HHsearch alignment for GI: 254780166 and conserved domain: pfam06342

>pfam06342 DUF1057 Alpha/beta hydrolase of unknown function (DUF1057). This family consists of several Caenorhabditis elegans specific proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Probab=99.76  E-value=3.5e-17  Score=121.20  Aligned_cols=238  Identities=14%  Similarity=0.111  Sum_probs=150.3

Q ss_pred             ECCCCEE----EEEEECCCCCC--EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3499499----99996489987--89999878888001221799999998689899996476554222222222222122
Q gi|254780166|r   10 SWRKYQF----AFYDVGDKDAP--TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF   83 (261)
Q Consensus        10 ~~dG~~l----~y~~~g~~~~~--~vv~iHG~~~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~s~~~   83 (261)
T Consensus        13 ~~~~k~v~v~A~y~D~~~~gs~~GTVV~~HGsPGSH~D---FkYi~~~l~~~~iR~IgiN~PGf~~t~~~~-~~~ytn~~   88 (297)
T pfam06342        13 TELGKTVEVQAVYEDSLTSGSPFGTVVAFHGSPGSHND---FKYIRSKFEDLNIRFIGVNYPGFEFTTGYP-GQSHTNQE   88 (297)
T ss_pred             HHCCCEEEEEEEEEECCCCCCCCEEEEEECCCCCCCCC---HHHHHHHHHHCCEEEEEECCCCCCCCCCCC-CCCCCCHH
T ss_conf             50485688888998448999875279995389997422---677666676639179996689876788974-34557577


Q ss_pred             CCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHH--HHHHHHHHCCCCCHHHH
Q ss_conf             222222222222222-222234434443101333210235652389628856331103569--99999863111100001
Q gi|254780166|r   84 MAADAVSLLEHLGIS-KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW--QSLIDSFLLPSIDEVQN  160 (261)
Q Consensus        84 ~~~di~~~i~~l~~~-~~~liGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~  160 (261)
T Consensus        89 r~~~~~all~~l~i~~~~i~~GHSrGce~al~~~~~~p--~~g~vlin~~G~rpH~gi~P~~r~~~i~~v~~~L~~~l~~  166 (297)
T pfam06342        89 RNSYSKALLEELELKGKLIIMGHSRGCENALQTATTRP--AHGLVMINPTGFRIHKGIRPKSRMETINWVYKLLPLFLGD  166 (297)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHCCC--CCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999997287772599985552477888762587--6148986478766666768178999999999998999999


Q ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHH------HHCCCCCEEEEEECCCCCCCCH--HHHH----------
Q ss_conf             110000000034766541356777654101220012------1003576069984788878807--9999----------
Q gi|254780166|r  161 PLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD------LYRIDVPVLIAVGSQDDLAGSP--QELM----------  222 (261)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------l~~i~~P~l~i~G~~D~~~~~~--~~l~----------  222 (261)
T Consensus       167 ~i~~~~y~~~GfkV~~-Geea~~air~~~~~~f~~q~~~I~~l~~k~~k~li~fg~~D~LiEeeI~~E~~~~~~~l~h~~  245 (297)
T pfam06342       167 SILYFYYKSVGLKVSD-GEEAAAAMRSMQTFALEEQLESIDKLNEKPTKTFIVFGGKDHLVEEEIVFEALMKFSGLDHFN  245 (297)
T ss_pred             HHHHHHHHHHCCCCCC-HHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCHHHEE
T ss_conf             9999999982700477-489999888773007467788999961889857999747643457899999998518725500


Q ss_pred             --------------HHCC---CCEEEEECCCCCCCCCCCHHHH-HHHHHH
Q ss_conf             --------------9679---9799998888738434848999-999999
Q gi|254780166|r  223 --------------SFIP---SSQYLNICRRDHLLAVGDKQFK-QGVVNF  254 (261)
Q Consensus       223 --------------~~~p---~~~~~~i~~~gH~~~~e~p~~~-~~i~~F  254 (261)
T Consensus       246 ~~~~~~e~~~~kI~~~~~~gq~~~sVf~~~~gHy~qK~~A~~iae~~~~m  295 (297)
T pfam06342       246 IDKEISEEEIKKILKSFTGGQKGASVFVAKDGHFQNKTRAELVAEVVKSI  295 (297)
T ss_pred             ECCCCCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHH
T ss_conf             00147545689999997456761599982687157665389999999985