HHsearch alignment for GI: 254780166 and conserved domain: pfam03403

>pfam03403 PAF-AH_p_II isoform II. Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.
Probab=99.28  E-value=9.3e-11  Score=83.03  Aligned_cols=176  Identities=20%  Similarity=0.258  Sum_probs=101.9

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC--------CCCCC-------------CCCC---
Q ss_conf             98789999878888001221799999998689899996476554222--------22222-------------2222---
Q gi|254780166|r   25 DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD--------KSYIE-------------NDYR---   80 (261)
Q Consensus        25 ~~~~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~--------~~~~~-------------~~~s---   80 (261)
T Consensus        99 ~~PvvIFSHGlgg~R~---~yS~~~eeLAS~GyVV~aidH~d~Sa~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  175 (372)
T pfam03403        99 KYPLIVFSHGLGAFRT---IYSAICIELASHGFVVAAVEHRDRSASATYFFKDKNAAEVEEPSWIYLRDVNAEEEFKIRN  175 (372)
T ss_pred             CCCEEEECCCCCCCHH---HHHHHHHHHHCCCEEEEECCCCCCCCEEEEECCCCCCCCCCCCCEEECCCCCCHHHHHHHH
T ss_conf             8748998899876256---7899999987183299971567886403775477766546654212013556415688888


Q ss_pred             --CCCCCCCCCC--------------------------CCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCC
Q ss_conf             --1222222222--------------------------222222222222344344431013332102356523896288
Q gi|254780166|r   81 --LVFMAADAVS--------------------------LLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG  132 (261)
Q Consensus        81 --~~~~~~di~~--------------------------~i~~l~~~~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~  132 (261)
T Consensus       176 ~qv~~R~~e~~~vl~~l~~l~~g~~~~~~~~~~~~~~~l~g~lD~~~I~~~GHSfGGATa~~~l~~-D~R~~agI~LDgw  254 (372)
T pfam03403       176 EQVGQRAQECSKALSIILQIDLGTPVENVLDSDFDLQQLKGNLDTSKIAVIGHSFGGATVIQSLSE-DTRFRCGIALDAW  254 (372)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHCCCCCCCEEEEEECCCHHHHHHHHHH-CCCCCEEEECCCC
T ss_conf             999999999999999999852588531124665456776054564635798534037999999861-8771379841552


Q ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEECCC
Q ss_conf             56331103569999998631111000011100000000347665413567776541012200121003576069984788
Q gi|254780166|r  133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD  212 (261)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D  212 (261)
T Consensus       255 --m~------------------------------------------------------Pl~~~~~~~~~~P~l~i~se~f  278 (372)
T pfam03403       255 --MY------------------------------------------------------PVGQDQYSQARQPLLFINSEKF  278 (372)
T ss_pred             --CC------------------------------------------------------CCCCCCCCCCCCCEEEEECCCC
T ss_conf             --36------------------------------------------------------5763200036887799834545


Q ss_pred             CCCCCHHHHHHHC---CCCEEEEECCCCCCCCCC-------------------CHH-----HHHHHHHHHHHHCC
Q ss_conf             8788079999967---997999988887384348-------------------489-----99999999875168
Q gi|254780166|r  213 DLAGSPQELMSFI---PSSQYLNICRRDHLLAVG-------------------DKQ-----FKQGVVNFYANELR  260 (261)
Q Consensus       213 ~~~~~~~~l~~~~---p~~~~~~i~~~gH~~~~e-------------------~p~-----~~~~i~~Fl~~~~~  260 (261)
T Consensus       279 ~~~~n~~~~~~~~~~~~~~~~~ti~gs~H~sftD~~~~~p~~~~~~~~~~g~idp~~~~~i~n~~~l~Fl~~hL~  353 (372)
T pfam03403       279 QWNENIFKMKKIYSPDKESKMITLKGSVHQNFSDFPFVTGKIIGKFFKLKGEIDPYEAMDIANRASLAFLQKHLD  353 (372)
T ss_pred             CCCCCHHHHHHHHCCCCCCEEEEECCCCCCCCCCCHHHCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             675568999987347887249997897467866410235187886426776669999999999999999998717