHHHHHHHHH
T ss_conf             8879999999987699998550512886546552687-425639999999997889708995688-77699999999997


Q ss_pred             CCCCCCCEEEE
Q ss_conf             02356523896
Q gi|254780166|r  119 YPSYVRSVILG  129 (261)
Q Consensus       119 ~p~~v~~lvl~  129 (261)
                      +|++|.++.+-
T Consensus        88 ~P~rI~aI~IR   98 (100)
T pfam09949        88 FPGRILAIYIR   98 (100)
T ss_pred             CCCCEEEEEEE
T ss_conf             97558999984


No 204
>TIGR01120 rpiB ribose 5-phosphate isomerase B; InterPro: IPR004785   Ribose 5-phosphate isomerase (5.3.1.6 from EC) forms a homodimer and catalyses the interconversion of D-ribose 5-phosphate and D-ribulose 5-phosphate in the non-oxidative branch of the pentose phosphate pathway. This reaction permits the synthesis of ribose from other sugars, as well as the recycling of sugars from nucleotide breakdown. Two unrelated enzymes can catalyse this reaction: RpiA (found in most organisms) and RpiB (found in some bacteria and eukaryotes). RpiB is also involved in metabolism of the rare sugar, allose, in addition to ribose sugars. The structures of RpiA and RpiB are distinct, RpiB having a Rossmann-type alpha/beta/alpha sandwich topology . This entry represents the RpiB enzyme.; GO: 0004751 ribose-5-phosphate isomerase activity, 0006098 pentose-phosphate shunt.
Probab=59.38  E-value=6.8  Score=18.44  Aligned_cols=71  Identities=20%  Similarity=0.164  Sum_probs=41.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             88800122179999999868989999647655422222222222212222222222222222222223443444310133
Q gi|254780166|r   36 ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM  115 (261)
Q Consensus        36 ~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~  115 (261)
                      |+++.....=..+-.+|.++|+.|+..     |    +...+..+..++++++..-+..=..+.=+||.   |..|++.+
T Consensus         5 GsDHaGf~Lke~ik~fL~~~g~kvid~-----G----T~~~ertdYP~YAk~V~~av~~g~~~~GILiC---gTGiGmSi   72 (143)
T TIGR01120         5 GSDHAGFILKEKIKEFLEDKGFKVIDV-----G----TLASERTDYPDYAKEVVRAVLEGKAERGILIC---GTGIGMSI   72 (143)
T ss_pred             ECCCCCCHHHHHHHHHHCCCCEEEEEE-----C----CCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE---ECCCCHHH
T ss_conf             058656234788999861398579875-----3----78867636606899999997448766766885---05321100


Q ss_pred             HHH
Q ss_conf             321
Q gi|254780166|r  116 VLF  118 (261)
Q Consensus       116 a~~  118 (261)
                      +++
T Consensus        73 ~AN   75 (143)
T TIGR01120        73 AAN   75 (143)
T ss_pred             HCC
T ss_conf             101


No 205
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family; InterPro: IPR014189   Members of this family are putative quinone oxidoreductases that belong to the broader superfamily of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxidoreductases. An alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, consequently members of this entry are likely to be quinone oxidoreductases. A member of this family in Homo sapiens (Human), PIG3, is induced by p53 but is otherwise uncharacterised..
Probab=58.78  E-value=11  Score=17.22  Aligned_cols=98  Identities=19%  Similarity=0.178  Sum_probs=54.9

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEE----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             999987888800122179999999868-9899996----4765-5422222222222212222222222222-2222222
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQ-GFRVIAF----DNLG-HGKSDKSYIENDYRLVFMAADAVSLLEH-LGISKVH  101 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~-g~~vi~~----D~~G-~G~S~~~~~~~~~s~~~~~~di~~~i~~-l~~~~~~  101 (261)
                      -|||||..|.-.+      .+=.|+++ |.+|++=    |-.. +-.+-+-...-+|+-+|+++-+.+.-.. -+.+-+.
T Consensus       147 tvLiHGGaSGIGt------tAIqLAKA~Ga~V~~TaGS~eK~~~a~~~LGAd~aINY~e~DFve~~k~~t~g~kGvDVIL  220 (334)
T TIGR02824       147 TVLIHGGASGIGT------TAIQLAKAFGARVFTTAGSDEKCATACEALGADIAINYREEDFVEVVKEETGGGKGVDVIL  220 (334)
T ss_pred             EEEEEECCCCHHH------HHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCCCCCEEE
T ss_conf             2899713673679------9999998569759998289899999998609807860777347999998268998531798


Q ss_pred             -CCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCC
Q ss_conf             -234434443101333210235652389628856331
Q gi|254780166|r  102 -VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD  137 (261)
Q Consensus       102 -liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~  137 (261)
                       +||   |.|+...+.+...|  -+||.++......-
T Consensus       221 D~vG---g~Yl~~N~~alA~d--GRlV~Ig~~gG~~A  252 (334)
T TIGR02824       221 DIVG---GSYLARNIKALALD--GRLVQIGFQGGAKA  252 (334)
T ss_pred             ECCC---HHHHHHHHHHHHCC--CCEEEEECCCCCCC
T ss_conf             5776---68899899998407--93999850678320


No 206
>pfam10329 DUF2417 Region of unknown function (DUF2417). This is a region of a family of proteins conserved in fungi some of whose members also have the Abhydrolase_1, pfam00561, domain in their sequence. The function of this region is not known.
Probab=56.78  E-value=14  Score=16.66  Aligned_cols=48  Identities=23%  Similarity=0.385  Sum_probs=29.2

Q ss_pred             EEEEECCCCEEEEEEECCCC-----CCEEEEE-CCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             79993499499999964899-----8789999-878888001221799999998689
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVGDKD-----APTILLI-HGLASSVQTNWLFSGWIQLLCDQG   56 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g~~~-----~~~vv~i-HG~~~~~~~~~~~~~~~~~l~~~g   56 (261)
                      .|++..|..++|..++|+..     +.|+||+ ||-..+   .+.+..+++.+-..|
T Consensus        71 ~y~Vd~~kyqvHl~C~G~~~~~~~~~~ptVL~EgGe~~~---~~~~~~wi~ely~~~  124 (126)
T pfam10329        71 RYWVDGDKYQVHLACYGDVTDATGNKQPTVLFEGGEYPV---EHTLQEWIEELYHLG  124 (126)
T ss_pred             EEEECCCEEEEEEEEECCCCCCCCCCCCEEEEECCCCCH---HHHHHHHHHHHHHCC
T ss_conf             786668746898997568888888989889995799854---878999999999758


No 207
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=56.66  E-value=14  Score=16.64  Aligned_cols=62  Identities=15%  Similarity=0.209  Sum_probs=40.6

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCC--CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9987899998788880012217999999986898999964765--542222222222221222222222
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG--HGKSDKSYIENDYRLVFMAADAVS   90 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G--~G~S~~~~~~~~~s~~~~~~di~~   90 (261)
                      +..+.+|.+.|..++..+ +.-..+.+.|.++|++++..|=-.  ||.+.    +-.||-++..+.+..
T Consensus        20 ~~~~~viW~TGLSGsGKS-TiA~ale~~L~~~G~~~y~LDGDnvR~gL~~----dLgFs~edR~eniRR   83 (197)
T COG0529          20 GQKGAVIWFTGLSGSGKS-TIANALEEKLFAKGYHVYLLDGDNVRHGLNR----DLGFSREDRIENIRR   83 (197)
T ss_pred             CCCCEEEEEECCCCCCHH-HHHHHHHHHHHHCCCEEEEECCHHHHHCCCC----CCCCCHHHHHHHHHH
T ss_conf             799859996468888787-9999999999975975898557467650057----889786789999999


No 208
>pfam03976 PPK2 Polyphosphate kinase 2 (PPK2). Inorganic polyphosphate (polyP) plays a role in metabolism and regulation and has been proposed to serve as a energy source in a pre-ATP world. In prokaryotes, the synthesis and utilisation of polyP are catalysed by PPK1, PPK2 and polyphosphatases. Proteins with a single PPK2 domain catalyse polyP-dependent phosphorylation of ADP to ATP, whereas proteins containing 2 fused PPK2 domains phosphorylate AMP to ADP. The structure of PPK2 from Pseudomonas aeruginosa has revealed a a 3-layer alpha/beta/alpha sandwich fold with an alpha-helical lid similar to the structures of microbial thymidylate kinases.
Probab=56.35  E-value=13  Score=16.75  Aligned_cols=75  Identities=13%  Similarity=0.177  Sum_probs=44.3

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             987899998788880012217999999986898999964765542222222222221222222222222222-2222223
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG-ISKVHVM  103 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~-~~~~~li  103 (261)
                      +.|.||++.|+-++..+. ....+...|.++|++|.++.-|---+..     .+|        +-.+-..+. -+++.++
T Consensus        29 ~~~viIv~eG~daaGKg~-~I~~l~~~lDPrg~~v~~~~~pt~eE~~-----~p~--------lwRfw~~lP~~G~I~iF   94 (229)
T pfam03976        29 GKKLVVIFEGRDAAGKGG-AIKRITEALNPRGARIVALPAPTEEERS-----QWY--------FQRYVQHLPAGGEIVLF   94 (229)
T ss_pred             CCCEEEEEECCCCCCCHH-HHHHHHHHCCCCEEEEEECCCCCHHHHC-----CCH--------HHHHHHHCCCCCEEEEE
T ss_conf             994899996657787369-9999986259885699868999978847-----861--------99998637777818997


Q ss_pred             CCCCCCCCHH
Q ss_conf             4434443101
Q gi|254780166|r  104 GYSMGARIAC  113 (261)
Q Consensus       104 GhS~Gg~ia~  113 (261)
                      =-||=+.+..
T Consensus        95 drSWY~~~l~  104 (229)
T pfam03976        95 DRSWYNRAGV  104 (229)
T ss_pred             CCCHHHHHHH
T ss_conf             4625566899


No 209
>PRK06849 hypothetical protein; Provisional
Probab=56.26  E-value=13  Score=16.78  Aligned_cols=69  Identities=19%  Similarity=0.222  Sum_probs=41.7

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC-CCCC-------CCCCCCCCCCCCCCCCCCC
Q ss_conf             9878999987888800122179999999868989999647655422222-2222-------2221222222222222222
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS-YIEN-------DYRLVFMAADAVSLLEHLG   96 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~-~~~~-------~~s~~~~~~di~~~i~~l~   96 (261)
                      +.|.=|||-|....     .-..++..|..+|++|+..|-..+..|.-. ....       ..+.+.+++++.++++..+
T Consensus         2 ~~p~tvLiTg~r~~-----~aL~laR~l~~~Gh~V~~aD~~~~~l~r~Sr~v~~~~~vP~P~~d~~~y~~~Ll~Iv~~e~   76 (387)
T PRK06849          2 NTPKTVLITGARAP-----AALQLARSFHNAGHTVILADSLKYPLSRFSRAVDGFYTIPSPKWDPNAYIQALLSIVKRHN   76 (387)
T ss_pred             CCCCEEEEECCCHH-----HHHHHHHHHHHCCCEEEEECCCCCCCCCHHHCEEEEEECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             99877999588607-----8999999998789979998489877542000011279869997898999999999999838


Q ss_pred             CC
Q ss_conf             22
Q gi|254780166|r   97 IS   98 (261)
Q Consensus        97 ~~   98 (261)
                      ++
T Consensus        77 id   78 (387)
T PRK06849         77 ID   78 (387)
T ss_pred             CC
T ss_conf             99


No 210
>TIGR01748 rhaA L-rhamnose isomerase; InterPro: IPR009308   This family consists of several bacterial L-rhamnose isomerase proteins (5.3.1.14 from EC). This enzyme interconverts L-rhamnose and L-rhamnulose. In some species, including Escherichia coli, this is the first step in rhamnose catabolism. Sequential steps are catalyzed by rhamnulose kinase (rhaB), then rhamnulose-1-phosphate aldolase (rhaD) to yield glycerone phosphate and (S)-lactaldehyde. ; GO: 0008740 L-rhamnose isomerase activity, 0030145 manganese ion binding, 0019299 rhamnose metabolic process.
Probab=55.59  E-value=6.8  Score=18.45  Aligned_cols=38  Identities=16%  Similarity=0.260  Sum_probs=31.3

Q ss_pred             EEEEECCCCCCCCHH-HHHHHCCCCEEEEECCCCCCCCCC
Q ss_conf             699847888788079-999967997999988887384348
Q gi|254780166|r  205 LIAVGSQDDLAGSPQ-ELMSFIPSSQYLNICRRDHLLAVG  243 (261)
Q Consensus       205 l~i~G~~D~~~~~~~-~l~~~~p~~~~~~i~~~gH~~~~e  243 (261)
                      |+-.|.+..+|++.| .|.-.+.+-+++++ ++|||.+.|
T Consensus       226 LFGlGaEsYtVGShEFYmgYa~tr~kl~cL-DaGHFHPTE  264 (415)
T TIGR01748       226 LFGLGAESYTVGSHEFYMGYALTRDKLLCL-DAGHFHPTE  264 (415)
T ss_pred             HHCCCCCEEEECCHHHHHHHHHHHHHHHHH-CCCCCCCHH
T ss_conf             421452102406337788777742020011-277988602


No 211
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=54.20  E-value=15  Score=16.40  Aligned_cols=43  Identities=23%  Similarity=0.311  Sum_probs=35.0

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC
Q ss_conf             78999987888800122179999999868989999647655422
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS   70 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S   70 (261)
                      .|||-+-|+-+|..+ +....+++.|.++||+|-++-.-+|+..
T Consensus         2 ~Pii~ivG~s~SGKT-TLi~kli~~l~~~G~rV~~IKH~~H~f~   44 (170)
T PRK10751          2 IPLLAIAAWSGTGKT-TLLKKLIPALCARGIRPGLIKHTHHDMD   44 (170)
T ss_pred             CCEEEEEECCCCCHH-HHHHHHHHHHHHCCCEEEEEECCCCCCC
T ss_conf             877999946999999-9999999999987984999945777888


No 212
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=53.84  E-value=15  Score=16.37  Aligned_cols=79  Identities=13%  Similarity=0.154  Sum_probs=45.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             88800122179999999868989999647655422---222222222212222222222222222222223443444310
Q gi|254780166|r   36 ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS---DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA  112 (261)
Q Consensus        36 ~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S---~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia  112 (261)
                      |.+.+.-|+...-+..|.+.||..+.++-=  .++   |.+..+.-|--....+++..+++.-+.+.+++   ++||+.+
T Consensus       567 GqgiEFDY~~v~a~~alk~~G~~~imIN~N--PETVSTD~d~sDrLYFEplt~E~V~~I~~~E~p~gvi~---qfGGQt~  641 (1063)
T PRK05294        567 GQGIEFDYCCVHAALALREAGYETIMVNCN--PETVSTDYDTSDRLYFEPLTLEDVLEIIEKEKPKGVIV---QFGGQTP  641 (1063)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEECCC--CCCCCCCCCCCCEEEECCCCHHHHHHHHHHHCCCEEEE---ECCCCCH
T ss_conf             444230067999999999659815895378--11111565667614543688999999999758987999---7388367


Q ss_pred             HHHHHHC
Q ss_conf             1333210
Q gi|254780166|r  113 CSMVLFY  119 (261)
Q Consensus       113 ~~~a~~~  119 (261)
                      +.++..-
T Consensus       642 ~nla~~L  648 (1063)
T PRK05294        642 LKLAKAL  648 (1063)
T ss_pred             HHHHHHH
T ss_conf             8999999


No 213
>pfam00698 Acyl_transf_1 Acyl transferase domain.
Probab=53.77  E-value=3.8  Score=19.92  Aligned_cols=29  Identities=28%  Similarity=0.418  Sum_probs=22.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             22222222222222344344431013332
Q gi|254780166|r   89 VSLLEHLGISKVHVMGYSMGARIACSMVL  117 (261)
Q Consensus        89 ~~~i~~l~~~~~~liGhS~Gg~ia~~~a~  117 (261)
                      .+++...++++-.++|||+|=+-|+..+-
T Consensus        74 ~~~l~~~Gi~P~~v~GHSlGE~aA~~~aG  102 (319)
T pfam00698        74 AALLRSYGVTPAAVVGHSLGEIAAAVVAG  102 (319)
T ss_pred             HHHHHHCCCCCCEEEECCCCHHHHHHHCC
T ss_conf             20033229876668663704899998728


No 214
>pfam11713 Peptidase_C80 Peptidase C80 family. This family belongs to cysteine peptidase family C80.
Probab=53.60  E-value=2.4  Score=21.14  Aligned_cols=51  Identities=20%  Similarity=0.287  Sum_probs=24.2

Q ss_pred             EEECCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCC
Q ss_conf             996476554222222-222222122222222222222--------222222234434443
Q gi|254780166|r   60 IAFDNLGHGKSDKSY-IENDYRLVFMAADAVSLLEHL--------GISKVHVMGYSMGAR  110 (261)
Q Consensus        60 i~~D~~G~G~S~~~~-~~~~~s~~~~~~di~~~i~~l--------~~~~~~liGhS~Gg~  110 (261)
                      +.+-+-|||+..... .-..++.+..+..+..+.+.+        ..+++.|+|.|+++.
T Consensus        58 iRwqlVGHG~~~~n~~~lag~~a~~La~~l~~~~~~~~~~~~~~~~P~kI~LvGC~l~~~  117 (160)
T pfam11713        58 IRWQFVGHGRDEFNGPTLGGHTADELANKIASFRDAFLQTYGSNASPKKISLVGCSMASA  117 (160)
T ss_pred             EEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCC
T ss_conf             579999458665678432688999999999999999987534578874789998743578


No 215
>KOG1387 consensus
Probab=53.32  E-value=8.1  Score=18.01  Aligned_cols=33  Identities=21%  Similarity=0.391  Sum_probs=24.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC-HHHHHHHCC
Q ss_conf             222222222222222344344431-013332102
Q gi|254780166|r   88 AVSLLEHLGISKVHVMGYSMGARI-ACSMVLFYP  120 (261)
Q Consensus        88 i~~~i~~l~~~~~~liGhS~Gg~i-a~~~a~~~p  120 (261)
                      ++.++++-.++.+.++|.|.|+++ +++...+.|
T Consensus       117 ~R~lVea~~~~hfTllgQaigsmIl~~Eai~r~~  150 (465)
T KOG1387         117 LRYLVEASTWKHFTLLGQAIGSMILAFEAIIRFP  150 (465)
T ss_pred             EEEEEECCCCCCEEHHHHHHHHHHHHHHHHHHCC
T ss_conf             1210233556510017878888999999998188


No 216
>TIGR00137 gid gid protein; InterPro: IPR004417 The gid proteins are present in relatively few bacteria but very tightly conserved where they occur. The function of these proteins is unknown. They are closely related to gidA (glucose-inhibited division protein A), which appears to be present in all complete eubacterial genomes so far and in Saccharomyces cerevisiae..
Probab=52.10  E-value=16  Score=16.20  Aligned_cols=63  Identities=16%  Similarity=0.301  Sum_probs=34.3

Q ss_pred             CCHHHHHCCCCCEEEEEECCCC-------CC--------CCHHHHHHHCCC---CEEEEECCCCC-CCCCCCHHHHHHHH
Q ss_conf             2001210035760699847888-------78--------807999996799---79999888873-84348489999999
Q gi|254780166|r  192 FCQDDLYRIDVPVLIAVGSQDD-------LA--------GSPQELMSFIPS---SQYLNICRRDH-LLAVGDKQFKQGVV  252 (261)
Q Consensus       192 ~~~~~l~~i~~P~l~i~G~~D~-------~~--------~~~~~l~~~~p~---~~~~~i~~~gH-~~~~e~p~~~~~i~  252 (261)
                      |+++...+-+-|--++.=.+|.       +|        ...+++.+.||.   ++++.+ |+=| --++..|++....+
T Consensus       257 dfrdPankeK~PyAVVQLRqedkaGtL~n~VGFQT~L~wgeQkrVfrLIPgLeNaefVR~-GvMHRNTFInSp~lL~~~l  335 (444)
T TIGR00137       257 DFRDPANKEKKPYAVVQLRQEDKAGTLYNLVGFQTKLKWGEQKRVFRLIPGLENAEFVRL-GVMHRNTFINSPKLLTASL  335 (444)
T ss_pred             CCCCCCCCCCCCEEEEEECCCCCCCCEEEEEEEEECCEECCCCEEEECCCCCCCEEEEEE-CCCCCCCCCCCHHHHHHHH
T ss_conf             777732347885068730221756762310022210101355514440578431478850-7431111127635655753


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780166|r  253 NFY  255 (261)
Q Consensus       253 ~Fl  255 (261)
                      +|=
T Consensus       336 ~fk  338 (444)
T TIGR00137       336 QFK  338 (444)
T ss_pred             CCC
T ss_conf             047


No 217
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=50.39  E-value=17  Score=16.03  Aligned_cols=101  Identities=15%  Similarity=0.197  Sum_probs=54.1

Q ss_pred             CCEEEEECCC----CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8789999878----88800122179999999868989999647655422---2222222222122222222222222222
Q gi|254780166|r   26 APTILLIHGL----ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS---DKSYIENDYRLVFMAADAVSLLEHLGIS   98 (261)
Q Consensus        26 ~~~vv~iHG~----~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S---~~~~~~~~~s~~~~~~di~~~i~~l~~~   98 (261)
                      .+.|+.+-+.    |.+.+.-|+...-+..|.+.||..+.++-=  .++   |.+-.+.-|--....+++..+++.-+.+
T Consensus       554 ~~kvliLGsGP~RIGqgiEFDYc~vha~~aLr~~G~etImiN~N--PETVSTDyD~sDrLYFEPlt~E~V~~I~~~E~p~  631 (1068)
T PRK12815        554 KKKVLILGSGPIRIGQGIEFDYMCVHAAFALKKEGYETIMINNN--PETVSTDYDTADRLYFEPITLEDILNVAEAENIK  631 (1068)
T ss_pred             CCEEEEECCCCCEECCCCCCHHHHHHHHHHHHHCCCEEEEECCC--CCCCCCCCCCCCCEEECCCCHHHHHHHHHHHCCC
T ss_conf             83499956787142244240025899999999689748996278--4312367455773575368799999999985899


Q ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCC
Q ss_conf             22223443444310133321023565238962885
Q gi|254780166|r   99 KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS  133 (261)
Q Consensus        99 ~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~  133 (261)
                      .+++   ++||+.++.+|..-.+  .++-+.++.+
T Consensus       632 gViv---qfGGQt~lnla~~L~~--~gv~IlGts~  661 (1068)
T PRK12815        632 GVIV---QFGGQTAINLAKPLEE--AGLPILGTSP  661 (1068)
T ss_pred             EEEE---ECCCCCHHHHHHHHHH--CCCEEECCCH
T ss_conf             7999---6488236799999997--6994982786


No 218
>KOG1209 consensus
Probab=50.07  E-value=18  Score=16.00  Aligned_cols=38  Identities=21%  Similarity=0.244  Sum_probs=27.2

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             998789999878888001221799999998689899996476
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      ++.|++|+|-|-  +...  .-..++.+|+++||+|++--.+
T Consensus         4 ~~~~k~VlItgc--s~GG--IG~ala~ef~~~G~~V~AtaR~   41 (289)
T KOG1209           4 QSQPKKVLITGC--SSGG--IGYALAKEFARNGYLVYATARR   41 (289)
T ss_pred             CCCCCEEEEEEC--CCCC--HHHHHHHHHHHCCEEEEEECCC
T ss_conf             567975999605--7765--3499999998678199997022


No 219
>cd07227 Pat_Fungal_NTE1 Fungal patatin-like phospholipase domain containing protein 6. These are fungal Neuropathy Target Esterase (NTE), commonly referred to as NTE1. Patatin-like phospholipase. NTE has at least two functional domains: the N-terminal domain putatively regulatory domain and the C-terminal catalytic domain which shows esterase activity. NTE shows phospholipase activity for lysophosphatidylcholine (LPC) and phosphatidylcholine (PC). Exposure of NTE to organophosphates leads to organophosphate-induced delayed neurotoxicity (OPIDN). OPIDN is a progressive neurological condition that is characterized by weakness, paralysis, pain, and paresthesia. This family includes NTE1 from fungi.
Probab=49.59  E-value=2.9  Score=20.67  Aligned_cols=32  Identities=22%  Similarity=0.175  Sum_probs=23.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             22222222222222234434443101333210
Q gi|254780166|r   88 AVSLLEHLGISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        88 i~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      +...+++.++..-.+.|.|+|+.++..||..+
T Consensus        28 vLkaLeE~gI~iD~I~GtS~GAivGalyA~~~   59 (269)
T cd07227          28 ILQALEEAGIPIDAIGGTSIGSFVGGLYAREA   59 (269)
T ss_pred             HHHHHHHCCCCCCEEEEECHHHHHHHHHHCCC
T ss_conf             99999986998308966069999899998299


No 220
>COG3933 Transcriptional antiterminator [Transcription]
Probab=49.37  E-value=16  Score=16.27  Aligned_cols=73  Identities=14%  Similarity=0.101  Sum_probs=47.0

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78999987888800122179999999868989999647655422222222222212222222222222222222223443
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYS  106 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS  106 (261)
                      ..+|..||.. ++.   .....+..|..... +.++|+|        .+   -+..+..+.+.+-+++....+-.++=.+
T Consensus       110 ~vIiiAHG~s-TAS---SmaevanrLL~~~~-~~aiDMP--------Ld---vsp~~vle~l~e~~k~~~~~~GlllLVD  173 (470)
T COG3933         110 KVIIIAHGYS-TAS---SMAEVANRLLGEEI-FIAIDMP--------LD---VSPSDVLEKLKEYLKERDYRSGLLLLVD  173 (470)
T ss_pred             EEEEEECCCC-HHH---HHHHHHHHHHHCCC-EEEECCC--------CC---CCHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             6999725864-078---89999999863253-0134687--------76---7889999999999984475674599982


Q ss_pred             CCCCCHHHH
Q ss_conf             444310133
Q gi|254780166|r  107 MGARIACSM  115 (261)
Q Consensus       107 ~Gg~ia~~~  115 (261)
                      ||......-
T Consensus       174 MGSL~~f~~  182 (470)
T COG3933         174 MGSLTSFGS  182 (470)
T ss_pred             CCHHHHHHH
T ss_conf             530878999


No 221
>smart00827 PKS_AT Acyl transferase domain in polyketide synthase (PKS) enzymes.
Probab=49.24  E-value=2.9  Score=20.64  Aligned_cols=28  Identities=25%  Similarity=0.339  Sum_probs=21.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             2222222222222234434443101333
Q gi|254780166|r   89 VSLLEHLGISKVHVMGYSMGARIACSMV  116 (261)
Q Consensus        89 ~~~i~~l~~~~~~liGhS~Gg~ia~~~a  116 (261)
                      .+++...++.+-.++|||+|=+.|+..+
T Consensus        73 ~~~l~~~Gi~Pd~v~GhSlGE~aAl~aa  100 (298)
T smart00827       73 ARLWRSWGVRPDAVVGHSLGEIAAAYVA  100 (298)
T ss_pred             HHHHHHCCCCCCEEEECCHHHHHHHHHC
T ss_conf             9999985998777865579899999984


No 222
>cd07225 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domain containing protein 6 and protein 7. Patatin-like phospholipase domain containing protein 6 (PNPLA6) and protein 7 (PNPLA7) are 60% identical to each other. PNPLA6 is commonly known as Neuropathy Target Esterase (NTE). NTE has at least two functional domains: the N-terminal domain putatively regulatory domain and the C-terminal catalytic domain which shows esterase activity. NTE shows phospholipase activity for lysophosphatidylcholine (LPC) and phosphatidylcholine (PC). Exposure of NTE to organophosphates leads to organophosphate-induced delayed neurotoxicity (OPIDN). OPIDN is a progressive neurological condition that is characterized by weakness, paralysis, pain, and paresthesia. PNPLA7 is an insulin-regulated phospholipase that is homologous to Neuropathy Target Esterase (NTE or PNPLA6) and is also known as NTE-related esterase (NRE). Human NRE is predominantly expressed in prostate, white adipose, and pancreatic tissue. NRE 
Probab=49.20  E-value=2.9  Score=20.65  Aligned_cols=62  Identities=27%  Similarity=0.229  Sum_probs=37.3

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             1799999998689899996476554222222222222122222222222222222222234434443101333210
Q gi|254780166|r   44 LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        44 ~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      .|..+++.+..+   .|..=+-|=|  .+       .+.+ +. +...+++.++..-.+.|.|+|+.++..||..+
T Consensus         3 d~~r~aR~l~g~---~IgLvLsGGG--ar-------G~AH-iG-VLkaLeE~GI~id~I~GtS~GAivgalyA~g~   64 (306)
T cd07225           3 DFSRLARVLTGN---SIALVLGGGG--AR-------GCAH-IG-VIKALEEAGIPVDMVGGTSIGAFIGALYAEER   64 (306)
T ss_pred             HHHHHHHHHHCC---EEEEEECCHH--HH-------HHHH-HH-HHHHHHHCCCCCCEEEECHHHHHHHHHHHCCC
T ss_conf             178999998498---6999957509--99-------9999-99-99999986999319983039899999998799


No 223
>pfam03205 MobB Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop.
Probab=48.55  E-value=19  Score=15.86  Aligned_cols=43  Identities=30%  Similarity=0.512  Sum_probs=30.5

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC
Q ss_conf             89999878888001221799999998689899996476554222
Q gi|254780166|r   28 TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD   71 (261)
Q Consensus        28 ~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~   71 (261)
                      |+|++-|.-.+..+ .....++.++.++||+++++=...+|.++
T Consensus         1 p~v~i~G~~~sGKt-tl~~~L~~~~~~~g~~~~~~~~~d~gq~~   43 (122)
T pfam03205         1 PIVLVVGPKDSGKT-TLIRKLLNYLKRRGYRVAVVKHLDHGQGE   43 (122)
T ss_pred             CEEEEECCCCCCHH-HHHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             97999948999899-99999999999879944899989999877


No 224
>pfam06309 Torsin Torsin. This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterized by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of (pfam00004) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia.
Probab=48.19  E-value=19  Score=15.83  Aligned_cols=34  Identities=18%  Similarity=0.274  Sum_probs=16.3

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48998789999878888001221799999998689
Q gi|254780166|r   22 GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQG   56 (261)
Q Consensus        22 g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g   56 (261)
                      .++.+|-|+-+||+.|+... +.-.-+++.|-..|
T Consensus        48 ~~p~KpLVlSfHG~tGtGKn-~vs~liA~~Ly~~G   81 (127)
T pfam06309        48 PKPRKPLVLSFHGWTGTGKN-FVAEIIADNLYRDG   81 (127)
T ss_pred             CCCCCCEEEEECCCCCCCHH-HHHHHHHHHHHHCC
T ss_conf             99999748870189998798-99999999987543


No 225
>COG4822 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism]
Probab=47.20  E-value=19  Score=15.74  Aligned_cols=53  Identities=8%  Similarity=0.247  Sum_probs=25.0

Q ss_pred             CCEEEEEECCC--CCCCCHH-HHHHHC--CCCEEEE-ECCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             76069984788--8788079-999967--9979999-888873843484899999999987516
Q gi|254780166|r  202 VPVLIAVGSQD--DLAGSPQ-ELMSFI--PSSQYLN-ICRRDHLLAVGDKQFKQGVVNFYANEL  259 (261)
Q Consensus       202 ~P~l~i~G~~D--~~~~~~~-~l~~~~--p~~~~~~-i~~~gH~~~~e~p~~~~~i~~Fl~~~~  259 (261)
                      +|.+++.|++-  .+.+..+ .-...+  .+-++.. +.|-|     |.|.+-+..++.++..+
T Consensus       199 ~PlMlvAG~Ha~nDMasddedswk~il~~~G~~v~~~l~GLG-----E~~~iq~ifi~Hik~ai  257 (265)
T COG4822         199 IPLMLVAGDHAKNDMASDDEDSWKNILEKNGFKVEVYLHGLG-----ENPAIQAIFIDHIKDAI  257 (265)
T ss_pred             EEEEEEECHHHHHHHCCCCHHHHHHHHHHCCCEEEEEEECCC-----CCHHHHHHHHHHHHHHH
T ss_conf             656886040223211126347899999867954688760577-----76789999999999998


No 226
>pfam09994 DUF2235 Uncharacterized conserved protein (DUF2235). This domain, found in various hypothetical bacterial proteins, has no known function.
Probab=46.80  E-value=20  Score=15.70  Aligned_cols=92  Identities=17%  Similarity=0.175  Sum_probs=45.1

Q ss_pred             CEEEEECCCCCCCHHH---HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC-----CCCCCCCCCCCCCC-CCCCC-C
Q ss_conf             7899998788880012---2179999999868989999647655422222222-----22221222222222-22222-2
Q gi|254780166|r   27 PTILLIHGLASSVQTN---WLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE-----NDYRLVFMAADAVS-LLEHL-G   96 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~---~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~-----~~~s~~~~~~di~~-~i~~l-~   96 (261)
                      ..|||+=|.+.+.+..   +--..+.+.+...+-+.+++=.+|-|-.......     ....++..+.+.-. +++.. .
T Consensus         2 ~iiv~~DGT~n~~~~~~~~TNV~rL~~~~~~~~~~q~~~Y~~GVGT~~~~~~~~~g~a~G~g~~~~i~~Ay~fl~~~y~~   81 (261)
T pfam09994         2 RLVLCFDGTGNNLEGDAPPSNVAKLFRALDRSGPPQIVYYDPGVGTSGSRLDKALGGAFGSGLDRNVREAYRFLARNYRP   81 (261)
T ss_pred             EEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCC
T ss_conf             19999628999899999888999999986147987699974898477752033311254402799999999999983789


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             2222223443444310133321
Q gi|254780166|r   97 ISKVHVMGYSMGARIACSMVLF  118 (261)
Q Consensus        97 ~~~~~liGhS~Gg~ia~~~a~~  118 (261)
                      -+++.|+|.|-|+..|-.++..
T Consensus        82 gD~I~lFGFSRGA~tAR~la~~  103 (261)
T pfam09994        82 GDEIYLFGFSRGAYTARALAGL  103 (261)
T ss_pred             CCEEEEEECCCCHHHHHHHHHH
T ss_conf             9889995035428999999988


No 227
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT). This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes. Thiopurine S-methyltransferase (TPMT) is a cytosolic enzyme that catalyses S-methylation of aromatic and heterocyclic sulfhydryl compounds, including anticancer and immunosuppressive thiopurines.
Probab=45.80  E-value=20  Score=15.60  Aligned_cols=31  Identities=16%  Similarity=0.210  Sum_probs=22.1

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             789999878888001221799999998689899996476
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      +.=||+.|=|-+.+        +..|+++||+|+..|+-
T Consensus        23 ~~rvlVPlCGks~D--------~~wLa~~G~~VvGvels   53 (203)
T pfam05724        23 GLRVLVPLCGKALD--------MVWLAEQGHFVVGVEIS   53 (203)
T ss_pred             CCEEEEECCCCHHH--------HHHHHHCCCEEEEEECC
T ss_conf             98899968998599--------99998389848999567


No 228
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=45.73  E-value=21  Score=15.60  Aligned_cols=22  Identities=18%  Similarity=0.305  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHCCCEEEEECCC
Q ss_conf             1799999998689899996476
Q gi|254780166|r   44 LFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        44 ~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      +-.+.+..|.++||.|..||..
T Consensus        11 MG~~mA~nL~~~G~~V~v~d~~   32 (298)
T PRK12490         11 MGGNMAERLREDGHEVVGYDVN   32 (298)
T ss_pred             HHHHHHHHHHHCCCEEEEECCC
T ss_conf             6899999999779948998499


No 229
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed
Probab=43.72  E-value=14  Score=16.55  Aligned_cols=36  Identities=22%  Similarity=0.207  Sum_probs=21.9

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             8789999878888001221799999998689899996476554
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG   68 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G   68 (261)
                      +..+|-+.|.=.|+.     .  +..|.++||.|+.+-++-+.
T Consensus         5 ~rV~VamSGGVDSsV-----a--A~LL~~~Gy~V~Gv~m~~w~   40 (355)
T PRK00143          5 KRVVVGMSGGVDSSV-----A--AALLKEQGYDVIGLFMKLWD   40 (355)
T ss_pred             CEEEEEECCCHHHHH-----H--HHHHHHCCCCEEEEEEECCC
T ss_conf             889999167899999-----9--99999779958999998876


No 230
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism]
Probab=43.28  E-value=6.1  Score=18.74  Aligned_cols=22  Identities=23%  Similarity=0.483  Sum_probs=12.2

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             2222234434443101333210
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      .++-+-|||+||.+|..+..++
T Consensus       276 a~iwlTGHSLGGa~AsLlG~~f  297 (425)
T COG5153         276 ARIWLTGHSLGGAIASLLGIRF  297 (425)
T ss_pred             CEEEEECCCCCHHHHHHHCCCC
T ss_conf             4489953661068999753004


No 231
>KOG4540 consensus
Probab=43.28  E-value=6.1  Score=18.74  Aligned_cols=22  Identities=23%  Similarity=0.483  Sum_probs=12.2

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             2222234434443101333210
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      .++-+-|||+||.+|..+..++
T Consensus       276 a~iwlTGHSLGGa~AsLlG~~f  297 (425)
T KOG4540         276 ARIWLTGHSLGGAIASLLGIRF  297 (425)
T ss_pred             CEEEEECCCCCHHHHHHHCCCC
T ss_conf             4489953661068999753004


No 232
>PRK07659 enoyl-CoA hydratase; Provisional
Probab=43.24  E-value=22  Score=15.37  Aligned_cols=112  Identities=11%  Similarity=0.096  Sum_probs=50.6

Q ss_pred             CCCCEEEEEECCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC-
Q ss_conf             9764079993499499999964899878999987888800122179999999868989999647655422222222222-
Q gi|254780166|r    1 MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY-   79 (261)
Q Consensus         1 ~~~~~~~~~~~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~-   79 (261)
                      ||++++.......-.+.+.....|.+     .+  ..+..........+..+.+..-+++.+.=.|-..|.+.....-. 
T Consensus         1 ~~~~~e~i~~e~~~~Va~itlnrP~~-----~N--al~~~m~~~l~~~l~~~~d~~~r~vVl~g~G~~FcaG~Dl~~~~~   73 (260)
T PRK07659          1 VTSKMESVVVKYEGHVATIMLNRPEA-----LN--ALDEPMLKELLEALKEVAESSAHIVVLRGNGRGFSAGGDIKMMLS   73 (260)
T ss_pred             CCCCCCEEEEEEECCEEEEEECCCCC-----CC--CCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCEECCCCHHHHHC
T ss_conf             99988807999999999999748888-----89--989999999999999975799869999757984388867688753


Q ss_pred             -----CCCCCCCCCCCCCCCC-CCCCCC---CCCCCCCCCCHHHHHHHC
Q ss_conf             -----2122222222222222-222222---234434443101333210
Q gi|254780166|r   80 -----RLVFMAADAVSLLEHL-GISKVH---VMGYSMGARIACSMVLFY  119 (261)
Q Consensus        80 -----s~~~~~~di~~~i~~l-~~~~~~---liGhS~Gg~ia~~~a~~~  119 (261)
                           +.....+.+..++..+ ...+.+   +=|+.+||.+.+.++...
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~~~kPvIaav~G~a~GgG~~lal~cD~  122 (260)
T PRK07659         74 SNDESKFDRVMNTISEIVVTLYTMPKLVISAIHGPAAGLGLSLALTADY  122 (260)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEEEECHHHHHHHCCC
T ss_conf             5786789999999999999999689989999637066413499874274


No 233
>pfam05707 Zot Zonular occludens toxin (Zot). This family consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophages present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers
Probab=43.16  E-value=23  Score=15.36  Aligned_cols=37  Identities=32%  Similarity=0.267  Sum_probs=26.4

Q ss_pred             EEEECCCCCCCHHHHHHHH-HHHHHHHCCCEEEEECCCCC
Q ss_conf             9999878888001221799-99999868989999647655
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGH   67 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~-~~~~l~~~g~~vi~~D~~G~   67 (261)
                      |.+++|-+||..+...... +.+.+ ++|..|++ +.+|.
T Consensus         2 I~litG~pGsGKS~~aV~~~i~~al-~~GR~V~t-NI~gL   39 (183)
T pfam05707         2 IYLITGKPGSGKTLEAVSYHILPAL-KKGRKVIT-NIDGL   39 (183)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHH-HCCCEEEE-CCCCC
T ss_conf             7999359999622999999999998-78998998-78653


No 234
>KOG1283 consensus
Probab=40.26  E-value=6.6  Score=18.55  Aligned_cols=116  Identities=19%  Similarity=0.206  Sum_probs=63.5

Q ss_pred             EEEEECCCCEEEEE----EECCCCCCEE-EEECCCCCCCHH-HHHHHHHH-----------HHHHHCCCEEEEECCC-CC
Q ss_conf             79993499499999----9648998789-999878888001-22179999-----------9998689899996476-55
Q gi|254780166|r    6 KFFRSWRKYQFAFY----DVGDKDAPTI-LLIHGLASSVQT-NWLFSGWI-----------QLLCDQGFRVIAFDNL-GH   67 (261)
Q Consensus         6 ~~~~~~dG~~l~y~----~~g~~~~~~v-v~iHG~~~~~~~-~~~~~~~~-----------~~l~~~g~~vi~~D~~-G~   67 (261)
                      -|....++..+.|.    ....+..+|+ +.+.|.++.... .-.|..+-           ..|..+  .++..|-| |-
T Consensus         6 g~v~vr~~a~~F~wly~~~~~~ks~~pl~lwlqGgpGaSstG~GNFeE~GPl~~~~~~r~~TWlk~a--dllfvDnPVGa   83 (414)
T KOG1283           6 GYVDVRTGAHMFWWLYYATANVKSERPLALWLQGGPGASSTGFGNFEELGPLDLDGSPRDWTWLKDA--DLLFVDNPVGA   83 (414)
T ss_pred             CCEEEECCCEEEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCHHHCCCCCCCCCCCCCHHHHHC--CEEEECCCCCC
T ss_conf             6305524854898886611343457872688137898777674656442876467996875355316--68886277767


Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCHHHHHHHCCCCCC
Q ss_conf             422222222222--2122222222222222-------22222223443444310133321023565
Q gi|254780166|r   68 GKSDKSYIENDY--RLVFMAADAVSLLEHL-------GISKVHVMGYSMGARIACSMVLFYPSYVR  124 (261)
Q Consensus        68 G~S~~~~~~~~~--s~~~~~~di~~~i~~l-------~~~~~~liGhS~Gg~ia~~~a~~~p~~v~  124 (261)
                      |.|--.. ..-|  +.+..+.|+.+++..+       +..+.+++.-|+||-++..++..-.+.|+
T Consensus        84 GfSyVdg-~~~Y~~~~~qia~Dl~~llk~f~~~h~e~~t~P~~If~ESYGGKma~k~al~l~~aIk  148 (414)
T KOG1283          84 GFSYVDG-SSAYTTNNKQIALDLVELLKGFFTNHPEFKTVPLYIFCESYGGKMAAKFALELDDAIK  148 (414)
T ss_pred             CEEEECC-CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEHHCCCCHHHHHHHHHHHHHH
T ss_conf             6005648-5310044799999999999999744943145554999800066010333046788885


No 235
>COG1752 RssA Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only]
Probab=40.15  E-value=5.3  Score=19.09  Aligned_cols=10  Identities=30%  Similarity=0.574  Sum_probs=5.5

Q ss_pred             HHHHHHHHCC
Q ss_conf             9999998689
Q gi|254780166|r   47 GWIQLLCDQG   56 (261)
Q Consensus        47 ~~~~~l~~~g   56 (261)
                      ..++.|.+.|
T Consensus        28 GVl~aL~e~g   37 (306)
T COG1752          28 GVLKALEEAG   37 (306)
T ss_pred             HHHHHHHHCC
T ss_conf             9999999769


No 236
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional
Probab=39.44  E-value=6.6  Score=18.55  Aligned_cols=40  Identities=20%  Similarity=0.183  Sum_probs=28.0

Q ss_pred             CCCCCCCCCCC---CCCCCCCCCCCCCHHHHHHHCCCCCCCEEE
Q ss_conf             22222222222---222234434443101333210235652389
Q gi|254780166|r   88 AVSLLEHLGIS---KVHVMGYSMGARIACSMVLFYPSYVRSVIL  128 (261)
Q Consensus        88 i~~~i~~l~~~---~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl  128 (261)
                      +..++++++++   ++.=||.+|||. +..+|.++.-+|.++++
T Consensus       156 l~~i~~kl~l~~G~~VLeIGcGWGgl-a~~aA~~~g~~VtgiTl  198 (383)
T PRK11705        156 LDLICRKLQLKPGMRVLDIGCGWGGL-ARYAAEHYGVSVVGVTI  198 (383)
T ss_pred             HHHHHHHCCCCCCCEEEEECCCHHHH-HHHHHHHCCCEEEEEEC
T ss_conf             99999864899999798857874999-99999974975999858


No 237
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional
Probab=39.17  E-value=13  Score=16.71  Aligned_cols=37  Identities=5%  Similarity=0.126  Sum_probs=21.1

Q ss_pred             CCCCEE--EEEECCCCEEEEEEECCCCC--CEEEEECCCCC
Q ss_conf             976407--99934994999999648998--78999987888
Q gi|254780166|r    1 MMNEVK--FFRSWRKYQFAFYDVGDKDA--PTILLIHGLAS   37 (261)
Q Consensus         1 ~~~~~~--~~~~~dG~~l~y~~~g~~~~--~~vv~iHG~~~   37 (261)
                      ||.+|.  +....||..+.=+..|....  -=|||--|..|
T Consensus         1 ~~~~~~~A~LvLedG~~f~G~~fG~~~~~~GEvVFnT~MtG   41 (383)
T CHL00197          1 LMKKMIPAILVLEDGTVYRGWSFSNPITSIGEVVFNTGMTG   41 (383)
T ss_pred             CCCCCCCEEEEECCCCEEEEEECCCCCCEEEEEEEECCCCC
T ss_conf             95656768999669998987974877767789999799787


No 238
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents the small subunit of the glutamine-dependent form (6.3.5.5 from EC) of carbamoyl phosphate synthase, CPSase II. The small subunit catalyses the hydrolysis of glutamine to ammonia, which in turn used by the large chain to synthesize carbamoyl phosphate. The C-terminal domain of the small subunit of CPSase has glutamine amidotransferase activity. Note that the sequence from the mammalian urea cycle form has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I (6.3.4.16 from EC). CPSases of pyrimidine biosynthesis, arginine biosynthesis, and the urea cycle may be encoded by one or by several genes, depending on the species. ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=37.89  E-value=16  Score=16.17  Aligned_cols=31  Identities=13%  Similarity=0.266  Sum_probs=18.7

Q ss_pred             EEEECCCCEEEEEEECCCCCC--EEEEECCCCC
Q ss_conf             999349949999996489987--8999987888
Q gi|254780166|r    7 FFRSWRKYQFAFYDVGDKDAP--TILLIHGLAS   37 (261)
Q Consensus         7 ~~~~~dG~~l~y~~~g~~~~~--~vv~iHG~~~   37 (261)
                      +++..||+.+.=+.+|.+...  =|||--|..|
T Consensus         2 ~LvLeDGt~f~G~sFGa~~~~~GE~VFnTgMTG   34 (383)
T TIGR01368         2 YLVLEDGTVFEGYSFGAEGTVAGEVVFNTGMTG   34 (383)
T ss_pred             EEECCCCCEEEEEEECCCCCEEEEEEEECCCCC
T ss_conf             778137877788884566654888988368977


No 239
>pfam03283 PAE Pectinacetylesterase.
Probab=37.17  E-value=28  Score=14.79  Aligned_cols=21  Identities=24%  Similarity=0.129  Sum_probs=15.5

Q ss_pred             CCCCCCCCCCCCCCCHHHHHH
Q ss_conf             222222344344431013332
Q gi|254780166|r   97 ISKVHVMGYSMGARIACSMVL  117 (261)
Q Consensus        97 ~~~~~liGhS~Gg~ia~~~a~  117 (261)
                      .++++|-|.|-||.-++..+-
T Consensus       155 A~~viLsG~SAGGLa~~lh~D  175 (366)
T pfam03283       155 AKQVILSGCSAGGLAAILHCD  175 (366)
T ss_pred             CCEEEEECCCCCHHHHHHHHH
T ss_conf             564787246751177776689


No 240
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolysed for each amidation .; GO: 0003824 catalytic activity, 0009236 cobalamin biosynthetic process.
Probab=36.84  E-value=22  Score=15.45  Aligned_cols=68  Identities=13%  Similarity=0.306  Sum_probs=31.8

Q ss_pred             HHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCHHHHHHHC--C----C
Q ss_conf             99986898999964765542222222222221222222222--22222222222234434443101333210--2----3
Q gi|254780166|r   50 QLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVS--LLEHLGISKVHVMGYSMGARIACSMVLFY--P----S  121 (261)
Q Consensus        50 ~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~--~i~~l~~~~~~liGhS~Gg~ia~~~a~~~--p----~  121 (261)
                      +.|+ +.|.+|.++=.|        .+..+.+.  -+|+..  +.+.++-+-+.+.=-.-||.+|.-+....  |    .
T Consensus       117 e~L~-~~Yd~vv~EGAG--------S~AEINL~--~rDLaN~~iA~~~~A~~iLvADIDRGGVFAsi~GTl~LL~~~~r~  185 (502)
T TIGR00313       117 EILA-EEYDLVVIEGAG--------SPAEINLK--ERDLANMRIAELADADVILVADIDRGGVFASIYGTLKLLPEEERK  185 (502)
T ss_pred             HHHH-CCCCEEEEECCC--------CCCCCCCC--CCCCHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             8752-028889982688--------71000533--157224789864397679997507774324337466618834575


Q ss_pred             CCCCEEE
Q ss_conf             5652389
Q gi|254780166|r  122 YVRSVIL  128 (261)
Q Consensus       122 ~v~~lvl  128 (261)
                      +|+++|+
T Consensus       186 liKG~vI  192 (502)
T TIGR00313       186 LIKGIVI  192 (502)
T ss_pred             EECEEEE
T ss_conf             0030688


No 241
>PRK05541 adenylylsulfate kinase; Provisional
Probab=36.81  E-value=28  Score=14.76  Aligned_cols=39  Identities=26%  Similarity=0.181  Sum_probs=30.1

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             9878999987888800122179999999868989999647
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN   64 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~   64 (261)
                      .++.||.+-|..|+..+ +.-..+...|..+|+.++.+|-
T Consensus         5 ~kg~viW~TGLsGSGKT-TiA~~l~~~L~~~g~~~~~LDG   43 (176)
T PRK05541          5 PNGYVIWITGLAGSGKT-TIAKALYERLKLKYSNVIYLDG   43 (176)
T ss_pred             CCCEEEEEECCCCCCHH-HHHHHHHHHHHHCCCCEEEECC
T ss_conf             88679997899999899-9999999999975997799886


No 242
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=36.37  E-value=29  Score=14.72  Aligned_cols=22  Identities=18%  Similarity=0.276  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHCCCEEEEECCC
Q ss_conf             1799999998689899996476
Q gi|254780166|r   44 LFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        44 ~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      +-.+.+..|+++||.|..||..
T Consensus        11 MG~~mA~nL~~~G~~V~v~dr~   32 (301)
T PRK09599         11 MGGNMARRLLRGGHEVVGYDRN   32 (301)
T ss_pred             HHHHHHHHHHHCCCEEEEECCC
T ss_conf             7999999999689907997699


No 243
>PRK13512 coenzyme A disulfide reductase; Provisional
Probab=36.35  E-value=25  Score=15.07  Aligned_cols=43  Identities=12%  Similarity=0.050  Sum_probs=29.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             2222222222222344344431013332102356523896288563
Q gi|254780166|r   90 SLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL  135 (261)
Q Consensus        90 ~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~  135 (261)
                      ++++.-+.+++.++|   ||.+++++|.....+=..++++...+.+
T Consensus       141 ~~~~~~~~k~vvIIG---gG~IGlE~A~~l~~~G~~Vtlie~~~~~  183 (438)
T PRK13512        141 QFIKANQVDKVLVVG---AGYVSLEVLENLYERGLHPTLIHRSDKI  183 (438)
T ss_pred             HHHHHCCCCEEEEEC---CCHHHHHHHHHHHHCCCEEEEEEECCCC
T ss_conf             988617997799989---5589999999999729908999935731


No 244
>TIGR03453 partition_RepA plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error.
Probab=35.90  E-value=29  Score=14.67  Aligned_cols=44  Identities=20%  Similarity=0.248  Sum_probs=29.9

Q ss_pred             CCCEEEEECCC-CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
Q ss_conf             98789999878-8880012217999999986898999964765542
Q gi|254780166|r   25 DAPTILLIHGL-ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK   69 (261)
Q Consensus        25 ~~~~vv~iHG~-~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~   69 (261)
                      ++..||-+--+ ||...+ +.-..++..|+.+||+|+++|+--.|.
T Consensus       102 ~~~~VIav~N~KGGVGKT-Ttav~LA~~LA~~G~RVLvIDLDPQan  146 (387)
T TIGR03453       102 EHLQVIAVTNFKGGSGKT-TTSAHLAQYLALRGYRVLAIDLDPQAS  146 (387)
T ss_pred             CCCEEEEEECCCCCCHHH-HHHHHHHHHHHHCCCCEEEEECCCHHH
T ss_conf             988089997888765699-999999999997799889995370167


No 245
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase. Members of this protein family are CoA-disulfide reductase (EC 1.8.1.14), as characterized in Staphylococcus aureus, Pyrococcus horikoshii, and Borrelia burgdorferi, and inferred in several other species on the basis of high levels of CoA and an absence of glutathione as a protective thiol.
Probab=35.44  E-value=30  Score=14.65  Aligned_cols=48  Identities=19%  Similarity=0.205  Sum_probs=33.0

Q ss_pred             CCCCCCCCC---CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCC
Q ss_conf             222222222---222222223443444310133321023565238962885633
Q gi|254780166|r   86 ADAVSLLEH---LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY  136 (261)
Q Consensus        86 ~di~~~i~~---l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~  136 (261)
                      +|...+.+.   -+.+++.++|   ||.+++++|.....+=..++++...+.+.
T Consensus       123 ~Da~~i~~~l~~~~~k~vvViG---gG~IGlE~A~~l~~~G~~Vtvve~~~~il  173 (427)
T TIGR03385       123 EDTDAIKQYIDANKVDRVVIIG---GGYIGLEMVEALRERGKNVTLIHRSDKIL  173 (427)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEC---CCHHHHHHHHHHHHCCCEEEEEEECCCCC
T ss_conf             9999999987507998899999---63999999999997699899998468336


No 246
>PRK11613 folP dihydropteroate synthase; Provisional
Probab=34.61  E-value=31  Score=14.55  Aligned_cols=45  Identities=16%  Similarity=0.214  Sum_probs=22.7

Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999998689899996476554222222222222122222222222222
Q gi|254780166|r   46 SGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL   95 (261)
Q Consensus        46 ~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l   95 (261)
                      ...+..+.++|=.+|  |.=  |+|++|... ..+.+...+-+.-+++.+
T Consensus        41 ~~~a~~mi~~GAdiI--DIG--geSTrPga~-~vs~eeE~~Rl~pvi~~i   85 (282)
T PRK11613         41 VKHANLMINAGATII--DVG--GESTRPGAA-EVSVEEELDRVIPVVEAI   85 (282)
T ss_pred             HHHHHHHHHCCCCEE--EEC--CCCCCCCCC-CCCHHHHHHHHHHHHHHH
T ss_conf             999999998899699--979--825899898-689899999999999999


No 247
>PRK13869 plasmid-partitioning protein RepA; Provisional
Probab=33.99  E-value=32  Score=14.49  Aligned_cols=44  Identities=23%  Similarity=0.250  Sum_probs=29.6

Q ss_pred             CCCEEEEECCC-CCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
Q ss_conf             98789999878-8880012217999999986898999964765542
Q gi|254780166|r   25 DAPTILLIHGL-ASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK   69 (261)
Q Consensus        25 ~~~~vv~iHG~-~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~   69 (261)
                      +...||-+--+ ||...+ +.-..++..|+.+||+|+++|+--.|-
T Consensus       119 ~~~kVIaVaN~KGGVGKT-Ttav~LA~~LA~~G~RVLlIDLDPQgn  163 (405)
T PRK13869        119 EHLQVIAVTNFKGGSGKT-TTSAHLAQYLALQGYRVLAVDLDPQAS  163 (405)
T ss_pred             CCCEEEEEECCCCCCHHH-HHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             998289997888776599-999999999997799889996456178


No 248
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed
Probab=33.77  E-value=20  Score=15.64  Aligned_cols=32  Identities=9%  Similarity=0.040  Sum_probs=19.3

Q ss_pred             EEEEECCCCEEEEEEECCCCC--CEEEEECCCCC
Q ss_conf             799934994999999648998--78999987888
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVGDKDA--PTILLIHGLAS   37 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g~~~~--~~vv~iHG~~~   37 (261)
                      -+....||..+.=+.+|.+..  -=|||-.|..|
T Consensus         3 a~L~LeDGt~f~G~~fG~~~~~~GEvVFnT~MtG   36 (356)
T PRK12838          3 AYLILEDGTTFEGELFGAPIDVTGELVFNTGMTG   36 (356)
T ss_pred             EEEEECCCCEEEEEEECCCCCEEEEEEEECCCCC
T ss_conf             7999679999987970777768899999699787


No 249
>PRK03846 adenylylsulfate kinase; Provisional
Probab=33.25  E-value=32  Score=14.41  Aligned_cols=40  Identities=18%  Similarity=0.241  Sum_probs=30.3

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             99878999987888800122179999999868989999647
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN   64 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~   64 (261)
                      +..+.||++-|..|+..+ +.-..+...|.+.|+.++.+|-
T Consensus        21 ~~kg~viWlTGLSGSGKT-TlA~~L~~~L~~~~~~~~~LDG   60 (198)
T PRK03846         21 GHKGVVLWFTGLSGSGKS-TVAGALEEALHELGVHTYLLDG   60 (198)
T ss_pred             CCCCEEEEEECCCCCCHH-HHHHHHHHHHHHCCCCEEEECH
T ss_conf             899869998799999889-9999999999975997599777


No 250
>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only]
Probab=33.20  E-value=33  Score=14.41  Aligned_cols=15  Identities=20%  Similarity=0.414  Sum_probs=6.0

Q ss_pred             CCCCCCEEEEECCCC
Q ss_conf             489987899998788
Q gi|254780166|r   22 GDKDAPTILLIHGLA   36 (261)
Q Consensus        22 g~~~~~~vv~iHG~~   36 (261)
                      |+.++..=+|+.|=.
T Consensus        55 ~ps~kkV~~fvNgkl   69 (580)
T COG5083          55 GPSNKKVHLFVNGKL   69 (580)
T ss_pred             CCCCCEEEEEECCEE
T ss_conf             257867999977653


No 251
>PRK13255 thiopurine S-methyltransferase; Reviewed
Probab=33.16  E-value=33  Score=14.41  Aligned_cols=31  Identities=19%  Similarity=0.284  Sum_probs=21.5

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             789999878888001221799999998689899996476
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      ..=||+++=|-+.+        +..|+++||+|+..|+.
T Consensus        38 ~~rVlVPlCGKs~D--------m~wLa~~G~~VvGvEls   68 (218)
T PRK13255         38 GSRVLVPLCGKSLD--------MLWLAEQGHEVLGVELS   68 (218)
T ss_pred             CCEEEEECCCCHHH--------HHHHHHCCCEEEEEECH
T ss_conf             98699948986776--------99998489726998352


No 252
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases. ExpC in Rhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucan (exopolysaccharide II).
Probab=32.92  E-value=33  Score=14.38  Aligned_cols=32  Identities=25%  Similarity=0.346  Sum_probs=24.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             9999878888001221799999998689899996476
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      |+|+|...-.     .|..+++.|+.+|+.|..+...
T Consensus         2 ~~~~~~~~p~-----q~r~LA~~La~rGHeV~Vit~~   33 (396)
T cd03818           2 ILFVHQNFPG-----QFRHLAPALAAQGHEVVFLTEP   33 (396)
T ss_pred             EEEECCCCCH-----HHHHHHHHHHHCCCEEEEEECC
T ss_conf             8998899881-----6999999999789989999689


No 253
>TIGR02873 spore_ylxY probable sporulation protein, polysaccharide deacetylase family; InterPro: IPR014228   Members of this entry include YlxY, and are related to IPR014132 from INTERPRO, which represents a subset of the polysaccharide deacetylase family found in a species if, and only if, the species forms endospores e.g. Bacillus subtilis or Clostridium tetani. Proteins in this entry are likewise restricted to spore-formers, but are not universally found among endospore-forming species..
Probab=32.71  E-value=33  Score=14.36  Aligned_cols=26  Identities=12%  Similarity=0.091  Sum_probs=11.1

Q ss_pred             HCCCCCEEEEEE-CCCCCCCCHHHHHH
Q ss_conf             003576069984-78887880799999
Q gi|254780166|r  198 YRIDVPVLIAVG-SQDDLAGSPQELMS  223 (261)
Q Consensus       198 ~~i~~P~l~i~G-~~D~~~~~~~~l~~  223 (261)
                      ...++-|.+++= .-|.--|.+..|..
T Consensus       197 ad~~M~TimWtVDTIDWk~P~p~vl~~  223 (269)
T TIGR02873       197 ADLQMGTIMWTVDTIDWKNPEPSVLVD  223 (269)
T ss_pred             HHCCCCEEEEEECCCCCCCCCHHHHHH
T ss_conf             746896388743112477887468988


No 254
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically  Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+.  ME has been found in all organisms, and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2.  This subfamily consists of eukaryotic and bacterial ME.  Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH
Probab=32.48  E-value=33  Score=14.34  Aligned_cols=88  Identities=18%  Similarity=0.267  Sum_probs=40.5

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCC-------EEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             7899998788880012217999999986898-------9999647655---4222222222222122222222222222-
Q gi|254780166|r   27 PTILLIHGLASSVQTNWLFSGWIQLLCDQGF-------RVIAFDNLGH---GKSDKSYIENDYRLVFMAADAVSLLEHL-   95 (261)
Q Consensus        27 ~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~-------~vi~~D~~G~---G~S~~~~~~~~~s~~~~~~di~~~i~~l-   95 (261)
                      ..||+ .|-|+ +.. -.-..+...+...|.       +++.+|..|-   ++.+.+.....|--...-.+...+.+.+ 
T Consensus        26 ~riv~-~GAGs-Ag~-gia~~l~~~~~~~G~~~eeA~~~i~~~D~~Gli~~~r~dl~~~k~~~a~~~~~~~~~~L~e~v~  102 (279)
T cd05312          26 QRILF-LGAGS-AGI-GIADLIVSAMVREGLSEEEARKKIWLVDSKGLLTKDRKDLTPFKKPFARKDEEKEGKSLLEVVK  102 (279)
T ss_pred             CEEEE-ECCCH-HHH-HHHHHHHHHHHHCCCCHHHHHCEEEEECCCCEEECCCCCCHHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             37999-79758-999-9999999999985999788617099965887531799986499999987474568999999997


Q ss_pred             CCCCCCCCCCC-CCCCCHHHHHH
Q ss_conf             22222223443-44431013332
Q gi|254780166|r   96 GISKVHVMGYS-MGARIACSMVL  117 (261)
Q Consensus        96 ~~~~~~liGhS-~Gg~ia~~~a~  117 (261)
                      +.++-+|+|.| -||.+.-....
T Consensus       103 ~~kp~vlIG~S~~~g~ft~e~v~  125 (279)
T cd05312         103 AVKPTVLIGLSGVGGAFTEEVVR  125 (279)
T ss_pred             HCCCCEEEEECCCCCCCCHHHHH
T ss_conf             24897799806898977999999


No 255
>PHA02519 plasmid partition protein SopA; Reviewed
Probab=32.33  E-value=34  Score=14.32  Aligned_cols=41  Identities=27%  Similarity=0.272  Sum_probs=27.5

Q ss_pred             CEEEEECCC-CCCCHHHHHHHHHHHHHHHCCCEEEEEC-CCCCC
Q ss_conf             789999878-8880012217999999986898999964-76554
Q gi|254780166|r   27 PTILLIHGL-ASSVQTNWLFSGWIQLLCDQGFRVIAFD-NLGHG   68 (261)
Q Consensus        27 ~~vv~iHG~-~~~~~~~~~~~~~~~~l~~~g~~vi~~D-~~G~G   68 (261)
                      +.||-+--+ ||...+ +.-..++..|+.+||+|+++| +--.|
T Consensus       106 ~~VIAVaN~KGGVGKT-TTavnLA~~LAl~G~RVL~ID~lDPQa  148 (387)
T PHA02519        106 PVVLAVMSHKGGVYKT-SSAVHTAQWLALQGHRVLLIEGNDPQG  148 (387)
T ss_pred             CEEEEEEECCCCCCHH-HHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             5289986168877699-999999999997699689995988520


No 256
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily. This CD includes predicted proteins with rhodanese-like domains found N-terminal of the metallo-beta-lactamase domain.
Probab=31.98  E-value=34  Score=14.29  Aligned_cols=13  Identities=15%  Similarity=0.095  Sum_probs=7.1

Q ss_pred             HCCCEEEEECCCC
Q ss_conf             6898999964765
Q gi|254780166|r   54 DQGFRVIAFDNLG   66 (261)
Q Consensus        54 ~~g~~vi~~D~~G   66 (261)
                      ..|-.++.+|-|-
T Consensus        11 ~~~e~~~llDVR~   23 (100)
T cd01523          11 LAGQPLFILDVRN   23 (100)
T ss_pred             HCCCCCEEEECCC
T ss_conf             7799968998997


No 257
>pfam00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.
Probab=31.48  E-value=35  Score=14.24  Aligned_cols=33  Identities=21%  Similarity=0.162  Sum_probs=16.2

Q ss_pred             CCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             222344344431013332102356523896288563
Q gi|254780166|r  100 VHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL  135 (261)
Q Consensus       100 ~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~  135 (261)
                      +.++|   ||.+++++|.....+=..+.++...+.+
T Consensus         2 v~iiG---gG~ig~E~A~~l~~~G~~Vtiie~~~~~   34 (82)
T pfam00070         2 VVVVG---GGYIGLEFASALAKLGSKVTVVERRDRL   34 (82)
T ss_pred             EEEEC---CCHHHHHHHHHHHHCCCEEEEECCCCCC
T ss_conf             99999---8899999999998639278998125733


No 258
>PRK10416 cell division protein FtsY; Provisional
Probab=31.21  E-value=35  Score=14.21  Aligned_cols=98  Identities=14%  Similarity=0.165  Sum_probs=53.7

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99878999987888800122179999999868989999647655422222222222212222222222222222222223
Q gi|254780166|r   24 KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVM  103 (261)
Q Consensus        24 ~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~~~~~~li  103 (261)
                      ..+|.|||+-|.-|+.... ....++.+|..+|++|+..    -|++-++         .-++|+..|-+..++   -++
T Consensus       292 ~~~P~VIl~vGvNG~GKTT-TigKLA~~~~~~gkkVlla----A~DTfRa---------AAieQL~~w~~r~~v---~vi  354 (499)
T PRK10416        292 GKTPFVILMVGVNGVGKTT-TIGKLARQFEQQGKSVMLA----AGDTFRA---------AAVEQLQVWGQRNNI---PVI  354 (499)
T ss_pred             CCCCEEEEEECCCCCCHHH-HHHHHHHHHHHCCCCEEEE----EECCCCH---------HHHHHHHHHHCCCCC---EEE
T ss_conf             9998799997478787898-9999999999779953788----4066756---------899999998424573---698


Q ss_pred             CCCCCCC---CHHHHHHHCCCCCCCEEEECCCCCCCCC
Q ss_conf             4434443---1013332102356523896288563311
Q gi|254780166|r  104 GYSMGAR---IACSMVLFYPSYVRSVILGGVGSVLYDS  138 (261)
Q Consensus       104 GhS~Gg~---ia~~~a~~~p~~v~~lvl~~~~~~~~~~  138 (261)
                      ++..|+-   |+.........+-.-++++++...+...
T Consensus       355 ~~~~g~Dpa~V~~dai~~a~~~~~DvviiDTAGRl~~~  392 (499)
T PRK10416        355 AQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNK  392 (499)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             36899997999999999999729998998577643260


No 259
>COG4850 Uncharacterized conserved protein [Function unknown]
Probab=31.20  E-value=12  Score=16.94  Aligned_cols=17  Identities=6%  Similarity=0.305  Sum_probs=9.3

Q ss_pred             HHHHCCCCEEEEECCCC
Q ss_conf             99967997999988887
Q gi|254780166|r  221 LMSFIPSSQYLNICRRD  237 (261)
Q Consensus       221 l~~~~p~~~~~~i~~~g  237 (261)
                      +.+..|+.+++++-++|
T Consensus       271 il~~~p~~kfvLVGDsG  287 (373)
T COG4850         271 ILRRYPDRKFVLVGDSG  287 (373)
T ss_pred             HHHHCCCCEEEEECCCC
T ss_conf             99867896399964787


No 260
>pfam05973 Gp49 Phage derived protein Gp49-like (DUF891). This family consists of hypothetical bacterial proteins of unknown function as well as phage Gp49 proteins.
Probab=30.67  E-value=36  Score=14.16  Aligned_cols=21  Identities=29%  Similarity=0.536  Sum_probs=9.4

Q ss_pred             CCCEEEEEEECCCCCCEEEEECCC
Q ss_conf             994999999648998789999878
Q gi|254780166|r   12 RKYQFAFYDVGDKDAPTILLIHGL   35 (261)
Q Consensus        12 dG~~l~y~~~g~~~~~~vv~iHG~   35 (261)
                      +..++.|...+   +..||++|||
T Consensus        52 ~~~Ri~y~~~~---~~~ivll~~f   72 (92)
T pfam05973        52 GGYRVYYAFDG---GRLIILLHGF   72 (92)
T ss_pred             CEEEEEEEEEC---CEEEEEEEEE
T ss_conf             86999999989---9799998518


No 261
>PRK06851 hypothetical protein; Provisional
Probab=30.37  E-value=36  Score=14.12  Aligned_cols=61  Identities=21%  Similarity=0.279  Sum_probs=38.4

Q ss_pred             CCCCEEEEEECCCCEE---EEEEE-CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             9764079993499499---99996-48998789999878888001221799999998689899996
Q gi|254780166|r    1 MMNEVKFFRSWRKYQF---AFYDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF   62 (261)
Q Consensus         1 ~~~~~~~~~~~dG~~l---~y~~~-g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~   62 (261)
                      |+.+++.|-....+.-   +|+.+ -+++..-|+++-|.+++..+ ...+.+...+.++||.|=.+
T Consensus         1 m~g~~~~~F~ggNT~~GF~S~~~~i~~~~~~ri~ilKGGpGtGKS-tlmK~ig~~~~~~GydVE~~   65 (368)
T PRK06851          1 MMGNVKHYFAGGNTARGFYSLYDSILPGDANRIFILKGGPGTGKS-TLMKKIGEEFLEKGYDVEFL   65 (368)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHCCCCCCEEEEEECCCCCCHH-HHHHHHHHHHHHCCCCEEEE
T ss_conf             998536874788777427888875425651279999689997789-99999999999689837999


No 262
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein B; InterPro: IPR004435   The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism , .    In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which coverts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner . MoCF is the active co-factor in eukaryotic and some prokaryotic molybdoenzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdoenzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF . Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 () of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) .   The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process.
Probab=30.24  E-value=37  Score=14.11  Aligned_cols=38  Identities=32%  Similarity=0.477  Sum_probs=29.7

Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
Q ss_conf             998788880012217999999986898999964765542
Q gi|254780166|r   31 LIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK   69 (261)
Q Consensus        31 ~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~   69 (261)
                      =+=|+-.|..+ .....+++.|..+||+|.++=.-|||.
T Consensus         3 ~i~G~k~SGKT-tL~~~l~~~L~~~Gy~V~~IKH~ghG~   40 (165)
T TIGR00176         3 QIVGYKNSGKT-TLIERLVKALKARGYRVATIKHDGHGH   40 (165)
T ss_pred             EEEEECCCCHH-HHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             78962588678-999999999970799508986089888


No 263
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown]
Probab=30.09  E-value=26  Score=14.99  Aligned_cols=77  Identities=22%  Similarity=0.285  Sum_probs=39.0

Q ss_pred             HHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCC--CCCCCCCCCCCCC----HHHHHHH
Q ss_conf             9999986898999964765542222222222221222222222---22222222--2222344344431----0133321
Q gi|254780166|r   48 WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVS---LLEHLGIS--KVHVMGYSMGARI----ACSMVLF  118 (261)
Q Consensus        48 ~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~---~i~~l~~~--~~~liGhS~Gg~i----a~~~a~~  118 (261)
                      .++.|.+.+-.++..|+-|-.+.-+    .-|.+.--++|...   ++.+.++.  +-+.+|.+.|+.-    |..+...
T Consensus       102 ~~eklk~~~vdvvsLDfvgDn~vIk----~vy~l~ksv~dyl~~l~~L~e~~irvvpHitiGL~~gki~~e~kaIdiL~~  177 (275)
T COG1856         102 DLEKLKEELVDVVSLDFVGDNDVIK----RVYKLPKSVEDYLRSLLLLKENGIRVVPHITIGLDFGKIHGEFKAIDILVN  177 (275)
T ss_pred             HHHHHHHHCCCEEEEEECCCHHHHH----HHHCCCCCHHHHHHHHHHHHHCCCEECEEEEEEECCCCCCCHHHHHHHHHC
T ss_conf             8999987168689986127748999----997688637777889999997094253059997316852333878899860


Q ss_pred             CCCCCCCEEEEC
Q ss_conf             023565238962
Q gi|254780166|r  119 YPSYVRSVILGG  130 (261)
Q Consensus       119 ~p~~v~~lvl~~  130 (261)
                      ++  ...|||..
T Consensus       178 ~~--~DalVl~v  187 (275)
T COG1856         178 YE--PDALVLVV  187 (275)
T ss_pred             CC--CCEEEEEE
T ss_conf             79--97399999


No 264
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: IPR006258   These sequences represent dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways. It is the E3 component of dehydrogenase complexes for pyruvate, 2-oxoglutarate, 2-oxoisovalerate, and acetoin. It can also serve as the L protein of the glycine cleavage system. This family includes a few members known to have distinct functions (ferric leghemoglobin reductase and NADH:ferredoxin oxidoreductase) but that may be predicted by homology to act as dihydrolipoamide dehydrogenase as well. The motif GGXCXXXGCXP near the N-terminus contains a redox-active disulphide. ; GO: 0004148 dihydrolipoyl dehydrogenase activity, 0050660 FAD binding, 0006118 electron transport.
Probab=29.82  E-value=37  Score=14.07  Aligned_cols=59  Identities=8%  Similarity=0.164  Sum_probs=43.1

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHH-HHHCCC-CCHHH
Q ss_conf             222223443444310133321023565238962885633110356999999-863111-10000
Q gi|254780166|r   98 SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID-SFLLPS-IDEVQ  159 (261)
Q Consensus        98 ~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~-~~~~~~-~~~~~  159 (261)
                      ++.++||   ||.|+.+||.-+...=..++.+-..+.+.+....+..+.+. .+.... +.-..
T Consensus       179 ~slvIiG---GGVIG~EfA~~f~~lG~~VTv~E~~drILp~~D~evSk~~~~~L~~~GNv~i~~  239 (481)
T TIGR01350       179 ESLVIIG---GGVIGVEFASIFASLGVKVTVIEMLDRILPGEDAEVSKVVKKKLKKKGNVKILT  239 (481)
T ss_pred             CEEEEEC---CCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             5669987---866778899999853980899945750035431689999999997449849854


No 265
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]
Probab=29.73  E-value=35  Score=14.20  Aligned_cols=37  Identities=22%  Similarity=0.205  Sum_probs=22.9

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
Q ss_conf             87899998788880012217999999986898999964765542
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK   69 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~   69 (261)
                      ...+|...|.-.|+-       -+..|.++||.|+.+-+.-+.+
T Consensus         4 ~kV~v~mSGGVDSSV-------aA~lLk~QGyeViGl~m~~~~~   40 (356)
T COG0482           4 KKVLVGMSGGVDSSV-------AAYLLKEQGYEVIGLFMKNWDE   40 (356)
T ss_pred             CEEEEECCCCHHHHH-------HHHHHHHCCCEEEEEEEEEECC
T ss_conf             679999057778999-------9999997697499999996414


No 266
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS.  Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.
Probab=29.61  E-value=37  Score=14.05  Aligned_cols=18  Identities=28%  Similarity=0.674  Sum_probs=11.4

Q ss_pred             HHHHCCCCCEEEEEECCC
Q ss_conf             121003576069984788
Q gi|254780166|r  195 DDLYRIDVPVLIAVGSQD  212 (261)
Q Consensus       195 ~~l~~i~~P~l~i~G~~D  212 (261)
                      +.+..+..|+|+-...+.
T Consensus       192 ~~f~~~~~PiLvG~SRKs  209 (257)
T cd00739         192 DELKQLGLPVLVGASRKS  209 (257)
T ss_pred             HHHHHCCCCEEEECCHHH
T ss_conf             999528998277502989


No 267
>TIGR02683 upstrm_HI1419 probable addiction module killer protein; InterPro: IPR014056   Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family IPR001387 from INTERPRO. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module..
Probab=29.42  E-value=38  Score=14.03  Aligned_cols=28  Identities=29%  Similarity=0.329  Sum_probs=18.3

Q ss_pred             CEEEEEECCCCEEEEEEECCCCCCEEEEECCC
Q ss_conf             40799934994999999648998789999878
Q gi|254780166|r    4 EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGL   35 (261)
Q Consensus         4 ~~~~~~~~dG~~l~y~~~g~~~~~~vv~iHG~   35 (261)
                      ||+-.. --|++++|...|   +..||||-|.
T Consensus        49 ElRId~-GpGYRvYf~~~G---~~~ilLLcGG   76 (95)
T TIGR02683        49 ELRIDY-GPGYRVYFTQRG---KVIILLLCGG   76 (95)
T ss_pred             EEEECC-CCCEEEEEEEEC---CEEEEEECCC
T ss_conf             543226-996468876448---8889985189


No 268
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. This family consist of Cyclopropane-fatty-acyl-phospholipid synthase or CFA synthase EC:2.1.1.79 this enzyme catalyse the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid <= S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
Probab=29.10  E-value=13  Score=16.87  Aligned_cols=43  Identities=21%  Similarity=0.251  Sum_probs=29.9

Q ss_pred             CCCCCCCCCCCCCC---CCCCCCCCCCCCCHHHHHHHCCCCCCCEEE
Q ss_conf             22222222222222---222234434443101333210235652389
Q gi|254780166|r   85 AADAVSLLEHLGIS---KVHVMGYSMGARIACSMVLFYPSYVRSVIL  128 (261)
Q Consensus        85 ~~di~~~i~~l~~~---~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl  128 (261)
                      .+=+..+++.++++   ++.=||..|||. +..+|..++.+|.++++
T Consensus        48 ~~Kl~~i~~~l~l~~g~~vLDiGCGWG~~-a~~~a~~~g~~v~giTl   93 (273)
T pfam02353        48 QAKLDLILDKLGLKPGMTLLDIGCGWGGL-MRRAAERYDVNVVGLTL   93 (273)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCHHH-HHHHHHHCCCEEEEEEC
T ss_conf             99999999865889999899978880899-99999847951899979


No 269
>pfam08237 PE-PPE PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.
Probab=28.75  E-value=16  Score=16.17  Aligned_cols=22  Identities=36%  Similarity=0.300  Sum_probs=18.2

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             2222223443444310133321
Q gi|254780166|r   97 ISKVHVMGYSMGARIACSMVLF  118 (261)
Q Consensus        97 ~~~~~liGhS~Gg~ia~~~a~~  118 (261)
                      -++++++|+|.|+.|+.....+
T Consensus        46 g~~v~V~GySQgA~Vas~~~~~   67 (227)
T pfam08237        46 GEPVVVFGYSQGALVAALEKAR   67 (227)
T ss_pred             CCCEEEEEECCHHHHHHHHHHH
T ss_conf             9957999957428999999999


No 270
>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate. This domain contains an ATP binding P-loop motif .; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity transferring phosphorus-containing groups, 0000103 sulfate assimilation.
Probab=28.50  E-value=39  Score=13.93  Aligned_cols=61  Identities=20%  Similarity=0.279  Sum_probs=39.6

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCC--CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89987899998788880012217999999986898999964765--5422222222222212222222
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG--HGKSDKSYIENDYRLVFMAADA   88 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G--~G~S~~~~~~~~~s~~~~~~di   88 (261)
                      ++..-.||.+-|..|+..+ +.=..+.+.|.+.||+++..|=-+  ||..    .+-.||-+|--+-+
T Consensus        15 ~~h~g~vlWlTGLSGsGKs-TiA~Al~~~L~~~G~~~~~LDGDnvR~gL~----~dLGFS~~DR~eNI   77 (187)
T TIGR00455        15 NKHRGVVLWLTGLSGSGKS-TIANALEKKLEKKGYRVYVLDGDNVRHGLN----KDLGFSEEDRKENI   77 (187)
T ss_pred             CCCCEEEEEEECCCCCHHH-HHHHHHHHHHHHCCCEEEEECCCEEECCCC----CCCCCCHHHHCCCC
T ss_conf             2797389851168856357-999999999996697499975863424778----88888856705688


No 271
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily. Unlike other rhodanese sulfurtransferases, GlpE is a single domain protein but indications are that it functions as a dimer. The active site contains a catalytically active cysteine.
Probab=27.69  E-value=41  Score=13.84  Aligned_cols=17  Identities=18%  Similarity=0.073  Sum_probs=9.9

Q ss_pred             HHHHHCCCEEEEECCCC
Q ss_conf             99986898999964765
Q gi|254780166|r   50 QLLCDQGFRVIAFDNLG   66 (261)
Q Consensus        50 ~~l~~~g~~vi~~D~~G   66 (261)
                      ..+.+.+-.++.+|.|-
T Consensus         8 ~~~l~~~~~~~liDVR~   24 (96)
T cd01444           8 AELLAAGEAPVLLDVRD   24 (96)
T ss_pred             HHHHHCCCCCEEEECCC
T ss_conf             99984899968998988


No 272
>cd01998 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The  archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.
Probab=27.64  E-value=31  Score=14.54  Aligned_cols=20  Identities=30%  Similarity=0.345  Sum_probs=14.8

Q ss_pred             HHHHHHCCCEEEEECCCCCC
Q ss_conf             99998689899996476554
Q gi|254780166|r   49 IQLLCDQGFRVIAFDNLGHG   68 (261)
Q Consensus        49 ~~~l~~~g~~vi~~D~~G~G   68 (261)
                      +..|.++||.|+..-++-+.
T Consensus        16 A~LL~~~G~~V~gv~m~~w~   35 (349)
T cd01998          16 AALLKEQGYEVIGVFMKNWD   35 (349)
T ss_pred             HHHHHHCCCCEEEEEEECCC
T ss_conf             99998779957999999678


No 273
>KOG1264 consensus
Probab=27.51  E-value=41  Score=13.82  Aligned_cols=13  Identities=23%  Similarity=0.125  Sum_probs=5.5

Q ss_pred             CCCCCCHHHHHHH
Q ss_conf             3444310133321
Q gi|254780166|r  106 SMGARIACSMVLF  118 (261)
Q Consensus       106 S~Gg~ia~~~a~~  118 (261)
                      .+||.+-..+-+.
T Consensus       813 dYGg~iq~wfPsn  825 (1267)
T KOG1264         813 DYGGRIQQWFPSN  825 (1267)
T ss_pred             CCCCCEEEECCHH
T ss_conf             5664111236477


No 274
>TIGR02884 spore_pdaA delta-lactam-biosynthetic de-N-acetylase; InterPro: IPR014235    Muramic delta-lactam is an unusual constituent of peptidoglycan, found only in bacterial spores, in the peptidoglycan wall or spore cortex. This entry represents a subset of the larger polysaccharide deacetylase family that is specifically involved in delta-lactam biosynthesis. PdaA from Bacillus subtilis acts immediately after CwlD, an N-acetylmuramoyl-L-alanine amidase and performs a de-N-acetylation. PdaA may also perform the subsequent transpeptidation that leads to lactam ring formation, as heterologous expression in Escherichia coli of CwlD and PdaA together is sufficient for delta-lactam production..
Probab=27.49  E-value=36  Score=14.12  Aligned_cols=66  Identities=11%  Similarity=0.163  Sum_probs=38.9

Q ss_pred             HHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCC
Q ss_conf             999998689899996476554222222222222---12222222222222222222223443444310133321023565
Q gi|254780166|r   48 WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR---LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR  124 (261)
Q Consensus        48 ~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s---~~~~~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~  124 (261)
                      ....|.++ |.++-+     |+|....---.|+   -.-+...|++||.+-++.-+.+        |.-.|.-..||+|+
T Consensus        18 ~~~~l~~K-y~~~y~-----GDt~~K~iYLTFDnGYEnGYT~kILDVLKe~~V~AaFF--------VTghY~K~~pdLvK   83 (225)
T TIGR02884        18 EYTELLKK-YNAYYL-----GDTSKKVIYLTFDNGYENGYTPKILDVLKENKVPAAFF--------VTGHYIKTQPDLVK   83 (225)
T ss_pred             HHHHHHHH-CCEEEE-----ECCCCEEEEEECCCCCCCCCCHHHHHHHHCCCCCEEEE--------EECCCCCCCHHHHH
T ss_conf             25888852-674886-----33872048851435533577033423320378831146--------40773147667666


Q ss_pred             CEE
Q ss_conf             238
Q gi|254780166|r  125 SVI  127 (261)
Q Consensus       125 ~lv  127 (261)
                      +++
T Consensus        84 RM~   86 (225)
T TIGR02884        84 RMV   86 (225)
T ss_pred             HHH
T ss_conf             555


No 275
>pfam01583 APS_kinase Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Probab=26.75  E-value=42  Score=13.74  Aligned_cols=39  Identities=21%  Similarity=0.222  Sum_probs=29.2

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             8789999878888001221799999998689899996476
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      ++.||++-|..++..+ +.-..+...|.++++.++.+|--
T Consensus         1 kG~viW~TGLsGsGKT-TlA~~l~~~L~~~~~~~~~LDGD   39 (157)
T pfam01583         1 RGCTVWFTGLSGSGKS-TIANALERKLFAQGISVYVLDGD   39 (157)
T ss_pred             CCEEEEEECCCCCCHH-HHHHHHHHHHHHCCCCEEEECCH
T ss_conf             9889998898999999-99999999999759977997688


No 276
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886    Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=25.37  E-value=45  Score=13.59  Aligned_cols=102  Identities=20%  Similarity=0.291  Sum_probs=54.8

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCC-------C---CCCCCCCCCCCCCC----CC
Q ss_conf             9998788880012217999999986898999964765542222222222-------2---21222222222222----22
Q gi|254780166|r   30 LLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND-------Y---RLVFMAADAVSLLE----HL   95 (261)
Q Consensus        30 v~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~-------~---s~~~~~~di~~~i~----~l   95 (261)
                      ||+-|..|     +.-......|.++||.|+.+|-.--|..+.-..-+.       +   ++.| .+-|.++++    +.
T Consensus         2 iLVTGGAG-----YIGSHt~~~Ll~~G~ev~vlDNLs~G~~~~l~~~~~~~G~~~~fv~gDL~D-~~~l~~~f~kqql~~   75 (341)
T TIGR01179         2 ILVTGGAG-----YIGSHTVRQLLESGYEVVVLDNLSNGSAEALKRGEEITGKEVTFVEGDLRD-RELLRRVFEKQQLEH   75 (341)
T ss_pred             EEEEECCC-----CCHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCEECCCCCEEEEECCHH-HHHHHHHHHHHHHCC
T ss_conf             26861466-----443588788763597289981578884887500234148532058717515-799999987743116


Q ss_pred             CCCC-CCC-----CCCCCC------------CCCHHHHHHHCCCCCCCEEEECCCCCCCCCC
Q ss_conf             2222-222-----344344------------4310133321023565238962885633110
Q gi|254780166|r   96 GISK-VHV-----MGYSMG------------ARIACSMVLFYPSYVRSVILGGVGSVLYDSD  139 (261)
Q Consensus        96 ~~~~-~~l-----iGhS~G------------g~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~  139 (261)
                      +++- +|+     ||-|+-            ....++...+  -.|+++|+.+++.....+.
T Consensus        76 ~idAViHFAg~~~VgESv~~Pl~YY~NNv~nTl~L~~~m~~--~GV~~~iFSSsAaVYG~p~  135 (341)
T TIGR01179        76 KIDAVIHFAGLIAVGESVQKPLKYYRNNVVNTLNLLEAMQE--TGVKKFIFSSSAAVYGEPE  135 (341)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCEEECCCCEEECCCC
T ss_conf             75467520112125255752454400046899999999998--1897415304214507788


No 277
>PRK13705 plasmid-partitioning protein SopA; Provisional
Probab=25.34  E-value=45  Score=13.59  Aligned_cols=43  Identities=21%  Similarity=0.257  Sum_probs=29.1

Q ss_pred             CCCEEEEECCC-CCCCHHHHHHHHHHHHHHHCCCEEEEEC-CCCCC
Q ss_conf             98789999878-8880012217999999986898999964-76554
Q gi|254780166|r   25 DAPTILLIHGL-ASSVQTNWLFSGWIQLLCDQGFRVIAFD-NLGHG   68 (261)
Q Consensus        25 ~~~~vv~iHG~-~~~~~~~~~~~~~~~~l~~~g~~vi~~D-~~G~G   68 (261)
                      ..+.||-+--+ ||...+ +.-..++..|+.+||+|+++| +--.|
T Consensus       104 ~~~~VIAVaNqKGGvGKT-TTavnLA~~LAl~G~RVLlID~LDPQa  148 (388)
T PRK13705        104 EFPPVIGVAAHKGGVYKT-SVSVHLAQDLALKGLRVLLVEGNDPQG  148 (388)
T ss_pred             CCCEEEEEECCCCCCCHH-HHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             987289995278885599-999999999997799089995878886


No 278
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]
Probab=25.27  E-value=17  Score=16.12  Aligned_cols=42  Identities=29%  Similarity=0.281  Sum_probs=29.0

Q ss_pred             CCCCCCCCCCCCC---CCCCCCCCCCCCCHHHHHHHCCCCCCCEEE
Q ss_conf             2222222222222---222234434443101333210235652389
Q gi|254780166|r   86 ADAVSLLEHLGIS---KVHVMGYSMGARIACSMVLFYPSYVRSVIL  128 (261)
Q Consensus        86 ~di~~~i~~l~~~---~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl  128 (261)
                      .-+..+++.++++   ++.=+|..||++ +..+|.+|..+|-++++
T Consensus        59 ~k~~~~~~kl~L~~G~~lLDiGCGWG~l-~~~aA~~y~v~V~GvTl  103 (283)
T COG2230          59 AKLDLILEKLGLKPGMTLLDIGCGWGGL-AIYAAEEYGVTVVGVTL  103 (283)
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCHHHH-HHHHHHHCCCEEEEEEC
T ss_conf             9999999756999999898747884499-99999984997999668


No 279
>cd07210 Pat_hypo_W_succinogenes_WS1459_like Hypothetical patatin similar to WS1459 of Wolinella succinogenes. Patatin-like phospholipase. This family predominantly consists of bacterial patatin glycoproteins. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.
Probab=25.01  E-value=12  Score=16.91  Aligned_cols=29  Identities=21%  Similarity=0.212  Sum_probs=20.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             22222222222234434443101333210
Q gi|254780166|r   91 LLEHLGISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        91 ~i~~l~~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      .+++.+++.-.+.|-|.|+.++..+|.-+
T Consensus        21 aL~e~gi~~d~i~GtSaGAi~ga~~a~G~   49 (221)
T cd07210          21 ALLEMGLEPSAISGTSAGALVGGLFASGI   49 (221)
T ss_pred             HHHHCCCCCCEEEEECHHHHHHHHHHCCC
T ss_conf             99977999888999889999999998599


No 280
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  This family includes the cell division ABC transporter and the periplasmic substrate-binding protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In Escherichia coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.; GO: 0005525 GTP binding.
Probab=24.83  E-value=46  Score=13.53  Aligned_cols=111  Identities=16%  Similarity=0.203  Sum_probs=70.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             8998789999878888001221799999998689899996476554222222222222122-222222222222222222
Q gi|254780166|r   23 DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF-MAADAVSLLEHLGISKVH  101 (261)
Q Consensus        23 ~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~-~~~di~~~i~~l~~~~~~  101 (261)
                      ..++|.|+|+=|.-|...+. ....++..|.++|++|+.-        ++   +   |++. -++|+..+.+.++++   
T Consensus        78 ~~~kp~Vil~VGVNG~GKTT-TIaKLA~~l~~~Gk~V~la--------Ag---D---TFRAAA~EQL~~Wa~R~gv~---  139 (284)
T TIGR00064        78 EEKKPNVILFVGVNGVGKTT-TIAKLANKLKKQGKSVLLA--------AG---D---TFRAAAIEQLEVWAKRLGVD---  139 (284)
T ss_pred             CCCCCEEEEEEEEECCCHHH-HHHHHHHHHHHCCCEEEEE--------CC---C---HHHHHHHHHHHHHHHHHCCE---
T ss_conf             47897799998440886010-2889999998749908998--------27---5---24799999999989883875---


Q ss_pred             CCCCCCC-CC---CHHHHHHHCCCCCCCEEEECCCCCCCCC-CHHHHHHHHHHHH
Q ss_conf             2344344-43---1013332102356523896288563311-0356999999863
Q gi|254780166|r  102 VMGYSMG-AR---IACSMVLFYPSYVRSVILGGVGSVLYDS-DVVDWQSLIDSFL  151 (261)
Q Consensus       102 liGhS~G-g~---ia~~~a~~~p~~v~~lvl~~~~~~~~~~-~~~~~~~~~~~~~  151 (261)
                      +|-|.-| +=   |+.........+=-=+|||+++..+... ..++-.+.+.+..
T Consensus       140 vi~~~~gn~DPAaV~fDAi~~Ak~~niDvvliDTAGRLqnk~NLm~EL~KI~RV~  194 (284)
T TIGR00064       140 VIKQKEGNADPAAVIFDAIQAAKARNIDVVLIDTAGRLQNKVNLMDELKKIKRVI  194 (284)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             5407889887178999989999874997899734754546620399999999987


No 281
>KOG2872 consensus
Probab=24.42  E-value=47  Score=13.48  Aligned_cols=51  Identities=20%  Similarity=0.166  Sum_probs=27.3

Q ss_pred             HCCCCCEEEEEECCCCC--CCCH-------HHHHHHCCCCEEEEECCCCCCCCCC-CHHHHHH
Q ss_conf             00357606998478887--8807-------9999967997999988887384348-4899999
Q gi|254780166|r  198 YRIDVPVLIAVGSQDDL--AGSP-------QELMSFIPSSQYLNICRRDHLLAVG-DKQFKQG  250 (261)
Q Consensus       198 ~~i~~P~l~i~G~~D~~--~~~~-------~~l~~~~p~~~~~~i~~~gH~~~~e-~p~~~~~  250 (261)
                      .++.-+...+.|.-|+-  ..+.       +++.+.....++  |-|-||-+... +|+....
T Consensus       288 r~~~g~~VtlQGNlDP~~ly~s~e~it~~v~~mv~~fG~~ry--I~NLGHGi~p~tp~e~v~~  348 (359)
T KOG2872         288 RRRVGNRVTLQGNLDPGVLYGSKEEITQLVKQMVKDFGKSRY--IANLGHGITPGTPPEHVAH  348 (359)
T ss_pred             HHHHCCCEEEECCCCHHHHCCCHHHHHHHHHHHHHHHCCCCE--EEECCCCCCCCCCHHHHHH
T ss_conf             875178347756778476508989999999999998386663--7624787789979799999


No 282
>PRK10037 cell division protein; Provisional
Probab=24.29  E-value=47  Score=13.47  Aligned_cols=38  Identities=24%  Similarity=0.221  Sum_probs=26.9

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             89999878888001221799999998689899996476
Q gi|254780166|r   28 TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        28 ~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      ++|.+.|.-|.....+.-..++..|+..|.+|+++|+.
T Consensus         2 ~iial~s~kGGVGkTTltAnLA~aL~~~g~~VlaID~d   39 (250)
T PRK10037          2 AILGLQGVRGGVGTTSITAALAWSLQMLGENVLVIDAC   39 (250)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             37999607888768999999999999779918999578


No 283
>TIGR01007 eps_fam capsular exopolysaccharide family; InterPro: IPR005702    This family describes the capsular exopolysaccharide proteins in bacteria. The exopolysaccharide gene cluster consists of several genes which encode a number of proteins which regulate the exoploysaccharide biosynthesis (EPS). At least 13 genes EpsA to EpsM in streptococcus species seem to direct the EPS proteins and share high homology. ; GO: 0030234 enzyme regulator activity, 0045227 capsule polysaccharide biosynthetic process.
Probab=24.22  E-value=47  Score=13.46  Aligned_cols=115  Identities=10%  Similarity=0.100  Sum_probs=57.6

Q ss_pred             CCCCEEEEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             49949999996489987899998788880012217999999986898999964765542222222222221222222222
Q gi|254780166|r   11 WRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVS   90 (261)
Q Consensus        11 ~dG~~l~y~~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~   90 (261)
                      +++.|....-++.+++-.+++|----....-.+.-..++-.||.+||+++.+|=    +..+|  -..+.+..       
T Consensus         3 yn~iRtNI~fS~a~~e~K~l~itS~~~~eGKsT~S~NiA~~fAqaGyKTLlIDg----D~R~s--v~~~~Fk~-------   69 (207)
T TIGR01007         3 YNAIRTNIQFSGAEQEIKVLLITSVKAGEGKSTTSANIAVSFAQAGYKTLLIDG----DMRNS--VMSGTFKS-------   69 (207)
T ss_pred             CCHHCCCHHHCCCCCCEEEEEEEECCCCCCCEEEEHHHHHHHHHCCCEEEEEEC----CCCCC--CEEEEECC-------
T ss_conf             230002022103578705899841105888624107889999856855888754----65866--03678658-------


Q ss_pred             CCC-CCCCCCCCCCCCCCCCCCHHHHHHHCCCCC-CCEEEECCCCCCCCCCHHHHHHH
Q ss_conf             222-222222222344344431013332102356-52389628856331103569999
Q gi|254780166|r   91 LLE-HLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILGGVGSVLYDSDVVDWQSL  146 (261)
Q Consensus        91 ~i~-~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v-~~lvl~~~~~~~~~~~~~~~~~~  146 (261)
                       -+ .-|+..+ |+|.+   -+.-   ....-+| ..|.++.+++....|........
T Consensus        70 -~n~~~GLtn~-L~g~~---dl~~---~i~~T~isenL~vi~sG~vPPNPt~LL~s~~  119 (207)
T TIGR01007        70 -QNKIKGLTNF-LSGNT---DLSD---AICETNISENLDVITSGPVPPNPTELLQSSN  119 (207)
T ss_pred             -CCCCCCCHHH-HCCCC---CHHH---HHHCCCCCCCCEEECCCCCCCCHHHHHHHHH
T ss_conf             -8876563332-21454---5333---4202654678727517887877547888899


No 284
>PRK07854 enoyl-CoA hydratase; Provisional
Probab=24.09  E-value=47  Score=13.44  Aligned_cols=74  Identities=16%  Similarity=0.165  Sum_probs=36.0

Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-CCC--CCCCCCCCCCHHHHHHHC
Q ss_conf             99999998689899996476554222222222222122222222222222-222-222--234434443101333210
Q gi|254780166|r   46 SGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHL-GIS-KVH--VMGYSMGARIACSMVLFY  119 (261)
Q Consensus        46 ~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l-~~~-~~~--liGhS~Gg~ia~~~a~~~  119 (261)
                      ...+..+.+.+.+|+.+.=-|-..|.+..-...-...++.+.+..++..+ ... +++  +=|+.+||.+.+.++...
T Consensus        33 ~~al~~~~d~~vr~vVltg~G~~FcaG~Dl~~~~~~~~~~~~~~~~~~~i~~~~kPvIAav~G~a~GgG~~lal~cD~  110 (243)
T PRK07854         33 REAVRKAGDAGARAIVLTGQGTVFCAGADLSGDVYADDFPDALIELLHAIDAAPVPVIAAINGPAIGAGLQLALACDL  110 (243)
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCEECCCHHHHHHCCCE
T ss_conf             999997238995599997889816689986552116677899999999998589988999758323351578860999


No 285
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional
Probab=24.01  E-value=47  Score=13.43  Aligned_cols=51  Identities=12%  Similarity=0.093  Sum_probs=29.6

Q ss_pred             HCCCCCEEEEEECCCCC-CCCHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             00357606998478887-88079999967997999988887384348489999999998
Q gi|254780166|r  198 YRIDVPVLIAVGSQDDL-AGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFY  255 (261)
Q Consensus       198 ~~i~~P~l~i~G~~D~~-~~~~~~l~~~~p~~~~~~i~~~gH~~~~e~p~~~~~i~~Fl  255 (261)
                      ..+.+|++.+.|--|+- ..+-      -.+...+.= ..+++--+...++.+++.+-|
T Consensus       269 aAlg~P~v~LFGpT~P~~~gP~------g~~~~~~~~-~~~~~~~~~~~~v~~~~~~~~  320 (322)
T PRK10964        269 AALDRPNITLYGPTDPGLIGGY------GKNQHACRS-EGKSMANLSAETVFQKLETLI  320 (322)
T ss_pred             HHCCCCEEEEECCCCCCCCCCC------CCCCEEEEC-CCCCCCCCCHHHHHHHHHHHH
T ss_conf             9839998999888994030788------888248968-998702199999999999974


No 286
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed
Probab=23.86  E-value=48  Score=13.42  Aligned_cols=32  Identities=6%  Similarity=0.075  Sum_probs=18.9

Q ss_pred             EEEEECCCCEEEEEEECCCC--CCEEEEECCCCC
Q ss_conf             79993499499999964899--878999987888
Q gi|254780166|r    6 KFFRSWRKYQFAFYDVGDKD--APTILLIHGLAS   37 (261)
Q Consensus         6 ~~~~~~dG~~l~y~~~g~~~--~~~vv~iHG~~~   37 (261)
                      -+....||..+.=..+|...  .-=|||-.|..|
T Consensus         5 a~LiLedGt~f~G~~fG~~~~~~GEvVFnT~MtG   38 (355)
T PRK12564          5 AYLVLEDGTVFEGKAFGAEGETVGEVVFNTSMTG   38 (355)
T ss_pred             EEEEECCCCEEEEEEECCCCCEEEEEEEECCCCC
T ss_conf             7999569999988980777657889999799876


No 287
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 3rd repeat which does not contain the putative catalytic Cys residue.
Probab=22.85  E-value=50  Score=13.30  Aligned_cols=20  Identities=20%  Similarity=0.162  Sum_probs=11.4

Q ss_pred             HHHHHCC-CEEEEECCCCCCC
Q ss_conf             9998689-8999964765542
Q gi|254780166|r   50 QLLCDQG-FRVIAFDNLGHGK   69 (261)
Q Consensus        50 ~~l~~~g-~~vi~~D~~G~G~   69 (261)
                      +.+..++ ..++.+|.|--++
T Consensus         7 ~~w~~~~~r~~~llDVR~~~E   27 (95)
T cd01534           7 ARWAAEGDRTVYRFDVRTPEE   27 (95)
T ss_pred             HHHHHCCCCCEEEEECCCHHH
T ss_conf             999868997379997998899


No 288
>PRK13753 dihydropteroate synthase; Provisional
Probab=22.74  E-value=50  Score=13.29  Aligned_cols=14  Identities=21%  Similarity=0.650  Sum_probs=9.2

Q ss_pred             CCCCCEEEEEECCC
Q ss_conf             03576069984788
Q gi|254780166|r  199 RIDVPVLIAVGSQD  212 (261)
Q Consensus       199 ~i~~P~l~i~G~~D  212 (261)
                      .+..|+|+-...+.
T Consensus       200 ~lg~PiLvG~SRKs  213 (279)
T PRK13753        200 ALGLPLLVSVSRKS  213 (279)
T ss_pred             CCCCCEEEEECHHH
T ss_conf             07993899935668


No 289
>pfam08433 KTI12 Chromatin associated protein KTI12. This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II. The Elongator complex has histone acetyltransferase activity.
Probab=22.50  E-value=51  Score=13.26  Aligned_cols=36  Identities=22%  Similarity=0.429  Sum_probs=26.4

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             9999878888001221799999998689899996476
Q gi|254780166|r   29 ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL   65 (261)
Q Consensus        29 vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~   65 (261)
                      +|.+.|++++..+. .-..+...|.++++.|+.++--
T Consensus         1 Livl~G~P~SGKSt-~A~~L~~~l~~~~~~v~vi~d~   36 (266)
T pfam08433         1 LIILTGLPSSGKST-RAKELAKYLEEKGYDVIVISDE   36 (266)
T ss_pred             CEEEECCCCCCHHH-HHHHHHHHHHHCCCEEEEECCC
T ss_conf             97985799996889-9999999999759938997800


No 290
>cd07207 Pat_ExoU_VipD_like ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2. ExoU, a 74-kDa enzyme, is a potent virulence factor of Pseudomonas aeruginosa. One of the pathogenic mechanisms of P. aeruginosa is to induce cytotoxicity by the injection of effector proteins (e.g. ExoU) using the type III secretion (T3S) system. ExoU is homologus to patatin and also has the conserved catalytic residues of mammalian calcium-independent (iPLA2) and cytosolic (cPLA2) PLA2. In vitro, ExoU cytotoxity is blocked by the inhibitor of cytosolic and Ca2-independent phospholipase A2 (cPLA2 and iPLA2) enzymes, suggesting that phospholipase A2 inhibitors may represent a novel mode of treatment for acute P. aeruginosa infections. ExoU requires eukaryotic superoxide dismutase as a cofactor and cleaves phosphatidylcholine and phosphatidylethanolamine in vitro. VipD, a 69-kDa cytosolic protein, belongs to the members of Legionella pneumophila family and is homologus to ExoU from Pseudomona
Probab=22.30  E-value=15  Score=16.39  Aligned_cols=25  Identities=44%  Similarity=0.462  Sum_probs=17.9

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             2222222234434443101333210
Q gi|254780166|r   95 LGISKVHVMGYSMGARIACSMVLFY  119 (261)
Q Consensus        95 l~~~~~~liGhS~Gg~ia~~~a~~~  119 (261)
                      .++..-.+.|-|.|+.++..+|..+
T Consensus        24 ~g~~~~~i~GtSaGAi~a~~la~g~   48 (194)
T cd07207          24 AGILKKRVAGTSAGAITAALLALGY   48 (194)
T ss_pred             CCCCCCEEEEECHHHHHHHHHHCCC
T ss_conf             7999667988779999999998299


No 291
>PRK13700 conjugal transfer protein TraD; Provisional
Probab=21.93  E-value=52  Score=13.19  Aligned_cols=40  Identities=15%  Similarity=0.267  Sum_probs=31.4

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             87899998788880012217999999986898999964765
Q gi|254780166|r   26 APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG   66 (261)
Q Consensus        26 ~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G   66 (261)
                      ..-=+++||..|+..+. ....+++....+|-+.|.||.-|
T Consensus       184 E~qH~li~GTtGtGKS~-~ir~LL~qIR~RGdrAIIyD~~G  223 (732)
T PRK13700        184 EIQNFCLHGTVGAGKSE-VIRRLANYARQRGDMVVIYDRSG  223 (732)
T ss_pred             HHHEEEEECCCCCCHHH-HHHHHHHHHHHCCCCEEEECCCC
T ss_conf             03126774688888999-99999999997299589993998


No 292
>pfam03054 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs.
Probab=21.88  E-value=42  Score=13.75  Aligned_cols=20  Identities=30%  Similarity=0.320  Sum_probs=14.7

Q ss_pred             HHHHHHCCCEEEEECCCCCC
Q ss_conf             99998689899996476554
Q gi|254780166|r   49 IQLLCDQGFRVIAFDNLGHG   68 (261)
Q Consensus        49 ~~~l~~~g~~vi~~D~~G~G   68 (261)
                      +..|.++||.|+.+-++-+.
T Consensus        17 A~LL~~~Gy~V~Gv~m~~w~   36 (354)
T pfam03054        17 AYLLKEQGYEVIGVFMKNWD   36 (354)
T ss_pred             HHHHHHCCCCEEEEEEECCC
T ss_conf             99999779963999999566


No 293
>PRK00162 glpE thiosulfate sulfurtransferase; Validated
Probab=21.25  E-value=54  Score=13.10  Aligned_cols=18  Identities=11%  Similarity=0.106  Sum_probs=10.8

Q ss_pred             HHHHHHCCCEEEEECCCCC
Q ss_conf             9999868989999647655
Q gi|254780166|r   49 IQLLCDQGFRVIAFDNLGH   67 (261)
Q Consensus        49 ~~~l~~~g~~vi~~D~~G~   67 (261)
                      +..+.+++ .++.+|.|.-
T Consensus        12 ~~~~~~~~-~~~liDVR~~   29 (104)
T PRK00162         12 AHQKLQEG-EAVLVDIRDP   29 (104)
T ss_pred             HHHHHHCC-CEEEEECCCH
T ss_conf             99999789-9399989988


No 294
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ. Members of this family are the YhjQ protein, found immediately upsteam of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae. In several species it is seen clearly as part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm (PMID:16930487), based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined.
Probab=21.08  E-value=54  Score=13.08  Aligned_cols=42  Identities=19%  Similarity=0.028  Sum_probs=30.2

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC
Q ss_conf             8999987888800122179999999868989999647655422
Q gi|254780166|r   28 TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS   70 (261)
Q Consensus        28 ~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S   70 (261)
                      +|.+.++=||...+. .-.+++..|+++|++|+.+|+-..|..
T Consensus         3 iIav~n~KGGVGKTT-~avNLA~~La~~G~rVLlIDlDpQ~~l   44 (246)
T TIGR03371         3 VIAIVGIKGGVGRTT-LTAALASALKLLGEPVLAIDLDPQNLL   44 (246)
T ss_pred             EEEEECCCCCCCHHH-HHHHHHHHHHHCCCCEEEEECCCCCCH
T ss_conf             999975999854999-999999999968997899975999850


No 295
>KOG1532 consensus
Probab=21.00  E-value=55  Score=13.07  Aligned_cols=44  Identities=20%  Similarity=0.255  Sum_probs=27.2

Q ss_pred             EECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             964899878999987888800122179999999868989999647
Q gi|254780166|r   20 DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN   64 (261)
Q Consensus        20 ~~g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~   64 (261)
                      ..|....|+++++-|..||.... ....+..++..+.-+-+.+++
T Consensus        12 a~~~~~~p~~ilVvGMAGSGKTT-F~QrL~~hl~~~~~ppYviNL   55 (366)
T KOG1532          12 ASGAIQRPVIILVVGMAGSGKTT-FMQRLNSHLHAKKTPPYVINL   55 (366)
T ss_pred             CCCCCCCCCEEEEEECCCCCCHH-HHHHHHHHHHHCCCCCEEEEC
T ss_conf             25555687079999447788413-999999998623699808867


No 296
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.
Probab=20.44  E-value=56  Score=13.00  Aligned_cols=54  Identities=11%  Similarity=0.151  Sum_probs=30.9

Q ss_pred             EECCCCEEEEEEECCCCCCEEE-EECCCCCC--CHHHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             9349949999996489987899-99878888--0012217999999986898999964
Q gi|254780166|r    9 RSWRKYQFAFYDVGDKDAPTIL-LIHGLASS--VQTNWLFSGWIQLLCDQGFRVIAFD   63 (261)
Q Consensus         9 ~~~dG~~l~y~~~g~~~~~~vv-~iHG~~~~--~~~~~~~~~~~~~l~~~g~~vi~~D   63 (261)
                      .+.+|..+.....-. ++|+|| |..|+.+.  ......+....+.+.+.|..++++-
T Consensus         8 ~~~~G~~v~l~~~~~-~~~vvl~F~R~~~Cp~C~~~l~~l~~~~~~~~~~gv~vvaIs   64 (149)
T cd02970           8 PDAGGETVTLSALLG-EGPVVVVFYRGFGCPFCREYLRALSKLLPELDALGVELVAVG   64 (149)
T ss_pred             ECCCCCEEECHHHCC-CCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             789989897679809-997999997789994214719899988999987696599992


No 297
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.
Probab=20.10  E-value=57  Score=12.96  Aligned_cols=42  Identities=24%  Similarity=0.295  Sum_probs=33.0

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC
Q ss_conf             8999987888800122179999999868989999647655422
Q gi|254780166|r   28 TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS   70 (261)
Q Consensus        28 ~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S   70 (261)
                      .++-+-|+-+|..+ +....+++.|.++||+|-++=.-+|+..
T Consensus         2 kii~ivG~snSGKT-TLi~kli~~l~~~G~~V~~iKH~~H~f~   43 (159)
T cd03116           2 KVIGFVGYSGSGKT-TLLEKLIPALSARGLRVAVIKHDHHDFD   43 (159)
T ss_pred             EEEEEEECCCCCHH-HHHHHHHHHHHHCCCEEEEEEECCCCCC
T ss_conf             29999967999999-9999999999977985989973476777


No 298
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase; InterPro: IPR011848    In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis. These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This entry describes proteins from the genera Streptococcus and Enterococcus homologous to the C-terminal region of IPR005252 from INTERPRO, corresponding to phosphopantothenate--cysteine ligase activity ..
Probab=20.02  E-value=57  Score=12.94  Aligned_cols=61  Identities=15%  Similarity=-0.007  Sum_probs=40.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC
Q ss_conf             217999999986898999964765542222222222221222222222222222----22222234434
Q gi|254780166|r   43 WLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLG----ISKVHVMGYSM  107 (261)
Q Consensus        43 ~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~~~~di~~~i~~l~----~~~~~liGhS~  107 (261)
                      ...+-+.+.|...||.|-...---   .-+|.+..+.|+.. ++++.+++..|.    -+++-++=|||
T Consensus        27 ~LGK~IaE~fL~~Gh~VtlvTTK~---A~kP~~~~~Lsi~E-ie~~~~L~~~L~~~v~~kq~d~liHsM   91 (253)
T TIGR02114        27 GLGKIIAEKFLAAGHEVTLVTTKR---ALKPEPQLNLSIKE-IETVKDLLTTLKELVAEKQHDILIHSM   91 (253)
T ss_pred             CCHHHHHHHHHHCCCEEEEEECCC---CCCCCCCCCCCEEE-ECCHHHHHHHHHHHCCCCCCCEEEEEE
T ss_conf             721799999986587897875361---21888888862486-427789999988750125543888851


Done!