HHsearch alignment for GI: 254780166 and conserved domain: pfam02273

>pfam02273 Acyl_transf_2 Acyl transferase. This bacterial family of Acyl transferases (or myristoyl-acp-specific thioesterases) catalyse the first step in the bioluminescent fatty acid reductase system.
Probab=98.93  E-value=1.9e-08  Score=69.34  Aligned_cols=218  Identities=21%  Similarity=0.312  Sum_probs=127.3

Q ss_pred             EEEECCCCEEEEEEECCCC-----CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCC-CCCCCCCCCCCCC
Q ss_conf             9993499499999964899-----878999987888800122179999999868989999647655-4222222222222
Q gi|254780166|r    7 FFRSWRKYQFAFYDVGDKD-----APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH-GKSDKSYIENDYR   80 (261)
Q Consensus         7 ~~~~~dG~~l~y~~~g~~~-----~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~-G~S~~~~~~~~~s   80 (261)
T Consensus         6 vi~l~~~r~I~VWet~Pk~~~~~rnnTiliAsGFarRMd---hfAglAeYLs~NGFhViRYDsLhHvGlSSG~i~eFtMs   82 (294)
T pfam02273         6 VIRVNNNREIHVWETPPKENVPKRNNTIVIASGFARRMD---HFAGLAEYLSTNGFHVIRYDSLHHVGLSSGEIDEFTMS   82 (294)
T ss_pred             EEEECCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHH---HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCHHHEEEE
T ss_conf             799369978999735886677654772998036888778---88999999850873899845654468786655251330


Q ss_pred             CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             1222-222222222222222222344344431013332102356523896288563311035699999986311110000
Q gi|254780166|r   81 LVFM-AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQ  159 (261)
Q Consensus        81 ~~~~-~~di~~~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (261)
T Consensus        83 iGk~Sll~VidWLk~rgi~~lGlIAaSLSARIAY~v~~ei--~lsfLiT-AVGVvnL-------R~TLEkal~--~Dyl~  150 (294)
T pfam02273        83 VGKNSLLTVIDWLKTRGINNIGLIASSLSARIAYEVISEI--NLSFLIT-AVGVVNL-------RDTLEKALG--FDYLS  150 (294)
T ss_pred             CCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHC--CHHEEEE-EEEEEEH-------HHHHHHHHC--CCHHC
T ss_conf             1344699999999865973334457767789999987421--3211666-5455537-------999999848--75211


Q ss_pred             HHHHHHHC--CCCCCCCCCCHHHHHH-HH-HHHCCCC-CHHHHHCCCCCEEEEEECCCCCCCCH--HHHHHHC--CCCEE
Q ss_conf             11100000--0003476654135677-76-5410122-00121003576069984788878807--9999967--99799
Q gi|254780166|r  160 NPLGKKFR--KFADLDPGNDLKALAS-CL-SMIRKPF-CQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFI--PSSQY  230 (261)
Q Consensus       160 ~~~~~~~~--~~~~~~~~~~~~~~~~-~~-~~~~~~~-~~~~l~~i~~P~l~i~G~~D~~~~~~--~~l~~~~--p~~~~  230 (261)
T Consensus       151 lpi~~lPedldFEgh~l--gs~vFvtDcf~~~Wdtl~sT~~~~~~l~iPfIAFtAn~DdWV~q~EV~~~l~~i~s~~~kl  228 (294)
T pfam02273       151 LPIDELPEDLDFEGHKL--GSEVFVRDCFENNWDTLDSTINKVANLDIPFIAFTANNDDWVKQHEVYDLLSNIRSDKCKI  228 (294)
T ss_pred             CCHHHCCCCCCCCCCCC--CCEEEEEHHHHCCCCCHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCCEE
T ss_conf             89446965245456545--6406760176648970675898850689857999846963440899999997179875158


Q ss_pred             EEECCCCCCCC
Q ss_conf             99888873843
Q gi|254780166|r  231 LNICRRDHLLA  241 (261)
Q Consensus       231 ~~i~~~gH~~~  241 (261)
T Consensus       229 ysL~GSsHdLg  239 (294)
T pfam02273       229 YSLLGSSHDLG  239 (294)
T ss_pred             EEEECCCCCCC
T ss_conf             88624644321