HHsearch alignment for GI: 254780166 and conserved domain: pfam02230

>pfam02230 Abhydrolase_2 Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.
Probab=99.51  E-value=4.4e-13  Score=96.87  Aligned_cols=179  Identities=16%  Similarity=0.190  Sum_probs=111.0

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCCC------CCC---CCCCC---CC-CC---CCCCCC
Q ss_conf             489987899998788880012217999999986-898999964765------542---22222---22-22---221222
Q gi|254780166|r   22 GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLG------HGK---SDKSY---IE-ND---YRLVFM   84 (261)
Q Consensus        22 g~~~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~-~g~~vi~~D~~G------~G~---S~~~~---~~-~~---~s~~~~   84 (261)
T Consensus         7 ~~p~~~llilLHG~G~n~~~---l~~l~~~~~~~p~~~~i~p~AP~~~~~~~~g~~~~~Wf~~~~~~~~~~~~~~~~~~s   83 (213)
T pfam02230         7 AKPATALVIFLHGLGDDGHG---WAFAAKCMAPLPNTKFIFPHAPERPVTLNGGRRMPAWFDLVGLSPNGSEDEAGIKNS   83 (213)
T ss_pred             CCCCCCEEEEEECCCCCHHH---HHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCHHHHHHH
T ss_conf             99988789999789999778---899898750389988997069986754578976451443546795201179999999


Q ss_pred             CCCCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             2222222222-----22222222344344431013332102356523896288563311035699999986311110000
Q gi|254780166|r   85 AADAVSLLEH-----LGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQ  159 (261)
Q Consensus        85 ~~di~~~i~~-----l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (261)
T Consensus        84 ~~~i~~~i~~~~~~~i~~~ri~l~GFSQGa~~a~~~~l~~~~~~~g~i~lsG~l~~~~----------------------  141 (213)
T pfam02230        84 AELIEELIDAEQKTGIPSSRIILGGFSQGGAVALYTALTLPQPLAGIIALSGALPLPP----------------------  141 (213)
T ss_pred             HHHHHHHHHHHHHHCCCHHHEEEEEECHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC----------------------
T ss_conf             9999999999998199930279999887789999999809401398999748878962----------------------


Q ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCCCCCCCH--HHHHH----HCCCCEEEEE
Q ss_conf             11100000000347665413567776541012200121003576069984788878807--99999----6799799998
Q gi|254780166|r  160 NPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMS----FIPSSQYLNI  233 (261)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~----~~p~~~~~~i  233 (261)
T Consensus       142 -----~----------------------~--~~~~~~~--~~~pi~~~HG~~D~vvp~~~~~~~~~~L~~~g~~v~~~~y  190 (213)
T pfam02230       142 -----K----------------------F--PQHPTAL--ADIPILLIHGTEDPVVPLALGKLAKEYLKTLGNTVEFHEY  190 (213)
T ss_pred             -----H----------------------H--HHHHHHC--CCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             -----1----------------------2--3445542--5997894158999821799999999999977998699997


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             88873843484899999999987516
Q gi|254780166|r  234 CRRDHLLAVGDKQFKQGVVNFYANEL  259 (261)
Q Consensus       234 ~~~gH~~~~e~p~~~~~i~~Fl~~~~  259 (261)
T Consensus       191 ~~~gH~I---~~~ei~~~~~fL~k~L  213 (213)
T pfam02230       191 PGMGHSI---CPQEMQDIKSFLSKHL  213 (213)
T ss_pred             CCCCCCC---CHHHHHHHHHHHHHHC
T ss_conf             9999968---9999999999999659