BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus
Liberibacter asiaticus str. psy62]
         (261 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039843|gb|ACT56639.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 261

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI
Sbjct: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP
Sbjct: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120

Query: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180
           SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA
Sbjct: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240
           LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL
Sbjct: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240

Query: 241 AVGDKQFKQGVVNFYANELRA 261
           AVGDKQFKQGVVNFYANELRA
Sbjct: 241 AVGDKQFKQGVVNFYANELRA 261


>gi|315122670|ref|YP_004063159.1| hydrolase protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496072|gb|ADR52671.1| hydrolase protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 246

 Score =  380 bits (977), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/241 (76%), Positives = 205/241 (85%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
            AFYDVGDK AP ILLIHG  SS Q NWL SGW+Q LCDQGFRVIA DNLGHGKSDK Y 
Sbjct: 1   MAFYDVGDKSAPAILLIHGFTSSYQINWLSSGWVQFLCDQGFRVIALDNLGHGKSDKPYS 60

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
             DYRL+FMAADAVSLL+HLGISK H++GYSMGARIACS  LFYP+Y RSV+LGGVGS L
Sbjct: 61  CVDYRLIFMAADAVSLLDHLGISKAHIIGYSMGARIACSTALFYPTYARSVVLGGVGSGL 120

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
           YD +V+DW  +IDSFL+PSI++VQ PLGKKFRKFA++ PGNDLKAL+SCLSM RK F +D
Sbjct: 121 YDLEVIDWNPIIDSFLVPSINDVQCPLGKKFRKFAEIVPGNDLKALSSCLSMTRKLFHRD 180

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFY 255
           DL RIDVPVLIAVGSQDD+AGSPQELMS I  SQYLNI  RDH+LAVGD QFKQGV+ FY
Sbjct: 181 DLSRIDVPVLIAVGSQDDIAGSPQELMSCIVGSQYLNIRNRDHMLAVGDMQFKQGVMEFY 240

Query: 256 A 256
            
Sbjct: 241 T 241


>gi|222085843|ref|YP_002544375.1| hydrolase protein [Agrobacterium radiobacter K84]
 gi|221723291|gb|ACM26447.1| hydrolase protein [Agrobacterium radiobacter K84]
          Length = 260

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 117/241 (48%), Positives = 167/241 (69%), Gaps = 2/241 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A++D GD + P +LLIHG AS+   NW+  GW++ L D G+RVIA DN GHG SDKSY
Sbjct: 17  KLAYFDEGDPNGPPVLLIHGFASTAIANWVNPGWLKTLGDAGYRVIAIDNRGHGASDKSY 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
             + Y    MA DAV+LL+HLGI + HVMGYSMGAR++  + + +P  VRS++LGG+G  
Sbjct: 77  DADAYHPWIMAEDAVALLDHLGIPEAHVMGYSMGARVSTFLAMAHPDRVRSLVLGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + D  V DW  + D+ L PS+D+V +  G+ FR FAD    +D +ALA+C+   R    +
Sbjct: 137 MVDG-VGDWDPIADALLAPSLDDVTHERGRMFRAFAD-QTKSDRQALAACIKGSRDLAAR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +D+ +++ P LIAVG++DD+AGS QEL + +P ++ L+I  RDH+LAVGDK FK+ V+ F
Sbjct: 195 EDVAKVEQPTLIAVGTKDDIAGSAQELAALMPHAEVLDIPNRDHMLAVGDKLFKKAVLEF 254

Query: 255 Y 255
           Y
Sbjct: 255 Y 255


>gi|327190786|gb|EGE57854.1| putative hydrolase protein [Rhizobium etli CNPAF512]
          Length = 261

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 163/242 (67%), Gaps = 2/242 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q AF+D GD     +LLIHG AS+   NW+  GW++ L D G+RVIA DN GHG SDK +
Sbjct: 17  QLAFFDEGDPSGVPVLLIHGFASTANVNWVNPGWLKTLGDAGYRVIAIDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR   MAADA++LL+HLGI++ ++MGYSMGARI+    L  P  VRS++LGG+G  
Sbjct: 77  DAEAYRPWVMAADAIALLDHLGIAEANLMGYSMGARISVFAALANPHRVRSLVLGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + D  V DW  + D+ L PS+D V +  G+ FR FAD    +D  ALA+C+   R    +
Sbjct: 137 MTDG-VGDWDPIADALLAPSLDVVTHERGRMFRAFAD-QTKSDRTALAACIRGSRDLVAR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            D+ ++D+P LI VG++DD+AGSPQ+L + +P ++ L+I  RDH+LAVGDK FKQ V+ F
Sbjct: 195 SDMAKLDMPALIGVGTKDDIAGSPQQLAALMPEAEALDIPGRDHMLAVGDKIFKQAVLAF 254

Query: 255 YA 256
           YA
Sbjct: 255 YA 256


>gi|190891592|ref|YP_001978134.1| probable hydrolase protein [Rhizobium etli CIAT 652]
 gi|190696871|gb|ACE90956.1| probable hydrolase protein [Rhizobium etli CIAT 652]
          Length = 261

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 163/242 (67%), Gaps = 2/242 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + AF+D GD     +LLIHG AS+   NW+  GW++ L D G+RVIA DN GHG SDK +
Sbjct: 17  RLAFFDEGDPSGVPVLLIHGFASTANVNWVNPGWLKTLGDAGYRVIAIDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR   MAADA++LL+HLGI++ ++MGYSMGARI+    L  P  VRS++LGG+G  
Sbjct: 77  DAEAYRPWVMAADAIALLDHLGIAEANLMGYSMGARISVFAALANPHRVRSLVLGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + D  V DW  + D+ L PS+D V +  G+ FR FA+    +D  ALA+C+   R    +
Sbjct: 137 MTDG-VGDWDPIADALLAPSLDVVTHERGRMFRAFAE-QTKSDRTALAACIRGSRDLVAR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            D+ ++D+P LI VG++DD+AGSPQ+L + +P ++ L+I  RDH+LAVGDK FKQ V+ F
Sbjct: 195 SDMAKLDMPALIGVGTKDDIAGSPQQLAALMPEAEALDIPGRDHMLAVGDKVFKQAVLAF 254

Query: 255 YA 256
           YA
Sbjct: 255 YA 256


>gi|86357523|ref|YP_469415.1| hydrolase protein [Rhizobium etli CFN 42]
 gi|86281625|gb|ABC90688.1| probable hydrolase protein [Rhizobium etli CFN 42]
          Length = 261

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 161/242 (66%), Gaps = 2/242 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + AF+D GD     +LLIHG AS+   NW+  GW++ L D G+RVIA DN GHG SDK +
Sbjct: 17  RLAFFDEGDPSGVPVLLIHGFASTANVNWVNPGWLRTLGDAGYRVIAIDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR   MA DA++LL+HLGI + ++MGYSMGARI+    L  P  VRS++LGG+G  
Sbjct: 77  DAEAYRPWVMAGDAIALLDHLGIPEANLMGYSMGARISVFAALANPHRVRSLVLGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + D  V DW  + D+ L PS+D V +  G+ FR FA+    +D  ALA+C+   R    +
Sbjct: 137 MTDG-VGDWDPIADALLAPSLDVVMHDRGRMFRAFAE-QTKSDRTALAACIRGSRDLVAR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            D+ ++D+P LI VG++DD+AGSPQEL + +P ++ L+I  RDH+LAVGDK FKQ V+ F
Sbjct: 195 SDMAKLDMPTLIGVGTKDDIAGSPQELAALMPEAEALDIPGRDHMLAVGDKVFKQAVLAF 254

Query: 255 YA 256
           YA
Sbjct: 255 YA 256


>gi|227821884|ref|YP_002825854.1| hydrolase family protein [Sinorhizobium fredii NGR234]
 gi|227340883|gb|ACP25101.1| hydrolase family protein [Sinorhizobium fredii NGR234]
          Length = 266

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 164/247 (66%), Gaps = 2/247 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A++D GD     +LLIHG ASS   NW++ GW++ L D G+RV+AFDN GHG S K Y
Sbjct: 22  EIAYFDEGDPSGDPVLLIHGFASSANVNWVYPGWLKTLGDAGYRVVAFDNRGHGASSKPY 81

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
             + Y    MA DA +LL HLGI + HVMGYSMGAR++  + L +P  VRS++ GG+G  
Sbjct: 82  DASVYHPHQMAGDAAALLVHLGIGEAHVMGYSMGARVSAFLALHHPHRVRSLVFGGLGIG 141

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  + V DW  + D+ L PS+++V +  G+ FR FAD    +D +ALA+C+S  R     
Sbjct: 142 MV-TGVGDWDPIADALLAPSLEDVTHARGRMFRAFAD-QTKSDRQALAACISTSRDLLSA 199

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +D+ RIDVPVLI VG++DD+AGS  EL + +P ++ L+I  RDH+LAVGD+ FK+ V+ F
Sbjct: 200 EDVGRIDVPVLIGVGTKDDVAGSALELAALMPQARALDIPGRDHMLAVGDRVFKKAVLEF 259

Query: 255 YANELRA 261
           +    RA
Sbjct: 260 FGEVGRA 266


>gi|209549166|ref|YP_002281083.1| alpha/beta hydrolase fold [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534922|gb|ACI54857.1| alpha/beta hydrolase fold [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 261

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 161/247 (65%), Gaps = 2/247 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + AF+D GD     +LLIHG AS+   NW+  GW++ L D G+RVIA DN GHG SDK +
Sbjct: 17  KLAFFDEGDPAGVPVLLIHGFASTANVNWVHPGWLKTLGDAGYRVIAIDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR   MA DA++LL+HLGI + +VMGYSMGARI+    L  P  VRS++LGG+G  
Sbjct: 77  DAEAYRPWVMAGDAIALLDHLGIPEANVMGYSMGARISVFTALANPHRVRSLVLGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + D  V DW  + D+ L PS+++V +  G+ FR FA+    +D  ALA C+   R    +
Sbjct: 137 MTDG-VGDWDPIADALLAPSLEDVTHDRGRMFRAFAE-QTKSDRVALALCIRGSRDLVAR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            D+ ++D+P LI VG++DD+AGSPQEL   +P ++ L+I  RDH+LAVGDK FKQ V+ F
Sbjct: 195 ADMGKLDMPTLIGVGTKDDIAGSPQELAGLMPDAEALDIPGRDHMLAVGDKVFKQAVLAF 254

Query: 255 YANELRA 261
           YA   R 
Sbjct: 255 YAKVARG 261


>gi|241204492|ref|YP_002975588.1| alpha/beta hydrolase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858382|gb|ACS56049.1| alpha/beta hydrolase fold protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 261

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/242 (47%), Positives = 161/242 (66%), Gaps = 2/242 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q AF+D GD     ++LIHG AS+   NW+  GW++ L D GFRVIA DN GHG SDK +
Sbjct: 17  QLAFFDEGDPAGVPVMLIHGFASTANVNWVHPGWLKTLGDAGFRVIAMDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR   MA DA++LL+HLGI + +VMGYSMGARI+    L  P  VRS++LGG+G  
Sbjct: 77  DAEAYRPWIMAGDAIALLDHLGIPEANVMGYSMGARISVFAALANPHRVRSLVLGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + D  V DW  + D+ L PS++ V +  G+ FR FA+ +  +D  ALA C+   R    +
Sbjct: 137 MTDG-VGDWDPIADALLAPSLEAVTHARGRMFRAFAE-ETKSDRVALADCIRGSRDLVAR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            D+ ++D+P LI VG++DD+AGSPQEL + + +++ L+I  RDH+LAVGD+ FKQ V+ F
Sbjct: 195 SDMAKLDMPTLIGVGTKDDIAGSPQELAALMQNAEALDIPGRDHMLAVGDRVFKQAVLAF 254

Query: 255 YA 256
           YA
Sbjct: 255 YA 256


>gi|116251964|ref|YP_767802.1| hydrolase [Rhizobium leguminosarum bv. viciae 3841]
 gi|6822257|emb|CAB70971.1| hydrolase [Rhizobium leguminosarum]
 gi|115256612|emb|CAK07700.1| putative hydrolase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 261

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 160/242 (66%), Gaps = 2/242 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q AF+D GD     +LLIHG AS+   NW+  GW++ L D G+RVIA DN GHG SDK +
Sbjct: 17  QLAFFDEGDPAGVPVLLIHGFASTANVNWVHPGWLKTLGDAGYRVIAMDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR   MA DA++LL+HLGI + +VMGYSMGARI+    L  P  VRS++LGG+G  
Sbjct: 77  DAEAYRPWVMAGDAIALLDHLGIPEANVMGYSMGARISVFAALANPHRVRSLVLGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + D  V DW  + D+ L PS++ V +  G+ FR FA+    +D  ALA C+   R    +
Sbjct: 137 MTDG-VGDWDPIADALLAPSLEAVTHTRGRMFRAFAE-QTKSDHVALAVCIRGSRDLVAR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            D+ ++D+P LI VG++DD+AGSPQEL + + +++ L+I  RDH+LAVGDK FKQ V+ F
Sbjct: 195 SDMAKLDMPTLIGVGTKDDIAGSPQELAALMQNAEALDIPGRDHMLAVGDKVFKQAVLAF 254

Query: 255 YA 256
           YA
Sbjct: 255 YA 256


>gi|222148876|ref|YP_002549833.1| hydrolase [Agrobacterium vitis S4]
 gi|221735862|gb|ACM36825.1| hydrolase [Agrobacterium vitis S4]
          Length = 261

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 166/243 (68%), Gaps = 2/243 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A++D GD   P +LLIHG ASS   NW+  GW++ L D G+RVIA DN GHG+SDK +
Sbjct: 17  EIAYFDEGDPSGPAVLLIHGFASSALVNWVHPGWLKTLGDAGYRVIAPDNRGHGQSDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MAADA +LL+HLG+++ HVMGYSMGARI+  M L +P  VRS++ GG+G +
Sbjct: 77  EAEVYHPENMAADAAALLDHLGVAEAHVMGYSMGARISAFMALDFPQRVRSLVFGGLG-I 135

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
              + V DW  + D+ L PS+D+V +  G+ FR FA+    +D  ALA+C+S  R     
Sbjct: 136 GISTGVGDWDPIADALLAPSLDDVTHERGRMFRAFAE-QTRSDRLALAACISTSRDLLSA 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            DL +I +PVLI VG+ DD+AGSPQEL + +P+++ L+I +RDH+LAVGD+ FKQ V+ F
Sbjct: 195 ADLAKITMPVLIGVGTVDDIAGSPQELAALMPNARALDIPKRDHMLAVGDRVFKQAVLEF 254

Query: 255 YAN 257
           YA 
Sbjct: 255 YAE 257


>gi|150396331|ref|YP_001326798.1| alpha/beta hydrolase fold [Sinorhizobium medicae WSM419]
 gi|150027846|gb|ABR59963.1| alpha/beta hydrolase fold [Sinorhizobium medicae WSM419]
          Length = 261

 Score =  232 bits (591), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 164/247 (66%), Gaps = 2/247 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A++D GD     ILLIHG ASS   NW+F GW++ L D G+RVIA DN GHG+S K +
Sbjct: 17  EIAYFDEGDPSGDPILLIHGFASSANVNWVFPGWLKTLGDAGYRVIALDNRGHGQSSKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
             + Y    MA DA +LL HLGI + HVMGYSMGARI+  + L +P+ VRS++ GG+G  
Sbjct: 77  DPSLYHPHQMAGDAAALLVHLGIGEAHVMGYSMGARISAFLALQHPARVRSLVFGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  + V +W  + D+ L PS+++V +  G+ FR FAD    +D +ALA+C+S  R     
Sbjct: 137 MI-TGVGEWDPIADALLAPSLEDVTHERGRTFRAFAD-QTKSDRQALAACISTSRDLLSA 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +++ RIDVPVLI VG++DD+AGS QEL + +  +  L+I  RDH+LAVGD+ FK+ V+ F
Sbjct: 195 EEVGRIDVPVLIGVGTKDDIAGSAQELAALMQHALALDIPGRDHMLAVGDRVFKKAVLEF 254

Query: 255 YANELRA 261
            A   RA
Sbjct: 255 LAEVGRA 261


>gi|15965235|ref|NP_385588.1| hypothetical protein SMc02114 [Sinorhizobium meliloti 1021]
 gi|307309258|ref|ZP_07588926.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
 gi|307317000|ref|ZP_07596441.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti AK83]
 gi|15074415|emb|CAC46061.1| Putative hydrolase [Sinorhizobium meliloti 1021]
 gi|306897088|gb|EFN27833.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti AK83]
 gi|306900259|gb|EFN30876.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
          Length = 259

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/257 (45%), Positives = 166/257 (64%), Gaps = 3/257 (1%)

Query: 2   MNEVKFFR-SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           +N   F R +    + A++D GD     ILLIHG ASS   NW+F GW++ L D G+RVI
Sbjct: 3   LNPPPFSRFAHDGLEIAYFDEGDPSGDPILLIHGFASSANVNWVFPGWLKTLGDAGYRVI 62

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           A DN GHG+S K +  + Y    MA DA +LL HLGI + HVMGYSMGARI+  + L +P
Sbjct: 63  ALDNRGHGQSSKPHDPSLYHPPQMAGDAAALLVHLGIGEAHVMGYSMGARISAFLALQHP 122

Query: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180
             VRS++ GG+G  +  + V +W  + D+ L PS+++V +  G+ FR FAD    +D +A
Sbjct: 123 DRVRSLVFGGLGIGMI-TGVGEWDPIADALLAPSLEDVTHERGRTFRAFAD-QTKSDRQA 180

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240
           LA+C+S  R     D++ RIDVPVLI VG++DD+AGS +EL + +  +  L+I  RDH+L
Sbjct: 181 LAACISTSRDLLTADEVGRIDVPVLIGVGTKDDIAGSAEELAALMQHAVALDIPGRDHML 240

Query: 241 AVGDKQFKQGVVNFYAN 257
           AVGD+ FK+ V+ F A 
Sbjct: 241 AVGDRVFKKAVLEFLAG 257


>gi|319783225|ref|YP_004142701.1| alpha/beta hydrolase fold protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169113|gb|ADV12651.1| alpha/beta hydrolase fold protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 263

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/229 (48%), Positives = 149/229 (65%), Gaps = 2/229 (0%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +L+IHG ASS   NW+  GW + L D G+R IAFDN GHG S KSY E DY  V MA+DA
Sbjct: 34  VLMIHGFASSHYVNWVSPGWFKTLNDAGYRAIAFDNRGHGASSKSYDEADYTPVKMASDA 93

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
            +LL+HLGI + HVMGYSMGARIA  M L  P  V +++ GG+G  + D  V DW  + D
Sbjct: 94  TALLDHLGIERAHVMGYSMGARIAAFMALSDPDKVATLVFGGLGIGMIDG-VGDWDPIAD 152

Query: 149 SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
           + L        +P G+ FR FAD    +D +ALA+C++  R+   + D+ RI  P L+AV
Sbjct: 153 ALLAEDPAATSHPRGRSFRAFAD-QTRSDRRALAACIAKSRELLSEQDVARIAQPTLVAV 211

Query: 209 GSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
           G+ DD+ GSP EL + +P+++  +I  RDH+LAVGDK FKQ V+ FYA 
Sbjct: 212 GTTDDIGGSPDELAALMPNARAFHIEGRDHMLAVGDKTFKQRVLEFYAE 260


>gi|159184821|ref|NP_354571.2| hydrolase [Agrobacterium tumefaciens str. C58]
 gi|159140106|gb|AAK87356.2| hydrolase [Agrobacterium tumefaciens str. C58]
          Length = 258

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 156/241 (64%), Gaps = 2/241 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A++D GD     +LLIHG ASS   NW+  GW++ L + G+RVIA DN GHG SDK +
Sbjct: 17  RLAYFDEGDPAGDPVLLIHGFASSANVNWVHPGWVKTLGEAGYRVIAIDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MA DAV+LL HLGI++ HVMGYSMGARI+  + + +P  VRS++ GG+G  
Sbjct: 77  DSEAYYPSVMAGDAVALLNHLGIAETHVMGYSMGARISAFLAMAHPERVRSLVFGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + +  V DW  + ++ L PS+D V +  G+ FR FAD    + L ALA+C+   R    +
Sbjct: 137 MVEG-VGDWDPIAEALLAPSLDVVTHERGRMFRAFADQTKSDRL-ALAACIETSRVLVTR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +   +ID P LIAVG++DD+AGS  EL + +P ++ ++I  RDH+LAVGD+ FK  V+ F
Sbjct: 195 EQAQKIDAPTLIAVGTKDDIAGSGAELAAIMPHARAIDIPGRDHMLAVGDRVFKAAVLEF 254

Query: 255 Y 255
           Y
Sbjct: 255 Y 255


>gi|325292966|ref|YP_004278830.1| hydrolase [Agrobacterium sp. H13-3]
 gi|325060819|gb|ADY64510.1| hydrolase [Agrobacterium sp. H13-3]
          Length = 258

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 154/241 (63%), Gaps = 2/241 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A++D GD     +LLIHG ASS   NW+  GW++ L D G+RVIA DN GHG SDK +
Sbjct: 17  RLAYFDEGDPAGDPVLLIHGFASSANVNWVHPGWLKTLGDAGYRVIAIDNRGHGASDKPH 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MA DAV+LL HLGI++ HVMGYSMGARI+  + + +P  VRS++ GG+G  
Sbjct: 77  DPQAYYPPVMAGDAVALLNHLGIAEAHVMGYSMGARISAFLAMAHPERVRSLVFGGLGIG 136

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + +  V DW  + ++ L PS+D V +  G+ FR FAD    + L ALA+C+   R    +
Sbjct: 137 MVEG-VGDWDPIAEALLAPSLDVVTHERGRMFRAFADQTKSDRL-ALAACIETSRVLVSR 194

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +   +ID P LIAVG+ DD+AGS  EL + +P ++ ++I  RDH+LAVGD+ FK   + F
Sbjct: 195 EQAAKIDAPTLIAVGTNDDIAGSGAELAAIMPHARAIDIPGRDHMLAVGDRVFKAAALEF 254

Query: 255 Y 255
           Y
Sbjct: 255 Y 255


>gi|319405710|emb|CBI79333.1| hydrolase or acyltransferase [Bartonella sp. AR 15-3]
          Length = 257

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 161/256 (62%), Gaps = 5/256 (1%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
            E++FF      +FA+ + G +  P ILLIHG  SS   NW  +GW ++L + G+RVIAF
Sbjct: 4   EEIRFFEH-DGLRFAYREEG-RGTP-ILLIHGFGSSAHMNWYVTGWFRILIEAGYRVIAF 60

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           DN GHG SDK Y    Y L  MA DAV LL+HLG+SK HVMGYSMGARI+  M L YP+Y
Sbjct: 61  DNRGHGDSDKIYDPLFYTLQAMAGDAVKLLQHLGLSKTHVMGYSMGARISAFMALLYPTY 120

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           V SVI GG+G  +      DW+ +  + L   I  + N  G  FRKFA+    +D +ALA
Sbjct: 121 VHSVIFGGLGIGMVTGS-GDWEPVAQALLEKDISAITNQRGLMFRKFAE-QTKSDRRALA 178

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           +C+   ++   +D++ +I  P L+AVGS D+++G  + L + +P  + L I  RDH+LAV
Sbjct: 179 ACIMTSKQELTEDEVCKIKQPALVAVGSLDEISGEAEPLAALLPHGEALQIPGRDHMLAV 238

Query: 243 GDKQFKQGVVNFYANE 258
           GDK +K+GV++F A  
Sbjct: 239 GDKVYKKGVIDFLARH 254


>gi|319407274|emb|CBI80915.1| hydrolase or acyltransferase [Bartonella sp. 1-1C]
          Length = 257

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 164/256 (64%), Gaps = 5/256 (1%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
            E++FF      +FA+ + G + AP ILLIHG  SS + NW  +GW + L   G+RVIAF
Sbjct: 4   EEIRFFEH-DGLRFAYCEEG-QGAP-ILLIHGFGSSARINWYATGWFRTLIAAGYRVIAF 60

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           DN GHG SDK Y    Y    MA+DAV LL+HL +SK HVMGYSMGARI+  M L YP+Y
Sbjct: 61  DNRGHGDSDKIYDPLFYTPQAMASDAVKLLQHLELSKAHVMGYSMGARISAFMALLYPTY 120

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           V SVI GG+G  +  + V DW+ +  + L   +  + +P G  FRKFA+    +D +ALA
Sbjct: 121 VHSVIFGGLGIGMV-TGVGDWEPVAQALLEKDVSAITDPRGLMFRKFAE-QTKSDRRALA 178

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           +C+   R+   + ++Y+I  P L+AVGS D+++G  + L++ +P  + L I  RDH+LAV
Sbjct: 179 ACIMTSRQELTEHEIYKIKQPALVAVGSLDEISGEAEPLVALLPHGEALQIPGRDHMLAV 238

Query: 243 GDKQFKQGVVNFYANE 258
           GDK +K+GV++F A  
Sbjct: 239 GDKVYKKGVIDFLARH 254


>gi|260460739|ref|ZP_05808989.1| alpha/beta hydrolase fold protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259033316|gb|EEW34577.1| alpha/beta hydrolase fold protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 255

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 148/230 (64%), Gaps = 2/230 (0%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +L+IHG ASS   NW+  GW + L D G+R IAFDN GHG S KSY E DY    MA+DA
Sbjct: 26  VLMIHGFASSHYVNWVSPGWFKTLNDAGYRAIAFDNRGHGSSSKSYDEADYTPDAMASDA 85

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
            +LL+HLGI + HVMGYSMGARIA  + L  P  V +++ GG+G  + D  V DW  +  
Sbjct: 86  AALLDHLGIERAHVMGYSMGARIAAFLALSDPDKVATLVFGGLGIGMIDG-VGDWDPIAA 144

Query: 149 SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
           + L        +P G+ FR FAD    +D +ALA+C++  R+   +DD+ RI  P LIAV
Sbjct: 145 ALLADDPVTTTHPRGRSFRAFAD-QTRSDRRALAACIAKSRELLSEDDIARISQPTLIAV 203

Query: 209 GSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYANE 258
           G+ DD+ GSP EL + +P+++  +I  RDH+LAVGDK FKQ V+ FYA  
Sbjct: 204 GTTDDIGGSPDELAALMPNARAFHIEGRDHMLAVGDKTFKQRVLEFYAEH 253


>gi|49474231|ref|YP_032273.1| hydrolase [Bartonella quintana str. Toulouse]
 gi|49239735|emb|CAF26117.1| Hydrolase [Bartonella quintana str. Toulouse]
          Length = 257

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 159/252 (63%), Gaps = 5/252 (1%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
            +++FF  +   +FA+ + G +  P ILLIHG  SS + NW  +GW   L + G+RVIA 
Sbjct: 4   EDIRFFE-YDGLRFAYREEG-QGVP-ILLIHGFGSSARVNWYATGWFHTLIEAGYRVIAL 60

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           DN GHG S KSY  + Y    MA DAV LL+HL +SK HVMGYSMGARI+  M L YP+Y
Sbjct: 61  DNRGHGDSIKSYDSSFYTPQAMAGDAVKLLQHLKLSKAHVMGYSMGARISAFMALLYPTY 120

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           + SVI GG+G  +  +   DW+ + D+ L   I  + NP G  FRKFAD    +D +ALA
Sbjct: 121 LHSVIFGGLGIGMV-TGAGDWKPVADALLAEDISTITNPRGLMFRKFAD-QTKSDRRALA 178

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           +C+   ++     ++Y+I  P L+AVGS D++ G  + L + +P  + L I  RDH+LAV
Sbjct: 179 ACVITSKQELTASEVYKIKQPALVAVGSLDEIGGEAKPLAALLPRGEALTIPGRDHMLAV 238

Query: 243 GDKQFKQGVVNF 254
           GDK +K+GVV+F
Sbjct: 239 GDKVYKKGVVDF 250


>gi|319898942|ref|YP_004159035.1| hydrolase or acyltransferase [Bartonella clarridgeiae 73]
 gi|319402906|emb|CBI76457.1| hydrolase or acyltransferase [Bartonella clarridgeiae 73]
          Length = 257

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/257 (43%), Positives = 157/257 (61%), Gaps = 5/257 (1%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIA 61
           + E+ FF     ++FA+ + G      ILLIHG  SS + NW  +GW + L + G+RVIA
Sbjct: 3   VEEIHFFEH-DSFRFAYREEGQ--GTPILLIHGFGSSARVNWCATGWFRSLVEAGYRVIA 59

Query: 62  FDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS 121
           FDN GHG SDKSY    Y    MA+DAV LL+HLG+SK HVMGYSMGARI+  M   YP+
Sbjct: 60  FDNRGHGDSDKSYDPLCYTPQAMASDAVKLLQHLGLSKAHVMGYSMGARISAFMAFLYPT 119

Query: 122 YVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKAL 181
           YV SV+ GG+G  +  +   DW+ +  + L   I  + NP G  FRKF D    +D  AL
Sbjct: 120 YVHSVVFGGLGIGMV-TGAGDWEPVAQALLAEDISTITNPRGLMFRKFVD-QTKSDRHAL 177

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLA 241
           A C+   ++   + ++  I  P L+AVGS D+++G  + L + +P  + L I  RDH+LA
Sbjct: 178 AVCIMTSKQELTESEVREIKQPALVAVGSLDEISGEAEPLAALLPRGEALQIPGRDHMLA 237

Query: 242 VGDKQFKQGVVNFYANE 258
           VGDK +K+GV++F A  
Sbjct: 238 VGDKVYKKGVIDFLARH 254


>gi|319404269|emb|CBI77862.1| hydrolase or acyltransferase [Bartonella rochalimae ATCC BAA-1498]
          Length = 257

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/256 (44%), Positives = 163/256 (63%), Gaps = 5/256 (1%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
            E++FF      +FA+ + G + AP ILLIHG  SS + NW  +GW + L   G+RVIAF
Sbjct: 4   EEIRFFEH-DGLRFAYCEEG-QGAP-ILLIHGFGSSARINWYATGWFRTLIAAGYRVIAF 60

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           DN GHG SDK Y    Y    MA+DAV LL+HL +SK HVMGYSMGARI+  M L YP+Y
Sbjct: 61  DNRGHGDSDKIYDPLFYTPQAMASDAVKLLQHLELSKAHVMGYSMGARISAFMALLYPTY 120

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           V SVI GG+G  +  +   DW+ +  + L   +  + +P G  FRKFA+    +D +ALA
Sbjct: 121 VHSVIFGGLGIGMV-TGAGDWEPVAQALLEKDVSAITDPRGLMFRKFAE-QTKSDRRALA 178

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           +C+   ++   + ++Y+I  P L+AVGS D+++G  + L++ +P  + L I  RDH+LAV
Sbjct: 179 ACIMTSKQELTEHEIYKIKQPALVAVGSLDEISGEAEPLVALLPHGEALQIPGRDHMLAV 238

Query: 243 GDKQFKQGVVNFYANE 258
           GDK +K+GV++F A  
Sbjct: 239 GDKVYKKGVIDFLARH 254


>gi|110634082|ref|YP_674290.1| alpha/beta hydrolase fold [Mesorhizobium sp. BNC1]
 gi|110285066|gb|ABG63125.1| alpha/beta hydrolase fold protein [Chelativorans sp. BNC1]
          Length = 251

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 113/254 (44%), Positives = 162/254 (63%), Gaps = 5/254 (1%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
           ++FF S   ++ AF D G+ D   ILLIHG AS+   NW+  GW++ L D G+RVIA DN
Sbjct: 1   MQFF-SHDGFELAFIDEGEGD--PILLIHGFASTHFVNWVAPGWVKTLRDAGYRVIALDN 57

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
            GHG+S KS++  DY    MA DA +LL+HLGI + HVMGYSMGARIA  + L +P+ V 
Sbjct: 58  RGHGRSTKSHVRQDYTPDKMADDAAALLDHLGIERAHVMGYSMGARIAAFLALAHPNRVA 117

Query: 125 SVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASC 184
           ++ILGG+G  + +  V +W  + D+ L    + + +  G+ FR FAD    +D +ALA+C
Sbjct: 118 TLILGGLGFGMVEG-VGEWDIIADALLAQDPESITHARGRMFRNFAD-QTKSDRQALAAC 175

Query: 185 LSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGD 244
           +S  R      ++ RI  PVL+AVG++DD+AG P+ L + +P  +  +I  RDH+LAVGD
Sbjct: 176 ISTSRTLLGAHEVARIRQPVLVAVGTRDDIAGRPESLAAMLPQGEAFSIVDRDHMLAVGD 235

Query: 245 KQFKQGVVNFYANE 258
           K FK   + F A+ 
Sbjct: 236 KTFKARALKFLASH 249


>gi|163760309|ref|ZP_02167392.1| hypothetical protein HPDFL43_08604 [Hoeflea phototrophica DFL-43]
 gi|162282708|gb|EDQ32996.1| hypothetical protein HPDFL43_08604 [Hoeflea phototrophica DFL-43]
          Length = 268

 Score =  218 bits (555), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 149/242 (61%), Gaps = 2/242 (0%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
            A+Y+ G  D   +LLIHG AS+   NW+F GW + L   G+RVIA DN GHG+SDK + 
Sbjct: 18  IAWYEAGSPDGFPVLLIHGFASTAHVNWVFPGWTKTLDQAGYRVIALDNRGHGESDKPHD 77

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              Y    MAADA  LL+ LGI   HVMGYSMGARI+  + L  P  VRSV+ GG+G  +
Sbjct: 78  PEAYHPETMAADAAGLLDELGIEAAHVMGYSMGARISAFLTLSRPDLVRSVVFGGLGMGM 137

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
            D  V DW  + D+ L  S+D+V +  G+ FR FA+    +D  ALA+C+   R    + 
Sbjct: 138 VDG-VGDWDPIADTLLASSLDDVTDERGRMFRAFAE-QTKSDRFALAACIRTSRTLVDRG 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFY 255
            L  +  P L+ VG++DD+AGS QEL   +P  ++L+I  RDH+LAVGDK FK  V+ F+
Sbjct: 196 HLAAMVTPALVGVGTRDDIAGSAQELAELMPHGEWLDIPNRDHMLAVGDKVFKAAVLEFF 255

Query: 256 AN 257
           + 
Sbjct: 256 SK 257


>gi|240850646|ref|YP_002972046.1| hydrolase, alpha/beta hydrolase fold family [Bartonella grahamii
           as4aup]
 gi|240267769|gb|ACS51357.1| hydrolase, alpha/beta hydrolase fold family [Bartonella grahamii
           as4aup]
          Length = 257

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 162/252 (64%), Gaps = 5/252 (1%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
            +++FF  +   +FA+ + G + AP +LLIHG  SS + NW  +GW ++L + G+RVIA 
Sbjct: 4   EDIRFFE-YNGLRFAYREEG-QGAP-VLLIHGFGSSARVNWYATGWFRILTEAGYRVIAL 60

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           DN GHG S KSY    Y    MA DA+ LL+HL ISK HVMGYSMGARI+  M L +P+Y
Sbjct: 61  DNRGHGDSVKSYDHVFYTPQAMAGDAIKLLQHLEISKAHVMGYSMGARISAFMALLHPTY 120

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           V SVI GG+G  +  +   +W+ + ++ L   I  + N  G  FRKFAD    +D +ALA
Sbjct: 121 VHSVIFGGLGIGMV-TGAGNWEPVAEALLAEDISTITNTRGLMFRKFAD-QTKSDRRALA 178

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           +C+   ++     ++Y+I  P L+AVGS D++ G+ + L + +P  + L+I  RDH+LAV
Sbjct: 179 ACIITSKQELTASEVYKIKQPALVAVGSLDEIGGAAEPLAALLPCGEALSIPGRDHMLAV 238

Query: 243 GDKQFKQGVVNF 254
           GDK +K+GV++F
Sbjct: 239 GDKVYKKGVIDF 250


>gi|13470458|ref|NP_102026.1| hydrolase [Mesorhizobium loti MAFF303099]
 gi|14021199|dbj|BAB47812.1| hydrolase [Mesorhizobium loti MAFF303099]
          Length = 271

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 147/229 (64%), Gaps = 2/229 (0%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +L+IHG ASS   NW+  GW + L D G+R IAFDN GHG S KSY E DY    MA+DA
Sbjct: 42  VLMIHGFASSHYVNWVSPGWFKTLNDAGYRAIAFDNRGHGSSSKSYEEADYTPAKMASDA 101

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
            +LL+HLGI + HVMGYSMGARIA  + L  P  V +++ GG+G  + D  V DW  +  
Sbjct: 102 AALLDHLGIERAHVMGYSMGARIAAFLALSDPDKVATLVFGGLGIGMIDG-VGDWDPIAA 160

Query: 149 SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
           + L        +P G+ FR FAD    +D +ALA+C++  R+   + D+ RI  P L+AV
Sbjct: 161 ALLADDPATTTHPRGRSFRAFAD-QTRSDRRALAACIATSRELLSEQDVARIAQPTLVAV 219

Query: 209 GSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
           G+ DD+ GSP +L + +P+++  +I  RDH+LAVGDK FKQ V+ FYA 
Sbjct: 220 GTTDDIGGSPDDLAALMPNARAFHIEGRDHMLAVGDKTFKQRVLEFYAE 268


>gi|90419556|ref|ZP_01227466.1| hydrolase, alpha/beta hydrolase fold family [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336493|gb|EAS50234.1| hydrolase, alpha/beta hydrolase fold family [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 264

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 153/240 (63%), Gaps = 2/240 (0%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q AF D G++D P +LL+HG ASS++ NW+ +GW++ L + G+RV+AFD+ GHG+S K  
Sbjct: 22  QLAFTDTGERDRPAVLLVHGFASSMRVNWIDTGWVKTLNEAGYRVVAFDHRGHGQSAKPQ 81

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E  Y    MA D V+LL+HL I +  + GYSMGAR++    L  P  +  ++ GG+G  
Sbjct: 82  DEAAYTPQKMAGDVVNLLDHLEIGETVIFGYSMGARVSAFTALAAPGRISRIVFGGLGIG 141

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           L +  V DW  +  + L PS+D+V +P G+ FR FAD    +D  ALA+C+S  R+   +
Sbjct: 142 LVEG-VGDWDPIAAALLAPSLDDVTDPRGRMFRAFADRTR-SDRHALAACISTSRQELTE 199

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            ++ RI  P LI VG+ DD+AGSP  L + +P+++   I  RDH+L+VGD+ FK  V+ F
Sbjct: 200 AEVGRIAQPTLIGVGTTDDIAGSPDALAALMPNARVFAIEGRDHMLSVGDRTFKAEVLRF 259


>gi|49475597|ref|YP_033638.1| hydrolase [Bartonella henselae str. Houston-1]
 gi|49238404|emb|CAF27631.1| Hydrolase [Bartonella henselae str. Houston-1]
          Length = 257

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 108/254 (42%), Positives = 159/254 (62%), Gaps = 5/254 (1%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           +   ++FF  +   +F++ + G      ILL+HG  SS + NW  +GW + L + G+RVI
Sbjct: 2   IAENIRFFE-YDGLRFSYREEGQ--GTPILLVHGFGSSARVNWYATGWFRTLTEAGYRVI 58

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           A DN GHG S KSY  + Y    MA+DA+ LL+HL +SK HVMGYSMGARI+  M L YP
Sbjct: 59  ALDNRGHGDSVKSYDPSFYTPQAMASDAMRLLQHLELSKAHVMGYSMGARISAFMALLYP 118

Query: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180
           +YV SVI GG+G  +  +   +W+ + ++ L   I  + NP G  FRKFAD    +D +A
Sbjct: 119 TYVHSVIFGGLGIGMV-TGAGNWEPVAEALLAEDISTITNPRGLMFRKFAD-QTKSDRRA 176

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240
           LA+C+   ++     ++Y+I  P L+AVGS D++ G  + L + +P  + L I  RDH+L
Sbjct: 177 LAACIITSKQELTAAEVYKIKQPALVAVGSLDEIGGEAEPLAALLPLGEVLQIPGRDHML 236

Query: 241 AVGDKQFKQGVVNF 254
           AVGDK +K+GV++F
Sbjct: 237 AVGDKIYKRGVIDF 250


>gi|163868309|ref|YP_001609518.1| hydrolase or acyltransferase [Bartonella tribocorum CIP 105476]
 gi|161017965|emb|CAK01523.1| hydrolase or acyltransferase [Bartonella tribocorum CIP 105476]
          Length = 257

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 161/252 (63%), Gaps = 5/252 (1%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
            +V+FF  +   +FA+ + G + AP ILLIHG  SS + NW  +GW ++L + G+RVIA 
Sbjct: 4   EDVRFFE-YDGLRFAYREEG-QGAP-ILLIHGFGSSARVNWYTTGWFRILTEAGYRVIAL 60

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           DN GHG S KSY    Y    MA DAV LL+HL +S+ HVMGYSMGARI+  M L +P+Y
Sbjct: 61  DNRGHGDSVKSYDPTFYTPQAMAGDAVKLLQHLELSRAHVMGYSMGARISAFMALLHPTY 120

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           V SVI GG+G  +  +   +W+ + ++ L      + N  G  FRKFAD    +D +ALA
Sbjct: 121 VNSVIFGGLGIGMV-TGAGNWEPVAEALLAEDPSSITNTRGLMFRKFAD-QTKSDRRALA 178

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           +C+   ++     ++Y+I  P L+AVGS D++ G+ + L + +P  + L+I  RDH+LAV
Sbjct: 179 ACIITSKQELTASEIYKIGQPALVAVGSLDEIGGAAEPLAALLPCGEALSIPSRDHMLAV 238

Query: 243 GDKQFKQGVVNF 254
           GDK +K+GV++F
Sbjct: 239 GDKVYKKGVIDF 250


>gi|319408549|emb|CBI82202.1| hydrolase or acyltransferase [Bartonella schoenbuchensis R1]
          Length = 257

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 152/240 (63%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           +FA+ + G      ILLIHG  SS + NW  +GW + L + G+RVIA DN GHG S KSY
Sbjct: 15  RFAYREEGQ--GIPILLIHGFGSSARINWYATGWFRSLVEAGYRVIALDNRGHGDSVKSY 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MA DAV LL+HLG+SKVHVMGYSMGARI+  M L YP+YV SVI GG+G  
Sbjct: 73  DPLFYTPQAMAGDAVKLLQHLGLSKVHVMGYSMGARISAFMALLYPTYVHSVIFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +      DW+ + ++ L   +  + N  G  FRKF D    +D +ALA+C+    +   +
Sbjct: 133 MVTGG-GDWKPVSEALLAEDVSTITNARGLMFRKFVD-QTKSDRRALATCIMTSAQKLTE 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            D+++I  P L+AVGS DD++G  + L++ +P  + L I  RDH+LAVGD+ +K+GV++F
Sbjct: 191 SDVHKIKQPALVAVGSLDDISGEAEPLVALLPHGEVLEIPGRDHMLAVGDQVYKKGVIDF 250


>gi|91977755|ref|YP_570414.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB5]
 gi|91684211|gb|ABE40513.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB5]
          Length = 250

 Score =  211 bits (538), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 152/244 (62%), Gaps = 4/244 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
             A+ D G+ D   I+L+HG AS+   NW++  W+  L   G RVIA DN GHG+S K Y
Sbjct: 10  NIAYLDDGEGD--PIVLVHGFASNKNVNWVYPSWLSELKRAGRRVIAIDNRGHGESAKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY L  MAAD ++L++HL I +  VMGYS+G RI  ++    P  VR+ ILGG+GS 
Sbjct: 68  DPADYGLAAMAADVIALMDHLAIDRADVMGYSLGGRITATLARECPERVRAAILGGIGSG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           L        +++  +   PS+D+V +P+G+ FR FAD    +D KALA+CL   R    +
Sbjct: 128 LVKGG-GPGETVAQALEAPSLDDVSDPVGRVFRAFAD-QTRSDRKALAACLRGSRLLMSE 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            +  RI VPVLIAVG+ DD+AGS  EL   IP S+ L+I RRDH+ AVGD+ +K+GVV+F
Sbjct: 186 QEAARIAVPVLIAVGTADDVAGSAHELSGMIPGSEVLDIPRRDHMRAVGDRVYKEGVVDF 245

Query: 255 YANE 258
            A  
Sbjct: 246 LARR 249


>gi|121602635|ref|YP_989120.1| hydrolase, alpha/beta fold family protein [Bartonella bacilliformis
           KC583]
 gi|120614812|gb|ABM45413.1| hydrolase, alpha/beta fold family protein [Bartonella bacilliformis
           KC583]
          Length = 257

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 106/255 (41%), Positives = 160/255 (62%), Gaps = 5/255 (1%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIA 61
           +  ++FF      +FA+Y+ G  +   ILLIHG  SS + NW  +GW   L + G+RVIA
Sbjct: 3   VENIRFFEH-DGLRFAYYEEGRGE--PILLIHGFGSSARINWYETGWFSCLIEAGYRVIA 59

Query: 62  FDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS 121
            DN GHG SDKSY  + Y    MA+DA  LL+HL + K HVMGYSMGARI+  M L YP+
Sbjct: 60  LDNRGHGDSDKSYNPSFYTPQLMASDAAKLLQHLELPKAHVMGYSMGARISAFMTLLYPT 119

Query: 122 YVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKAL 181
           YV SV+ GG+G +   +    W+ + ++ L   +  + N  G  FR+FAD +  +D +AL
Sbjct: 120 YVHSVVFGGLG-IGMVTGAGSWEPVAEALLAEDVSTITNSRGLMFRRFADKNK-SDKRAL 177

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLA 241
           A+C+   ++   + ++ +I  P L+AVGS D+++G  + L + +P+ + L I  R+H+LA
Sbjct: 178 AACIMTSKQELTEYEISQIKQPSLVAVGSLDEISGEAKPLAALLPNGEALQIPNRNHMLA 237

Query: 242 VGDKQFKQGVVNFYA 256
           VGDK +K+GV++F A
Sbjct: 238 VGDKIYKKGVIDFLA 252


>gi|86749255|ref|YP_485751.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris HaA2]
 gi|86572283|gb|ABD06840.1| Alpha/beta hydrolase [Rhodopseudomonas palustris HaA2]
          Length = 250

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 107/240 (44%), Positives = 153/240 (63%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
             A+ D G+ D   I+L+HG AS+   NW++  W+  L   G RV+A DN GHG+S K Y
Sbjct: 10  TIAYLDDGEGD--PIVLVHGFASNKNVNWVYPSWLSELKRAGRRVVALDNRGHGESSKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY L  MA D ++L++HL I +  +MGYS+G RI  ++   +P  VR+ ILGG+GS 
Sbjct: 68  DPADYGLTTMAGDVIALMDHLAIDRADIMGYSLGGRITATLARRHPERVRAAILGGIGSG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           L        +++  +   PS+D+V +P+G+ FR FAD    +D KALA+CL   R    +
Sbjct: 128 LVVGG-GPGETVALALEAPSLDDVSDPVGRTFRAFAD-QTRSDRKALAACLRGSRTLMSE 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           D++ +I VPVLIAVG+ DD+AGS  +L   IP S+ L+I RRDH+ AVGD+ FK+GVV+F
Sbjct: 186 DEVAQIAVPVLIAVGTVDDVAGSAHQLSGMIPGSEVLDIPRRDHMRAVGDRVFKEGVVDF 245


>gi|39936493|ref|NP_948769.1| alpha/beta hydrolase fold protein [Rhodopseudomonas palustris
           CGA009]
 gi|192292284|ref|YP_001992889.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris TIE-1]
 gi|39650349|emb|CAE28871.1| possible hydrolase [Rhodopseudomonas palustris CGA009]
 gi|192286033|gb|ACF02414.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris TIE-1]
          Length = 251

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 158/242 (65%), Gaps = 3/242 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
             A+ D G+ +   ILLIHG AS+   NW++  W+  L   G RVIA DN GHG+S K Y
Sbjct: 10  NIAYLDEGEGE--PILLIHGFASNKNVNWVYPSWLSELKRTGRRVIAIDNRGHGESSKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
             NDY L  MA+DAV+L++HLGI++  VMGYSMGARI  ++       VRSV+LGG+G  
Sbjct: 68  DPNDYTLEAMASDAVALMDHLGIARADVMGYSMGARIGANLARRQEQRVRSVVLGGLGMG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           L  ++    +++  +    ++D+V +P+G+ FR FAD    +D KALA+C+   R    +
Sbjct: 128 LLSNEGRPGENVARALEADALDDVTDPVGRTFRAFAD-QTRSDRKALAACMRGSRGLMSR 186

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +D  +I VPVLIAVG+ DD+AGS  EL   IP SQ L+I RRDH+ AVGD+ +K+GVV+F
Sbjct: 187 EDAAQIAVPVLIAVGTDDDVAGSAHELGDIIPGSQVLDIPRRDHMRAVGDRVYKEGVVDF 246

Query: 255 YA 256
            A
Sbjct: 247 LA 248


>gi|158425085|ref|YP_001526377.1| alpha/beta hydrolase fold protein [Azorhizobium caulinodans ORS
           571]
 gi|158331974|dbj|BAF89459.1| alpha/beta hydrolase fold protein [Azorhizobium caulinodans ORS
           571]
          Length = 250

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 156/243 (64%), Gaps = 4/243 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ D G+  AP +LLIHG AS+ + NW+F GW++ L D G RVIAFD+ GHG S K Y
Sbjct: 10  ELAYLDEGEG-AP-VLLIHGFASTKEINWVFPGWVKTLTDAGRRVIAFDHRGHGASQKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MA DA +LL+ LGI +  V+GYSMGAR+   + L +P  VR  +LGG+G  
Sbjct: 68  DPAQYHTRLMAEDAANLLKTLGIPQADVIGYSMGARVTAQLTLSHPDVVRKAVLGGLGIH 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           L D  V   QS+ ++   PS+++V +P+G+ FR FAD +   D KALA+C+   R+   +
Sbjct: 128 LVDG-VGLPQSIAEALEAPSLEDVTDPMGRMFRAFADSNKA-DRKALAACIRGSRQSLDR 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            ++  I  PVL+AVG++D +AG    L + +P+ + L+I  RDH  AVGDK FKQGV++F
Sbjct: 186 AEVASIRHPVLVAVGTRDLIAGDAHALAALLPNGRALDIPNRDHNPAVGDKVFKQGVLDF 245

Query: 255 YAN 257
           +A 
Sbjct: 246 FAE 248


>gi|146339934|ref|YP_001204982.1| putative hydrolase [Bradyrhizobium sp. ORS278]
 gi|146192740|emb|CAL76745.1| putative hydrolase [Bradyrhizobium sp. ORS278]
          Length = 251

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 152/242 (62%), Gaps = 4/242 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + AF D G+ D   I+L+HG AS+   NW++ GW+  L + G RVIA DN GHG S K Y
Sbjct: 10  EIAFIDEGEGD--PIVLVHGFASTKNVNWIYPGWVTELRNAGRRVIALDNRGHGDSAKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  MA+D  +L++HLG++   VMGYS+G RIA  + L  P  +RS I GG+G  
Sbjct: 68  DPAQYAIAEMASDVTALMDHLGLASADVMGYSLGGRIAAHIALTTPQRLRSAIFGGIGMA 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + +      +++  +   PS+D+V +P+GK FR FAD    +D  ALA+C+   R    +
Sbjct: 128 MIEGG-GPGENVAAALEAPSLDDVSDPVGKTFRAFAD-QTRSDRLALAACMRGSRGLISR 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +D  RI VPVL+AVG+ DD++GS   L + IP+++ L+I  RDH+ AVGDK +K GVV+F
Sbjct: 186 EDAGRIAVPVLVAVGTTDDVSGSGPALGALIPNAEVLDIPNRDHMRAVGDKVYKAGVVDF 245

Query: 255 YA 256
            A
Sbjct: 246 LA 247


>gi|306840272|ref|ZP_07473046.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           BO2]
 gi|306289799|gb|EFM60981.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           BO2]
          Length = 256

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+   G+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQAGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HLGI+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  EAEDYTPSKMAGDAAALLDHLGIAKTHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  PVL+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AAIERILQPVLVAVGTTDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|17987016|ref|NP_539650.1| non-heme chloroperoxidase [Brucella melitensis bv. 1 str. 16M]
 gi|225852759|ref|YP_002732992.1| alpha/beta hydrolase [Brucella melitensis ATCC 23457]
 gi|256044905|ref|ZP_05447809.1| Alpha/beta hydrolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113820|ref|ZP_05454613.1| Alpha/beta hydrolase [Brucella melitensis bv. 3 str. Ether]
 gi|256263757|ref|ZP_05466289.1| hydrolase [Brucella melitensis bv. 2 str. 63/9]
 gi|260565493|ref|ZP_05835977.1| hydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|265991333|ref|ZP_06103890.1| alpha/beta hydrolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995170|ref|ZP_06107727.1| alpha/beta hydrolase [Brucella melitensis bv. 3 str. Ether]
 gi|17982669|gb|AAL51914.1| non-heme chloroperoxidase [Brucella melitensis bv. 1 str. 16M]
 gi|225641124|gb|ACO01038.1| Alpha/beta hydrolase [Brucella melitensis ATCC 23457]
 gi|260151561|gb|EEW86655.1| hydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|262766283|gb|EEZ12072.1| alpha/beta hydrolase [Brucella melitensis bv. 3 str. Ether]
 gi|263002117|gb|EEZ14692.1| alpha/beta hydrolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093814|gb|EEZ17819.1| hydrolase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409285|gb|ADZ66350.1| alpha/beta hydrolase [Brucella melitensis M28]
 gi|326538995|gb|ADZ87210.1| alpha/beta hydrolase [Brucella melitensis M5-90]
          Length = 256

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+   G+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQAGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HLGI+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  KAEDYTPSKMAGDAAALLDHLGIAKAHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  PVL+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AAIERILQPVLVAVGTTDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|23502140|ref|NP_698267.1| alpha/beta fold family hydrolase [Brucella suis 1330]
 gi|62290172|ref|YP_221965.1| alpha/beta fold family hydrolase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700094|ref|YP_414668.1| alpha/beta fold hydrolase [Brucella melitensis biovar Abortus 2308]
 gi|161619215|ref|YP_001593102.1| alpha/beta hydrolase fold [Brucella canis ATCC 23365]
 gi|163843526|ref|YP_001627930.1| alpha/beta hydrolase fold [Brucella suis ATCC 23445]
 gi|189024407|ref|YP_001935175.1| hydrolase, alpha/beta hydrolase fold family [Brucella abortus S19]
 gi|225627731|ref|ZP_03785768.1| alpha/beta fold family hydrolase [Brucella ceti str. Cudo]
 gi|237815680|ref|ZP_04594677.1| alpha/beta fold family hydrolase [Brucella abortus str. 2308 A]
 gi|254689475|ref|ZP_05152729.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           abortus bv. 6 str. 870]
 gi|254693961|ref|ZP_05155789.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           abortus bv. 3 str. Tulya]
 gi|254697613|ref|ZP_05159441.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254704540|ref|ZP_05166368.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella suis
           bv. 3 str. 686]
 gi|254706564|ref|ZP_05168392.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           pinnipedialis M163/99/10]
 gi|254710326|ref|ZP_05172137.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           pinnipedialis B2/94]
 gi|254730504|ref|ZP_05189082.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           abortus bv. 4 str. 292]
 gi|256031820|ref|ZP_05445434.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           pinnipedialis M292/94/1]
 gi|256061341|ref|ZP_05451485.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           neotomae 5K33]
 gi|256159999|ref|ZP_05457708.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella ceti
           M490/95/1]
 gi|256255220|ref|ZP_05460756.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella ceti
           B1/94]
 gi|256257722|ref|ZP_05463258.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella
           abortus bv. 9 str. C68]
 gi|256369685|ref|YP_003107195.1| hydrolase, alpha/beta hydrolase fold family [Brucella microti CCM
           4915]
 gi|260168954|ref|ZP_05755765.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           F5/99]
 gi|260546716|ref|ZP_05822455.1| hydrolase [Brucella abortus NCTC 8038]
 gi|260566216|ref|ZP_05836686.1| hydrolase [Brucella suis bv. 4 str. 40]
 gi|260754999|ref|ZP_05867347.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           6 str. 870]
 gi|260758215|ref|ZP_05870563.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           4 str. 292]
 gi|260762042|ref|ZP_05874385.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260884009|ref|ZP_05895623.1| alpha/beta hydrolase [Brucella abortus bv. 9 str. C68]
 gi|261214254|ref|ZP_05928535.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           3 str. Tulya]
 gi|261222417|ref|ZP_05936698.1| alpha/beta hydrolase [Brucella ceti B1/94]
 gi|261314022|ref|ZP_05953219.1| alpha/beta hydrolase fold-containing protein [Brucella
           pinnipedialis M163/99/10]
 gi|261317891|ref|ZP_05957088.1| alpha/beta hydrolase fold-containing protein [Brucella
           pinnipedialis B2/94]
 gi|261325342|ref|ZP_05964539.1| alpha/beta hydrolase [Brucella neotomae 5K33]
 gi|261755224|ref|ZP_05998933.1| alpha/beta hydrolase fold-containing protein [Brucella suis bv. 3
           str. 686]
 gi|261758447|ref|ZP_06002156.1| hydrolase [Brucella sp. F5/99]
 gi|265988919|ref|ZP_06101476.1| alpha/beta hydrolase [Brucella pinnipedialis M292/94/1]
 gi|265998384|ref|ZP_06110941.1| alpha/beta hydrolase [Brucella ceti M490/95/1]
 gi|294852598|ref|ZP_06793271.1| chloride peroxidase [Brucella sp. NVSL 07-0026]
 gi|297248565|ref|ZP_06932283.1| chloride peroxidase [Brucella abortus bv. 5 str. B3196]
 gi|306844166|ref|ZP_07476759.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           BO1]
 gi|23348103|gb|AAN30182.1| hydrolase, alpha/beta hydrolase fold family [Brucella suis 1330]
 gi|62196304|gb|AAX74604.1| hydrolase, alpha/beta hydrolase fold family [Brucella abortus bv. 1
           str. 9-941]
 gi|82616195|emb|CAJ11238.1| Alpha/beta hydrolase fold:Esterase/lipase/thioesterase, active
           site:Prolyl aminopeptidase S33:Alpha/beta hydrolase
           [Brucella melitensis biovar Abortus 2308]
 gi|161336026|gb|ABX62331.1| alpha/beta hydrolase fold [Brucella canis ATCC 23365]
 gi|163674249|gb|ABY38360.1| alpha/beta hydrolase fold [Brucella suis ATCC 23445]
 gi|189019979|gb|ACD72701.1| hydrolase, alpha/beta hydrolase fold family [Brucella abortus S19]
 gi|225617736|gb|EEH14781.1| alpha/beta fold family hydrolase [Brucella ceti str. Cudo]
 gi|237788978|gb|EEP63189.1| alpha/beta fold family hydrolase [Brucella abortus str. 2308 A]
 gi|255999847|gb|ACU48246.1| hydrolase, alpha/beta hydrolase fold family [Brucella microti CCM
           4915]
 gi|260095766|gb|EEW79643.1| hydrolase [Brucella abortus NCTC 8038]
 gi|260155734|gb|EEW90814.1| hydrolase [Brucella suis bv. 4 str. 40]
 gi|260668533|gb|EEX55473.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           4 str. 292]
 gi|260672474|gb|EEX59295.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260675107|gb|EEX61928.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           6 str. 870]
 gi|260873537|gb|EEX80606.1| alpha/beta hydrolase [Brucella abortus bv. 9 str. C68]
 gi|260915861|gb|EEX82722.1| alpha/beta hydrolase fold-containing protein [Brucella abortus bv.
           3 str. Tulya]
 gi|260921001|gb|EEX87654.1| alpha/beta hydrolase [Brucella ceti B1/94]
 gi|261297114|gb|EEY00611.1| alpha/beta hydrolase fold-containing protein [Brucella
           pinnipedialis B2/94]
 gi|261301322|gb|EEY04819.1| alpha/beta hydrolase [Brucella neotomae 5K33]
 gi|261303048|gb|EEY06545.1| alpha/beta hydrolase fold-containing protein [Brucella
           pinnipedialis M163/99/10]
 gi|261738431|gb|EEY26427.1| hydrolase [Brucella sp. F5/99]
 gi|261744977|gb|EEY32903.1| alpha/beta hydrolase fold-containing protein [Brucella suis bv. 3
           str. 686]
 gi|262552852|gb|EEZ08842.1| alpha/beta hydrolase [Brucella ceti M490/95/1]
 gi|264661116|gb|EEZ31377.1| alpha/beta hydrolase [Brucella pinnipedialis M292/94/1]
 gi|294821187|gb|EFG38186.1| chloride peroxidase [Brucella sp. NVSL 07-0026]
 gi|297175734|gb|EFH35081.1| chloride peroxidase [Brucella abortus bv. 5 str. B3196]
 gi|306275441|gb|EFM57178.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           BO1]
          Length = 256

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+   G+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQAGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HLGI+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  EAEDYTPSKMAGDAAALLDHLGIAKAHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  PVL+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AAIERILQPVLVAVGTTDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|182677917|ref|YP_001832063.1| alpha/beta hydrolase fold [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633800|gb|ACB94574.1| alpha/beta hydrolase fold [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 255

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 153/253 (60%), Gaps = 7/253 (2%)

Query: 10  SWRKYQFAFYD----VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL 65
           S R  + AF D    V D+  P ILLIHG AS+   NW+F  W++ L + G RVIAFDN 
Sbjct: 5   SARGVRIAFIDEAPVVADRGEP-ILLIHGFASTHAINWVFPQWVKTLTEAGRRVIAFDNR 63

Query: 66  GHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS 125
           GHG+S+K Y    Y +  M  DA++LL+HLG+ +V VMGYSMGARI   +   +P  VRS
Sbjct: 64  GHGRSEKFYDPAAYHIKEMCGDAIALLDHLGLQQVDVMGYSMGARITAYLAWSHPERVRS 123

Query: 126 VILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCL 185
            IL G+G  L D   +    + ++   PS+D + +P+ + FR FA+    +DLKALA+C+
Sbjct: 124 AILAGLGYHLVDGAGLPL-GIAEAMEAPSLDTLTDPMQRMFRSFAEAT-KSDLKALAACI 181

Query: 186 SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDK 245
              R+   +  L  I  P L+AVG+ DD+AG P +L + +P++  L I  RDH  AVGD 
Sbjct: 182 RGARQTMTEAQLGEIRQPALVAVGTTDDVAGDPHKLAALLPAAHVLPIPGRDHNRAVGDP 241

Query: 246 QFKQGVVNFYANE 258
            +K+GVV F  N 
Sbjct: 242 VYKKGVVEFLLNR 254


>gi|254701999|ref|ZP_05163827.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella suis
           bv. 5 str. 513]
 gi|261752566|ref|ZP_05996275.1| alpha/beta hydrolase fold-containing protein [Brucella suis bv. 5
           str. 513]
 gi|261742319|gb|EEY30245.1| alpha/beta hydrolase fold-containing protein [Brucella suis bv. 5
           str. 513]
          Length = 256

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+   G+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQAGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HLGI+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  EAEDYTPSKMAGDAAALLDHLGIAKAHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  PVL+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AAIERILQPVLVAVGATDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|118593894|ref|ZP_01551252.1| Alpha/beta hydrolase [Stappia aggregata IAM 12614]
 gi|118433515|gb|EAV40184.1| Alpha/beta hydrolase [Stappia aggregata IAM 12614]
          Length = 251

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 149/243 (61%), Gaps = 4/243 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ D G+ D   ILLIHG AS+ Q NW + GW+ LL   G RVI  DN GHG S K Y
Sbjct: 10  RIAYQDQGEGD--PILLIHGFASNKQVNWQYPGWVDLLVGDGRRVITIDNRGHGDSQKFY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MA DA  LL+HL I +  VMGYSMGARI+  + L +P  VR  I  G+G  
Sbjct: 68  DPAAYGAPVMAEDAKRLLDHLNIERADVMGYSMGARISAFLTLNHPDRVRRAIFSGLGYG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  S V D + +  +     I ++ +  G+ FR FA+   G+D +ALA+C+   R+   +
Sbjct: 128 MI-SGVGDPEPIAAALEADRIQDISDRTGRAFRAFAE-QTGSDRRALAACMRSSRQKISE 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +D+ RI+ PVLIAVG++DD+AGSP +L + IP ++ L I  RDH++AVGDK  KQGV+ F
Sbjct: 186 EDVARIERPVLIAVGTKDDIAGSPHKLAALIPHAEVLEIPGRDHMVAVGDKVHKQGVLAF 245

Query: 255 YAN 257
             N
Sbjct: 246 LNN 248


>gi|254717221|ref|ZP_05179032.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella ceti
           M13/05/1]
 gi|261219040|ref|ZP_05933321.1| alpha/beta hydrolase fold-containing protein [Brucella ceti
           M13/05/1]
 gi|260924129|gb|EEX90697.1| alpha/beta hydrolase fold-containing protein [Brucella ceti
           M13/05/1]
          Length = 253

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+   G+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQAGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HLGI+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  EAEDYTPSKMAGDAAALLDHLGIAKAHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  PVL+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AVIERILQPVLVAVGTTDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|254714322|ref|ZP_05176133.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella ceti
           M644/93/1]
 gi|261322100|ref|ZP_05961297.1| alpha/beta hydrolase fold-containing protein [Brucella ceti
           M644/93/1]
 gi|261294790|gb|EEX98286.1| alpha/beta hydrolase fold-containing protein [Brucella ceti
           M644/93/1]
          Length = 255

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+   G+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQAGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HLGI+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  EAEDYTPSKMAGDAAALLDHLGIAKAHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  PVL+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AVIERILQPVLVAVGTTDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|148559037|ref|YP_001259180.1| alpha/beta fold family hydrolase [Brucella ovis ATCC 25840]
 gi|148370294|gb|ABQ60273.1| hydrolase, alpha/beta hydrolase fold family [Brucella ovis ATCC
           25840]
          Length = 256

 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+  VG+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQVGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HL I+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  EAEDYTPSKMAGDAAALLDHLSIAKAHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  PVL+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AAIERILQPVLVAVGTTDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|254719314|ref|ZP_05181125.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           83/13]
 gi|265984315|ref|ZP_06097050.1| alpha/beta hydrolase fold-containing protein [Brucella sp. 83/13]
 gi|306839088|ref|ZP_07471905.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           NF 2653]
 gi|264662907|gb|EEZ33168.1| alpha/beta hydrolase fold-containing protein [Brucella sp. 83/13]
 gi|306405635|gb|EFM61897.1| hydrolase, alpha/beta hydrolase fold family protein [Brucella sp.
           NF 2653]
          Length = 256

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/240 (44%), Positives = 150/240 (62%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+   G+ D   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S KS+
Sbjct: 15  RLAYRQAGEGD--PILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGFSTKSH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY    MA DA +LL+HLGI+K HVMGYSMGARI+  + + +   V S + GG+G  
Sbjct: 73  EAEDYTPSKMAGDAAALLDHLGIAKAHVMGYSMGARISAVLAIEHSERVHSAVFGGLGIG 132

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  +   DW+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++    
Sbjct: 133 MV-TGAGDWEPIGEALLAEDPATITHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPV 190

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             + RI  P L+AVG+ DD+AGS QEL + +P+ + L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 191 AAIERILQPALVAVGTTDDIAGSAQELANLLPNGEALDIPGRDHMLAVGDKVYKQGVLKF 250


>gi|254470220|ref|ZP_05083624.1| hypothetical protein PJE062_4765 [Pseudovibrio sp. JE062]
 gi|211960531|gb|EEA95727.1| hypothetical protein PJE062_4765 [Pseudovibrio sp. JE062]
          Length = 250

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 147/239 (61%), Gaps = 4/239 (1%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
            A+ D G+ D   ILLIHG AS+   NW++ GW+ LL   G RVIA DN GHG+S K Y 
Sbjct: 11  IAYLDEGEGDP--ILLIHGFASNKFVNWVYPGWVDLLVKDGRRVIAIDNRGHGESYKYYN 68

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
             DY    MA DA+ LL+HL I K  ++GYSMG RI+    L  P  VRS+ LGG+G  L
Sbjct: 69  GEDYGAPVMAEDALKLLDHLYIDKADLLGYSMGTRISAFCALQAPDRVRSLTLGGMGYGL 128

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
             S V + + +I+  L   I +V++  G+ FR FA+    +D +ALA+C+   RKP  +D
Sbjct: 129 I-SGVGNPEPIIEGLLADKISDVKDRTGRAFRAFAE-QTKSDRRALAACMQSARKPISED 186

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            +  I  P L+AVG+ DD+AG P+ L   +P++ YL I  RDH+ AVGDK FK+G + F
Sbjct: 187 MVSTITAPTLVAVGTNDDVAGDPKALADLMPNASYLEITNRDHMTAVGDKIFKKGTLEF 245


>gi|170744962|ref|YP_001773617.1| alpha/beta hydrolase fold [Methylobacterium sp. 4-46]
 gi|168199236|gb|ACA21183.1| alpha/beta hydrolase fold [Methylobacterium sp. 4-46]
          Length = 254

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 146/229 (63%), Gaps = 2/229 (0%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LLIHG AS+ +TNW+ +GW++ L + G+RVIA DN GHG+S K Y    Y    MA DA
Sbjct: 26  VLLIHGFASNHRTNWVNTGWVRTLTEAGYRVIALDNRGHGESGKLYEPEAYASELMAEDA 85

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
             LL+HLG+ +  VMGYSMGARI   + L +P  VRS +LGG+G  L +   +    + +
Sbjct: 86  RRLLDHLGLGRADVMGYSMGARITAFLALLHPDRVRSALLGGLGIHLVEGRGLP-SGISE 144

Query: 149 SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
           +   PS  +V +P+ + FR FA+    +DL+ALA+C+   R+   + ++ +I+VP L++V
Sbjct: 145 AMEAPSSADVTDPVARSFRIFAE-QTRSDLRALAACMRGSRQTLSRAEVAQIEVPTLVSV 203

Query: 209 GSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
           G+ D +AGS   L + IP ++ L I  RDH LAVGDK  KQGV+ F A 
Sbjct: 204 GTTDHIAGSGPALAALIPEARSLEIPNRDHNLAVGDKVHKQGVLGFLAE 252


>gi|148256544|ref|YP_001241129.1| putative hydrolase [Bradyrhizobium sp. BTAi1]
 gi|146408717|gb|ABQ37223.1| putative hydrolase [Bradyrhizobium sp. BTAi1]
          Length = 249

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/240 (42%), Positives = 148/240 (61%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + AF D G+ D   I+L+HG AS+   NW++  W+  L   G RVIA DN GHG S K Y
Sbjct: 10  EIAFIDEGEGD--PIVLVHGFASTKNVNWVYPAWVSELRKDGRRVIALDNRGHGDSAKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  MA+D  +L++HLG++   VMGYS+G RIA  + L  P  +RS I GG+G  
Sbjct: 68  DPASYAIAEMASDVTALMDHLGLASADVMGYSLGGRIAAHIALARPERLRSAIFGGIGMA 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + +      +++  +   PSIDEV +P+G+ FR FAD    +D  ALA+C+   R    +
Sbjct: 128 MIEGG-GPGENVAAALEAPSIDEVTDPVGRTFRAFAD-QTRSDRLALAACMRGSRGLISR 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           + + RI VPVL+AVG+ D++AGS   L + IP ++ L+I  RDH+ AVGDK +K GV++F
Sbjct: 186 EQVGRIAVPVLVAVGTADEVAGSGPALGALIPGAEVLDIPNRDHMRAVGDKVYKAGVIDF 245


>gi|154247137|ref|YP_001418095.1| alpha/beta hydrolase fold [Xanthobacter autotrophicus Py2]
 gi|154161222|gb|ABS68438.1| alpha/beta hydrolase fold [Xanthobacter autotrophicus Py2]
          Length = 250

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/239 (43%), Positives = 150/239 (62%), Gaps = 4/239 (1%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
            A++D+G  D   +LLIHG ASS + NW+   W + L + G+R I FD+ GHG S+K Y 
Sbjct: 11  IAYFDIGAGD--PVLLIHGFASSKEINWVGPSWTKTLTEAGYRAIGFDHRGHGLSEKLYD 68

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              Y    MA DA  LL HLG+ +  V+GYSMGAR+   M L +P  VRS+ILGG+G  L
Sbjct: 69  PALYDTRIMAEDAQRLLAHLGLERADVVGYSMGARVGAQMALHFPQAVRSLILGGLGIHL 128

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
            D  V   Q++ D+   PS+++V +P+G+ FR FAD +   DLKALA+C+   R+   ++
Sbjct: 129 VDG-VGLPQTVADALEAPSLEDVADPMGRMFRAFADANKA-DLKALAACIRGSRQVLTRE 186

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           ++ RI  PVL+A+G++D ++G  Q L+  +P    L+I  RDH  AVGDK FK G + F
Sbjct: 187 EVGRIFQPVLVAIGTRDLVSGPGQPLVDLLPDGTMLDIPNRDHNPAVGDKVFKAGALEF 245


>gi|217976272|ref|YP_002360419.1| alpha/beta hydrolase fold protein [Methylocella silvestris BL2]
 gi|217501648|gb|ACK49057.1| alpha/beta hydrolase fold protein [Methylocella silvestris BL2]
          Length = 255

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 147/246 (59%), Gaps = 5/246 (2%)

Query: 15  QFAFYD---VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           + AF D   VG      I+LIHG AS+   NW F  W++ L + G RV+AFDN GHG+S 
Sbjct: 10  RLAFVDEPPVGHDRNEPIILIHGFASNHAVNWFFPQWVKTLTEDGRRVVAFDNRGHGRSQ 69

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
           K Y   DY +  MA D   LL+HLGI    +MGYSMGARIA      +P   RS+ILGG+
Sbjct: 70  KFYSPEDYAVPKMAEDCRRLLDHLGIETADIMGYSMGARIAAFFAKAHPERARSIILGGL 129

Query: 132 GSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP 191
           G  L D   +    + D+   PS++++  P  + FR FA+    +DLKA+A+C+   R+ 
Sbjct: 130 GHHLIDGAGLPL-GIADAMEAPSVNDLMTPNQRLFRNFAEATK-SDLKAMAACIRGARQL 187

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGV 251
             + +  +I  PVL+A GS+DD+AG P++L +  P+ Q L+I  RDH  AVGD  FK+GV
Sbjct: 188 ISEAEARQIKTPVLVATGSEDDVAGDPKQLAAIFPNGQALDIKGRDHNRAVGDPIFKKGV 247

Query: 252 VNFYAN 257
           + F A 
Sbjct: 248 LAFLAE 253


>gi|115524320|ref|YP_781231.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisA53]
 gi|115518267|gb|ABJ06251.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisA53]
          Length = 254

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 152/246 (61%), Gaps = 4/246 (1%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           + + A+ D G+ +   I+L+HG AS+   NW++  W+  L   G RVIAFD+ GHG S K
Sbjct: 12  RVEIAYLDEGEGE--PIVLVHGFASNKDVNWVYPTWVSELKKHGRRVIAFDHRGHGASSK 69

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
            Y   DY L  +A D  +L++HLGI +  VMGYSMGAR+   +    P  +RS ILGG+G
Sbjct: 70  LYDPEDYHLGTLAGDLRALMDHLGIERADVMGYSMGARVTAYLARSQPQRLRSAILGGLG 129

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF 192
             L        ++++ +   PS+ +V + +G+ FR FAD    +D  ALA+CL   R+  
Sbjct: 130 IGLVQGG-GPGENVVKALQAPSLADVPDRMGRTFRAFAD-QTRSDRAALAACLRGSRQLM 187

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVV 252
             D+   I VPVLIAVG+ D++AGS Q L + IP S+ L+I RRDH+ AVGDK +K+GV+
Sbjct: 188 SADEAAGIAVPVLIAVGTTDEIAGSAQALQAIIPGSKVLDIPRRDHMRAVGDKVYKEGVL 247

Query: 253 NFYANE 258
           +F A+ 
Sbjct: 248 SFLASR 253


>gi|188579713|ref|YP_001923158.1| alpha/beta hydrolase fold [Methylobacterium populi BJ001]
 gi|179343211|gb|ACB78623.1| alpha/beta hydrolase fold [Methylobacterium populi BJ001]
          Length = 257

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/245 (43%), Positives = 146/245 (59%), Gaps = 7/245 (2%)

Query: 15  QFAFYDVGDKDAPT-----ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           Q A+ DV  K+        ILLIHG AS+   NW+ + W++ L + G+R IA DN GHG+
Sbjct: 10  QIAYIDVPAKEGAAGGGDPILLIHGFASNHAVNWVNTLWVRYLTEAGYRTIALDNRGHGQ 69

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           S+K Y    Y    MA DAV LL+HLGI +  VMGYSMGARIA  M L YP+ VRS++LG
Sbjct: 70  SEKLYEPTAYTSDRMAGDAVRLLQHLGIERADVMGYSMGARIAAHMALDYPNEVRSLLLG 129

Query: 130 GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIR 189
           G+G  L D   +  Q + ++   P      NP    FR FA+    +DL+ALA+C+   R
Sbjct: 130 GMGFHLVDGHGLP-QGIAEALEAPPGTPAPNPTAATFRIFAE-QTKSDLRALAACIRCSR 187

Query: 190 KPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQ 249
           +   + +L  ID P L+ VGS D +AGS  EL   +P+++ L +  RDH  AVGD+  +Q
Sbjct: 188 QTLSRAELSAIDTPTLVTVGSLDTVAGSGPELAKLMPNARALELPNRDHSTAVGDRLHRQ 247

Query: 250 GVVNF 254
           GV+ F
Sbjct: 248 GVLEF 252


>gi|75676363|ref|YP_318784.1| alpha/beta hydrolase fold [Nitrobacter winogradskyi Nb-255]
 gi|74421233|gb|ABA05432.1| alpha/beta hydrolase fold protein [Nitrobacter winogradskyi Nb-255]
          Length = 250

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 103/242 (42%), Positives = 148/242 (61%), Gaps = 4/242 (1%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           + + ++ D G+ D   ++L+HG ASS   NW++  W+  L   GFRVIA DN GHG S K
Sbjct: 8   EVEVSYLDEGEGD--PVVLVHGFASSKNVNWVYPTWVSELRKNGFRVIALDNRGHGDSTK 65

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
            Y   DY +  MA+D  +L++HLG+++  VMGYS+GARI   +    P  VRS I GG+G
Sbjct: 66  LYDPEDYHIGTMASDVTALMDHLGVARADVMGYSLGARIMGILAHTRPERVRSGIFGGLG 125

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF 192
             L +      +S+  +    S+D+V +P G+ FR FAD    +D +ALA+CL   R+  
Sbjct: 126 VGLIEGG-GPGESVARALEAASLDDVADPFGRTFRAFAD-QTRSDRRALAACLRGSRRLM 183

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVV 252
            + +   I VP LIAVGS+D++AGS Q L   IP ++ L+I  RDH+ AVGDK +K GV+
Sbjct: 184 TEAEAASISVPTLIAVGSKDEIAGSAQALAKIIPGAEVLDIPNRDHMRAVGDKVYKDGVL 243

Query: 253 NF 254
            F
Sbjct: 244 KF 245


>gi|300021600|ref|YP_003754211.1| alpha/beta hydrolase fold protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523421|gb|ADJ21890.1| alpha/beta hydrolase fold protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 270

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 137/231 (59%), Gaps = 2/231 (0%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P +LLIHG AS+V+TNW  +GW+  L   G+RV+AFDN GHG S K +   DY    M
Sbjct: 27  EKPPVLLIHGFASNVETNWGGTGWVDFLRKAGYRVVAFDNRGHGHSQKLHELTDYGAPLM 86

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ 144
           A DA  LL+HLGI + HV+GYSMGARIA  + L +P  V  V+ GG+G  +    +    
Sbjct: 87  AEDAKRLLDHLGIKRAHVIGYSMGARIAAFLALAHPERVDHVVFGGLGINMVRG-MAGTG 145

Query: 145 SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPV 204
            +  +    SID+V NP  + FR FA+    +DLKALA+C+   R P   +    I  PV
Sbjct: 146 PIARALEAESIDDVTNPTARTFRAFAE-QTKSDLKALAACIRSARAPITAEMAASISAPV 204

Query: 205 LIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFY 255
           L+AVG  D + GS  EL   IP ++ + +  +DH  AVGD+ FK  V+ F+
Sbjct: 205 LVAVGETDVIGGSAAELAKLIPGARAITMPGKDHNRAVGDRTFKAEVLAFF 255


>gi|328543245|ref|YP_004303354.1| Hydrolase or acyltransferase [Polymorphum gilvum SL003B-26A1]
 gi|326412991|gb|ADZ70054.1| Hydrolase or acyltransferase [Polymorphum gilvum SL003B-26A1]
          Length = 250

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 146/240 (60%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ D G+  AP ILLIHG AS+   NW + GW++LL   G RVIA DN GHG+S K Y
Sbjct: 10  EIAYLDEGEG-AP-ILLIHGFASNKMVNWAYPGWVELLKKSGRRVIALDNRGHGESGKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MA DA  LL+HL I +  VMGYSMGARI   + L +P  V   I GG+G  
Sbjct: 68  DPAAYGAPAMAEDARRLLDHLDIGQADVMGYSMGARITAFLTLNHPDRVGRAIFGGLGYG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           +  + V D + +       S+ +V +  G+ FR FAD    +D +ALA+C+   R+   +
Sbjct: 128 MI-TGVGDPEPIARGLEAASLQDVTDRTGRAFRAFADQTK-SDRRALAACIRSSRQKITE 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +D+ RI  PVL+AVG+ DD+AGSP  L   I  ++ L+I  RDH+LAVGDK +KQGV+ F
Sbjct: 186 EDVSRIRRPVLVAVGTNDDIAGSPDALADLIEGAKVLDITGRDHMLAVGDKIYKQGVLEF 245


>gi|90424637|ref|YP_533007.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB18]
 gi|90106651|gb|ABD88688.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB18]
          Length = 250

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 147/242 (60%), Gaps = 4/242 (1%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           + + A+ D G+ D   I+L+HG AS+   NW +  W+  L   G RV+AFDN GHG+S K
Sbjct: 8   RVEIAYLDEGEGD--PIILVHGFASNKNVNWAYPSWVSELQKSGRRVVAFDNRGHGESSK 65

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
            Y   DY +  MA D  +L++HL  ++  VMGYSMGARI   +    P  VRS I GG+G
Sbjct: 66  LYDPEDYHIGTMAGDLRALMDHLQFARADVMGYSMGARITAYLARSQPERVRSAIFGGLG 125

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF 192
             L        ++++ +   PS+D+V +P+G+ FR FA+    +D  ALA+CL   R+  
Sbjct: 126 IGLVQGG-GPGENVVAALQAPSLDDVTDPVGRTFRAFAE-QTRSDRAALAACLRGSRRLM 183

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVV 252
             ++   I VPVLIAVG+ DD+AGS + L   I  S+ L+I RRDH+ AVGD+ +K GV+
Sbjct: 184 SVEEAGGIAVPVLIAVGTTDDIAGSARALQEIIAGSEVLDIPRRDHMRAVGDRVYKDGVL 243

Query: 253 NF 254
           +F
Sbjct: 244 DF 245


>gi|307945521|ref|ZP_07660857.1| alpha/beta hydrolase fold protein [Roseibium sp. TrichSKD4]
 gi|307771394|gb|EFO30619.1| alpha/beta hydrolase fold protein [Roseibium sp. TrichSKD4]
          Length = 249

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 154/245 (62%), Gaps = 4/245 (1%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           S+     A+ D G+ +   ILLIHG AS+ Q NW++ GW+  L   G RVIA DN GHG+
Sbjct: 5   SYDGIDLAYLDEGEGE--PILLIHGFASNKQVNWVYPGWVDTLVKSGRRVIAIDNRGHGE 62

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           S K +  + Y    MA DA  L++HLG+ +V VMGYSMGARI+  + L +P  VR VI G
Sbjct: 63  SIKFHDPDAYGAPMMAEDAYELIKHLGLDQVDVMGYSMGARISAFLALKHPEKVRRVIFG 122

Query: 130 GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIR 189
           G+G  +  S + D + +  +     I ++ +  G+ FR FA+   G+D  ALA+C+   R
Sbjct: 123 GLGYGMI-SGIGDPEPIAGALETDRIQDISDRTGRAFRAFAE-QTGSDRLALAACMRSSR 180

Query: 190 KPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQ 249
           +   ++++  I VP L+AVG++DD+AGS Q+L   + ++  L+I  RDH++AVGDK +KQ
Sbjct: 181 QKISEEEVSGIAVPALVAVGTKDDIAGSAQQLADLMLNADVLDIPGRDHMVAVGDKVYKQ 240

Query: 250 GVVNF 254
           GV++F
Sbjct: 241 GVLDF 245


>gi|299135323|ref|ZP_07028514.1| alpha/beta hydrolase fold protein [Afipia sp. 1NLS2]
 gi|298590300|gb|EFI50504.1| alpha/beta hydrolase fold protein [Afipia sp. 1NLS2]
          Length = 250

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 151/244 (61%), Gaps = 4/244 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + AF D G+ +   I+L+HG  S+  TNW++ GW+  L   G RV+A DN GHG S K Y
Sbjct: 10  EIAFIDEGEGE--PIVLVHGFGSTAGTNWVYPGWVSALTKAGRRVVALDNRGHGASSKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              +Y L  MA D  +L++HL I +  +MGYS+G+RI+C + L +P  +RS+I+GG+G  
Sbjct: 68  DRAEYSLDIMAGDVRALMDHLNIERADIMGYSLGSRISCRVALHHPERLRSLIIGGLGYG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           L +      + +  +   PS+++V +P+G+ FR FAD    +D +AL +CL   R+    
Sbjct: 128 LIEGG-GPGEDVAVALEAPSLEDVTDPMGRMFRAFAD-QTRSDRRALVACLRGSRQWLTP 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +    I +P LIAVG++DD+ GS ++L   +  ++ L+I  RDH+ AVGD+ +K+GV+ F
Sbjct: 186 EQAASIKLPTLIAVGTKDDVGGSAEKLHQIMTHAEVLDIPDRDHMRAVGDRVYKEGVLAF 245

Query: 255 YANE 258
            A +
Sbjct: 246 LARQ 249


>gi|114707136|ref|ZP_01440034.1| probable hydrolase protein [Fulvimarina pelagi HTCC2506]
 gi|114537332|gb|EAU40458.1| probable hydrolase protein [Fulvimarina pelagi HTCC2506]
          Length = 250

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 143/237 (60%), Gaps = 2/237 (0%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + D G      +LL+HG ASS++ NW+  GWI+ L   G+R IAFD+ GHG SDK   E 
Sbjct: 13  YIDEGPVSGQAVLLVHGFASSIKFNWIDPGWIETLTGAGYRTIAFDHRGHGASDKPTDEA 72

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y    MA DA  LL+HL +      GYSMGAR+     L  P  +  +ILGG+G  L  
Sbjct: 73  AYTPTKMAEDAFGLLDHLDVKSTVFFGYSMGARVCAFAALARPETIDKLILGGLGYGLV- 131

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDL 197
           S V DW  +  +   PSID+V +P G+ FR FAD    +D +ALA+C++  R+   ++D+
Sbjct: 132 SGVGDWDPIAKALRAPSIDDVDDPRGQMFRAFADRTK-SDREALAACIAHSRQELTEEDV 190

Query: 198 YRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            RI+   LI VGS+D++AGSP  L + +P +Q L I  RDH+LAVGDK FK  V+ F
Sbjct: 191 GRIEAQTLIGVGSKDEIAGSPDRLAALMPKAQALTIPNRDHMLAVGDKAFKSAVLEF 247


>gi|92118094|ref|YP_577823.1| alpha/beta hydrolase fold [Nitrobacter hamburgensis X14]
 gi|91800988|gb|ABE63363.1| alpha/beta hydrolase fold protein [Nitrobacter hamburgensis X14]
          Length = 250

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 147/240 (61%), Gaps = 4/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ D G+ D   ++L+HG ASS   NW++  W+  L   GFRVIAFDN GHG S K Y
Sbjct: 10  EIAYLDEGEGD--PVVLVHGFASSKNVNWVYPTWVSELRKNGFRVIAFDNRGHGDSSKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              DY +  MA+D  +L++HL I++  VMGYS+GAR+   +    P  VRS I  G   +
Sbjct: 68  DPEDYHIGTMASDISALMDHLAIARADVMGYSLGARMTGILAQTRPERVRSGIF-GGLGI 126

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
                    +S+  +   PS+D+V +P G+ FR FAD    +D +ALA+CL   R+   +
Sbjct: 127 GLIKGGGPGESVARALEAPSLDDVTDPFGRTFRAFAD-QTRSDRRALAACLRGSRRLMTE 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            ++  I VP LIAVG++D++AGS Q L + IP ++ L+I  RDH+ AVGDK +K+GV+ F
Sbjct: 186 AEVASIKVPTLIAVGTKDEIAGSAQALANIIPGAEVLDIPNRDHMRAVGDKVYKEGVLKF 245


>gi|85715628|ref|ZP_01046608.1| alpha/beta hydrolase fold protein [Nitrobacter sp. Nb-311A]
 gi|85697567|gb|EAQ35444.1| alpha/beta hydrolase fold protein [Nitrobacter sp. Nb-311A]
          Length = 250

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/242 (41%), Positives = 146/242 (60%), Gaps = 4/242 (1%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           + + A+ D G+ D   ++L+HG ASS   NW++  W+  L   GFR IAFDN GHG S K
Sbjct: 8   EVEIAYLDEGEGD--PVVLVHGFASSKNVNWVYPTWVSELRKNGFRTIAFDNRGHGDSSK 65

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
            Y   DY +  MA D  +L++HLGI++  VMGYS+GAR+   +    P  VRS I  G  
Sbjct: 66  LYDPEDYHIGTMANDITALMDHLGIARADVMGYSLGARMMGILARTRPERVRSGIF-GGL 124

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF 192
            +         +S+  +   PS+D+V +P G+ FR FAD    +D +ALA+CL   R+  
Sbjct: 125 GIGLIKGGGPGESVARALEAPSLDDVTDPFGRTFRAFAD-QTRSDRRALAACLRGSRRLM 183

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVV 252
            + ++  I VP LIAVG++D++AGS Q L   IP ++ L+I  RDH+ AVGDK +K+GV+
Sbjct: 184 TESEVAGIKVPTLIAVGTKDEIAGSAQALADVIPGAEVLDIPNRDHMRAVGDKVYKEGVL 243

Query: 253 NF 254
            F
Sbjct: 244 RF 245


>gi|220927393|ref|YP_002502695.1| alpha/beta hydrolase fold protein [Methylobacterium nodulans ORS
           2060]
 gi|219952000|gb|ACL62392.1| alpha/beta hydrolase fold protein [Methylobacterium nodulans ORS
           2060]
          Length = 254

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 145/229 (63%), Gaps = 2/229 (0%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LLIHG AS+ +TNW+ + W++ L + G+RVIA D  GHG+S K Y    Y    MA D 
Sbjct: 26  VLLIHGFASNHKTNWVNTFWVRTLTEAGYRVIALDVRGHGESAKLYDPEAYASELMAEDV 85

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
             LL+HLG+ +  VMGYSMGARI   + L +P  VRS +LGG+G  L +   +    + +
Sbjct: 86  GRLLDHLGLPRADVMGYSMGARITAFLALMHPERVRSALLGGLGIHLVEGRGLP-SGIPE 144

Query: 149 SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
           +   PS  EV +P+ + FR FA+    +DL+ALA+C+   R+   + ++ +I+VP L++V
Sbjct: 145 AMEAPSSAEVTDPVARSFRIFAE-QTRSDLRALAACMRGSRQTLSRGEVAQIEVPTLVSV 203

Query: 209 GSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
           G+ D +AGS   L + IP+++ L+I  RDH LAVGDK  KQGV+ F A 
Sbjct: 204 GTTDHIAGSGPALAALIPNARSLDIPNRDHNLAVGDKVHKQGVLAFLAE 252


>gi|27380699|ref|NP_772228.1| hypothetical protein bll5588 [Bradyrhizobium japonicum USDA 110]
 gi|27353864|dbj|BAC50853.1| bll5588 [Bradyrhizobium japonicum USDA 110]
          Length = 291

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 147/240 (61%), Gaps = 3/240 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ D G+ D   I+L+HG ASS   NW++  W+  L   G RVIA DN GHG+S K Y
Sbjct: 50  EIAYLDEGEGD--PIILVHGFASSKNVNWVYPTWVSELRKNGRRVIALDNRGHGESAKLY 107

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  MA D ++L++HL I +  +MGYSMG R+   + L  P  +RS ILGG+G  
Sbjct: 108 EPAQYSIPTMAGDVLALMDHLAIPQADIMGYSMGGRMTAWLSLNEPQRLRSAILGGIGIG 167

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
                    +++  +   P++D+V +P+G+ FR FAD    +D +ALA+CL   R    +
Sbjct: 168 GLIEGTGPGENVAKALEAPALDDVSDPVGRTFRAFAD-QTRSDRRALAACLRGTRDLMTR 226

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            +  RIDVPVLIAVGS DD+AGS   L + IP S+ L+I  RDH+ AVGDK +K GV++F
Sbjct: 227 GEAARIDVPVLIAVGSTDDVAGSASALGAIIPGSEVLDIPGRDHMRAVGDKVYKTGVLDF 286


>gi|254501328|ref|ZP_05113479.1| hydrolase, alpha/beta fold family, putative [Labrenzia alexandrii
           DFL-11]
 gi|222437399|gb|EEE44078.1| hydrolase, alpha/beta fold family, putative [Labrenzia alexandrii
           DFL-11]
          Length = 251

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 146/243 (60%), Gaps = 4/243 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q A+ D G+ D   ILLIHG AS+   NW  +GW+ L   +G RVIA DN GHG S K +
Sbjct: 10  QIAYLDEGEGD--PILLIHGFASNKAVNWQNTGWVDLFVKEGRRVIALDNRGHGDSQKFH 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y    MA DA  LL+HLGI +  V+GYSMGARI+  + L +P  V+  I  G+G  
Sbjct: 68  DPEAYGAPIMAEDARKLLDHLGIEQTDVIGYSMGARISAFLTLSHPQRVKRAIFSGLGYG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           + +  V D + +  +     + +V +  G+ FR FA+    + L ALA+C+   R+   +
Sbjct: 128 MIEG-VGDPEPIAAALEADRLQDVTDRTGRAFRAFAEQTKSDRL-ALAACMRSSRQKISE 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +D+ RI+ PVL+AVG++DD+AGSP +L + +  +  L I  RDH++AVGDK  KQGV+ F
Sbjct: 186 EDIARIERPVLVAVGTRDDIAGSPHKLAALMQHADVLEIPGRDHMVAVGDKVHKQGVLAF 245

Query: 255 YAN 257
             N
Sbjct: 246 LNN 248


>gi|316933308|ref|YP_004108290.1| alpha/beta hydrolase fold protein [Rhodopseudomonas palustris DX-1]
 gi|315601022|gb|ADU43557.1| alpha/beta hydrolase fold protein [Rhodopseudomonas palustris DX-1]
          Length = 250

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/236 (43%), Positives = 145/236 (61%), Gaps = 2/236 (0%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D +   ILLIHG AS+   NW++  W+  L   G RVIA DN GHG+S K Y   DY L 
Sbjct: 16  DGEGEPILLIHGFASNKNVNWVYPSWLSELKRAGRRVIAIDNRGHGESTKLYDPADYTLA 75

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD 142
            MA DA++LL+HL + +  VMGYSMG RI  ++   +P  VRS IL G   +        
Sbjct: 76  AMAGDALALLDHLELPRTDVMGYSMGGRITATLAREHPDRVRSAIL-GGLGLGLIEGGGP 134

Query: 143 WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDV 202
            +++  +    S+D+V +P+G+ FR FAD    +D +ALA+C+   R+   +D   +I V
Sbjct: 135 GENVAAALEAESLDDVVDPMGRTFRVFAD-QTRSDRRALAACMRGSRRLMTRDQAAQIAV 193

Query: 203 PVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYANE 258
           PVLIAVG+ DD+AGS   L + IP ++ L+I RRDH+ AVGD+ +K+GVV+F A  
Sbjct: 194 PVLIAVGTTDDVAGSAHALGAIIPGAEVLDIPRRDHMRAVGDRVYKEGVVDFLARR 249


>gi|239832150|ref|ZP_04680479.1| hydrolase, alpha/beta hydrolase fold family protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239824417|gb|EEQ95985.1| hydrolase, alpha/beta hydrolase fold family protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 300

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 146/232 (62%), Gaps = 2/232 (0%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D +   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S K +  ++Y   
Sbjct: 65  DGEGDPILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGLSAKPHDADEYTPT 124

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD 142
            MAADA +LL+HLGI K HVMGYSMGARI+  + L +P  V S + GG+G  +  +   D
Sbjct: 125 KMAADAAALLDHLGIEKAHVMGYSMGARISAFLALEHPERVHSAVFGGLGIGMV-TGAGD 183

Query: 143 WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDV 202
           W+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++      + RI  
Sbjct: 184 WEPIGEALLAEDPTTIMHPRGQMFRKFAD-QTRSDRIALAACVITSKELVPAAAIARIMQ 242

Query: 203 PVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           P+L+AVG+ DD+AGS QEL   +P+ Q ++I  RDH+LAVGDK +KQ V+ F
Sbjct: 243 PILVAVGTTDDIAGSAQELADLLPNGQAVDIPGRDHMLAVGDKVYKQAVLGF 294


>gi|298292004|ref|YP_003693943.1| alpha/beta hydrolase fold protein [Starkeya novella DSM 506]
 gi|296928515|gb|ADH89324.1| alpha/beta hydrolase fold protein [Starkeya novella DSM 506]
          Length = 250

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 144/239 (60%), Gaps = 4/239 (1%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           FA+ D G+ +   I+L+HG  S+ + NW+   W+  L   G R+IA DN GHG S K Y 
Sbjct: 11  FAYLDEGEGE--PIILVHGFGSTKEINWVGPSWVTTLTRAGRRLIALDNRGHGASAKLYQ 68

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              Y    MA D + L++HL + +  VMGYSMG RI     L  P  VRS+ILGG+G  L
Sbjct: 69  AELYDPWLMARDVIGLMDHLHLPRADVMGYSMGGRIGACAALEAPERVRSLILGGIGIHL 128

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
            +   +   ++ D+   PS+ +V +P G+ FR FAD    +D +ALA+C+   R+   +D
Sbjct: 129 VEGAGLPL-TIADALRAPSLADVTDPTGRMFRAFAD-QTKSDREALAACIVGSRRTLSRD 186

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           ++ RI VP LIAVG++D +AG+ + L   I  ++ ++I  RDH+LAVGDK FK+ V+ F
Sbjct: 187 EVRRIAVPTLIAVGTRDPIAGAARPLAELIQGAKAVDIPDRDHMLAVGDKVFKEAVLAF 245


>gi|323137536|ref|ZP_08072613.1| alpha/beta hydrolase fold protein [Methylocystis sp. ATCC 49242]
 gi|322397162|gb|EFX99686.1| alpha/beta hydrolase fold protein [Methylocystis sp. ATCC 49242]
          Length = 255

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/232 (43%), Positives = 141/232 (60%), Gaps = 3/232 (1%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D+  P I+LIHG AS+   NW+F+ W++ L + G RVIAFDN GHG+S K Y    Y L 
Sbjct: 22  DRREP-IVLIHGFASTHAVNWMFTQWVKTLTEDGRRVIAFDNRGHGRSQKLYDPAQYSLD 80

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD 142
            MA D ++LL+HL I +  VMGYS+GARIA  M L +P  VR ++LGG+G  L + D   
Sbjct: 81  IMAQDVINLLDHLAIERADVMGYSLGARIATVMSLAHPERVRGLVLGGIGQYLVE-DAGL 139

Query: 143 WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDV 202
              L ++     I+++ N + K FR FA+    +DL ALA+C+   RK      L RI+ 
Sbjct: 140 PGGLAEAMEAERIEDIDNSMLKIFRGFAE-STRSDLAALAACVRGARKAIEPSLLARIES 198

Query: 203 PVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           PVLI VG++DD+AG P  L     + +  +I  RDH  AVGD+ +KQ V+ F
Sbjct: 199 PVLICVGTRDDVAGDPAPLQPLFRNVRIFDIPGRDHNRAVGDRLYKQAVLEF 250


>gi|209884656|ref|YP_002288513.1| alpha/beta hydrolase fold protein [Oligotropha carboxidovorans OM5]
 gi|209872852|gb|ACI92648.1| alpha/beta hydrolase fold protein [Oligotropha carboxidovorans OM5]
          Length = 250

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 146/244 (59%), Gaps = 4/244 (1%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ D G+ +   I L+HG  SS   NW++ GW+  L   G RV+A DN GHG S K Y
Sbjct: 10  EIAYIDEGEGN--PIFLVHGFGSSAGVNWVYPGWVSALTKAGRRVVALDNRGHGASSKLY 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y L  MA+D  +L++HL I    +MGYS+G+RIA  + L +P  +R++I+GG+G  
Sbjct: 68  DRAQYSLEIMASDVRALMDHLDIPHADIMGYSLGSRIASVLALHHPERLRTLIIGGLGYG 127

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ 194
           L +      + +  +   PS+++V +P+G+ FR FA+    +D +AL +CL   R+    
Sbjct: 128 LIEGG-GPGEDVAVALEAPSLEDVTDPMGRMFRAFAE-QTRSDRRALVACLRGSRQWLTP 185

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           + +  I  P LIAVG+ DD++GSPQ L   +  ++ L+I  RDH+ AVGD+ +K+GV+ F
Sbjct: 186 EQVASIKTPALIAVGTNDDVSGSPQRLHEVMRGAEMLDIPGRDHMRAVGDRVYKEGVLAF 245

Query: 255 YANE 258
            A  
Sbjct: 246 LARH 249


>gi|153009255|ref|YP_001370470.1| alpha/beta hydrolase fold protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561143|gb|ABS14641.1| alpha/beta hydrolase fold [Ochrobactrum anthropi ATCC 49188]
          Length = 256

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/232 (44%), Positives = 144/232 (62%), Gaps = 2/232 (0%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D +   ILLIHG ASS   NW+  GW + L + G+RVIA DN GHG S K +  ++Y   
Sbjct: 21  DGEGDPILLIHGFASSSLVNWVSPGWFRTLTEAGYRVIAIDNRGHGLSAKPHDADEYTPT 80

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD 142
            MAADA +LL+HLGI K HVMGYSMGARI   + + +   V S + GG+G  +  +   D
Sbjct: 81  KMAADAAALLDHLGIEKAHVMGYSMGARITAFLAIEHAERVHSAVFGGLGIGMV-TGAGD 139

Query: 143 WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDV 202
           W+ + ++ L      + +P G+ FRKFAD    +D  ALA+C+   ++      + RI  
Sbjct: 140 WEPIGEALLAEDPTTITHPRGQMFRKFAD-QTKSDRIALAACVITSKELVPAAAIARIMQ 198

Query: 203 PVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           PVL+AVG+ DD+AGS QEL   +P+ Q ++I  RDH+LAVGDK +KQ V+ F
Sbjct: 199 PVLVAVGTTDDIAGSAQELADLLPNGQAVDIPDRDHMLAVGDKVYKQAVLQF 250


>gi|254559059|ref|YP_003066154.1| alpha/beta hydrolase [Methylobacterium extorquens DM4]
 gi|254266337|emb|CAX22101.1| putative alpha/beta hydrolase [Methylobacterium extorquens DM4]
          Length = 258

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 151/246 (61%), Gaps = 8/246 (3%)

Query: 15  QFAFYDVGDKDAPT------ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           Q A+ DV  K+  +      ILLIHG AS+   NW+ + W++ L + G+RVIA DN GHG
Sbjct: 10  QIAYIDVPPKEGASGGSGDPILLIHGFASNHAVNWVNTLWVRTLTEAGYRVIAHDNRGHG 69

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +S+K Y    Y    MA DAV LL HLGI +  VMGYSMGARIA  M L YP+ VRS+++
Sbjct: 70  QSEKLYDPASYTSDQMAGDAVRLLRHLGIERADVMGYSMGARIAAHMALDYPAEVRSLLI 129

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI 188
           GG+G  L D   +  Q + ++   P+     NP    FR FA+    +DL+ALA+C+   
Sbjct: 130 GGLGFNLVDGRGLP-QGIAEALEAPAGAPAPNPTAASFRTFAE-QTKSDLRALAACIRAS 187

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFK 248
           R+   + +L  I+ P L++VG+ D +AGS  EL+  +P+++ L++  RDH  AVGD+  +
Sbjct: 188 RQTLSRAELSAIETPTLVSVGTLDTVAGSGPELVKLLPNARALDLPNRDHSTAVGDRLHR 247

Query: 249 QGVVNF 254
           +GV+ F
Sbjct: 248 KGVLEF 253


>gi|240137051|ref|YP_002961520.1| putative alpha/beta hydrolase [Methylobacterium extorquens AM1]
 gi|240007017|gb|ACS38243.1| putative alpha/beta hydrolase [Methylobacterium extorquens AM1]
          Length = 258

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 150/246 (60%), Gaps = 8/246 (3%)

Query: 15  QFAFYDVGDKDAPT------ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           Q A+ DV  K+  +      ILLIHG AS+   NW+ + W++ L + G+RVIA DN GHG
Sbjct: 10  QIAYIDVPPKEGASGGSGDPILLIHGFASNHAVNWVNTLWVRTLTEAGYRVIAHDNRGHG 69

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +S+K Y    Y    MA DAV LL HLGI +  VMGYSMGARIA  M L YP+ VRS+++
Sbjct: 70  QSEKLYDPASYTSDQMAGDAVRLLRHLGIERADVMGYSMGARIAAHMALDYPAEVRSLLI 129

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI 188
           GG+G  L D   +  Q + ++   P+     NP    FR FA+    +DL+ALA+C+   
Sbjct: 130 GGLGFNLVDGRGLP-QGIAEALEAPAGAPAPNPTAASFRTFAE-QTKSDLRALAACIRAS 187

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFK 248
           R+   + +L  I+ P L++VG+ D +AGS  EL   +P+++ L++  RDH  AVGD+  +
Sbjct: 188 RQTLSRAELSAIETPTLVSVGTLDTVAGSGPELAKLLPNARALDLPNRDHSTAVGDRLHR 247

Query: 249 QGVVNF 254
           +GV+ F
Sbjct: 248 KGVLEF 253


>gi|163849827|ref|YP_001637870.1| alpha/beta hydrolase fold [Methylobacterium extorquens PA1]
 gi|163661432|gb|ABY28799.1| alpha/beta hydrolase fold [Methylobacterium extorquens PA1]
          Length = 258

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 151/246 (61%), Gaps = 8/246 (3%)

Query: 15  QFAFYDVGDKDAPT------ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           Q A+ DV  K+  +      +LLIHG AS+   NW+ + W++ L + G+RVIA DN GHG
Sbjct: 10  QIAYIDVPAKEGASGGSGDPVLLIHGFASNHAVNWVNTLWVRTLTEAGYRVIAPDNRGHG 69

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +S+K Y  + Y    MA DAV LL HLGI +  VMGYSMGARIA  M L YP+ VRS+++
Sbjct: 70  QSEKLYDPSSYTSDQMAGDAVRLLRHLGIERADVMGYSMGARIAAHMALDYPAEVRSLLI 129

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI 188
           GG+G  L D   +  Q + ++   P+     NP    FR FA+    +DL+ALA+C+   
Sbjct: 130 GGLGFNLVDGRGLP-QGIAEALEAPAGAPAPNPTAASFRTFAE-QTKSDLRALAACIRAS 187

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFK 248
           R+   + +L  I+ P L++VG+ D +AGS  EL   +P+++ L++  RDH  AVGD+  +
Sbjct: 188 RQTLSRAELSAIETPTLVSVGTLDTVAGSGPELAKLLPNARALDLPNRDHSTAVGDRLHR 247

Query: 249 QGVVNF 254
           +GV+ F
Sbjct: 248 KGVLEF 253


>gi|170747139|ref|YP_001753399.1| alpha/beta hydrolase fold [Methylobacterium radiotolerans JCM 2831]
 gi|170653661|gb|ACB22716.1| alpha/beta hydrolase fold [Methylobacterium radiotolerans JCM 2831]
          Length = 254

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 144/246 (58%), Gaps = 4/246 (1%)

Query: 15  QFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           + A+ DV   +     ILLIHG AS+   NW+ + W++ L   G+R IA DN GHG+S+K
Sbjct: 10  RIAYIDVPPAEGAGKPILLIHGFASNHAVNWVNTQWVKALTQAGYRAIALDNRGHGESEK 69

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
            Y    Y    MA DA+ LL+HLGI++ HVMGYSMG RI   + L +   VRS ++GG+G
Sbjct: 70  LYDPAAYSSEAMAGDAIRLLDHLGIARAHVMGYSMGGRITAHIALDHADRVRSALIGGLG 129

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF 192
             L +   +    + ++   P+     NP    FR FA+    +DL+ALA+C+   R+  
Sbjct: 130 MHLIEGKGLP-SGIAEALEAPAGTPAPNPTAAAFRMFAE-QTRSDLRALAACMRGSRQTL 187

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVV 252
            + +L +I+VPVL++VG+ D +AGS   L + IP ++ L I  +DH  AVG K  + GV+
Sbjct: 188 SRGELAQIEVPVLVSVGTLDTVAGSGPGLAALIPDARALEIEGKDHSTAVGAKPHRDGVL 247

Query: 253 NFYANE 258
            F A +
Sbjct: 248 AFLAAQ 253


>gi|218528457|ref|YP_002419273.1| alpha/beta hydrolase fold protein [Methylobacterium
           chloromethanicum CM4]
 gi|218520760|gb|ACK81345.1| alpha/beta hydrolase fold protein [Methylobacterium
           chloromethanicum CM4]
          Length = 258

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 152/246 (61%), Gaps = 8/246 (3%)

Query: 15  QFAFYDVGDKD-AP-----TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           Q A+ DV  ++ AP      ILLIHG AS+   NW+ + W++ L + G+RV+A DN GHG
Sbjct: 10  QIAYIDVPAREGAPGGSGDPILLIHGFASNHAVNWVNTLWVRTLTEAGYRVVAHDNRGHG 69

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +S+K Y    Y    MA DAV LL HLGI +  VMGYSMGARIA  M L YP+ VRS+++
Sbjct: 70  QSEKLYDPASYTSDQMAGDAVRLLRHLGIERADVMGYSMGARIAAHMALDYPAEVRSLLI 129

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI 188
           GG+G  L D   +  Q + ++   P+     NP    FR FA+    +DL+ALA+C+   
Sbjct: 130 GGLGFNLVDGRGLP-QGIAEALEAPAGAPAPNPTAASFRTFAE-QTKSDLRALAACIRAS 187

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFK 248
           R+   + +L  I+ P L++VG+ D +AGS  EL+  +P+++ L++  RDH  AVGD+  +
Sbjct: 188 RQTLSRAELSAIETPTLVSVGTLDTVAGSGPELVKLLPNARALDLPNRDHSTAVGDRLHR 247

Query: 249 QGVVNF 254
           +GV+ F
Sbjct: 248 KGVLEF 253


>gi|312113808|ref|YP_004011404.1| alpha/beta hydrolase fold protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218937|gb|ADP70305.1| alpha/beta hydrolase fold protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 250

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 134/226 (59%), Gaps = 2/226 (0%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ILLIHG AS+  TNW  +GW + L   GFRV+ FDN GHG S K Y  + Y    MA DA
Sbjct: 22  ILLIHGFASNAATNWKDTGWTRWLTGNGFRVVTFDNRGHGASSKLYEPDAYAGPVMAEDA 81

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
             LL+HL I++  VMGYSMGARIA  + L +P  VR  I  G+G+ +  S V D Q + D
Sbjct: 82  RRLLDHLDIARADVMGYSMGARIAAFLALAHPERVRRAIFAGLGANMI-SGVGDPQPIAD 140

Query: 149 SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
           + +      V +   + FR FAD    +D +ALA+C+   R     D+L  + +PVL+AV
Sbjct: 141 ALMADDPAAVADANARGFRIFADQTK-SDRRALAACIKASRDRIPGDELATLTMPVLVAV 199

Query: 209 GSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           G+ D +AG P  L   I  ++ L+I  RDH+ AVGD+ FK GV+ F
Sbjct: 200 GTDDTIAGPPGPLADAIRGAKTLDIPGRDHMKAVGDRAFKDGVLTF 245


>gi|154253056|ref|YP_001413880.1| alpha/beta hydrolase fold protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154157006|gb|ABS64223.1| alpha/beta hydrolase fold [Parvibaculum lavamentivorans DS-1]
          Length = 248

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 92/226 (40%), Positives = 132/226 (58%), Gaps = 2/226 (0%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           I+L HG AS+ + NW+ +GW + L + GFRVI  D  GHG+SDK +   DY L  MAAD 
Sbjct: 22  IVLAHGFASTHRVNWIATGWSRALMEAGFRVIMPDMRGHGESDKPHDAEDYTLSAMAADL 81

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           V+LL+HLG     +MGYSMGA +A      +P     VI  GVG+ L  +D  D + +I+
Sbjct: 82  VALLDHLGEPGADLMGYSMGAMVALVAATEWPDRFDRVIAAGVGARLLAAD-RDPRPVIE 140

Query: 149 SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
           + L      V++   + FR FAD + G D  ALA+C   +R PF  + L RI  PVL+  
Sbjct: 141 ALLADDPASVEDAGARMFRVFADQN-GQDRAALAACFEAVRAPFPAEGLSRISRPVLVVA 199

Query: 209 GSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           G  D  AG+   L + IP+++   + +RDH+  VGD+ +K+ V+ F
Sbjct: 200 GETDSQAGAAGVLAARIPNARGFTVPKRDHMKTVGDRAYKEAVLKF 245


>gi|296445075|ref|ZP_06887036.1| alpha/beta hydrolase fold protein [Methylosinus trichosporium OB3b]
 gi|296257496|gb|EFH04562.1| alpha/beta hydrolase fold protein [Methylosinus trichosporium OB3b]
          Length = 255

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 146/247 (59%), Gaps = 8/247 (3%)

Query: 15  QFAFYD----VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS 70
           Q A+ D      D+  P I+L+HG AS+   NWLF  W++ L + G RV+  DN GHGKS
Sbjct: 11  QLAYVDFPPLAEDRGEP-IVLVHGFASTHAVNWLFPQWVKTLTEDGRRVLVLDNRGHGKS 69

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           +K Y    Y +  MAAD    L+HLG+ +  VMGYSMG RIA  + + +P+ VRS+ILGG
Sbjct: 70  EKIYDPAAYDVALMAADVARFLDHLGVERADVMGYSMGGRIATRLAIDHPARVRSLILGG 129

Query: 131 VGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRK 190
           +G+ L  S +   + L ++     I+++ +PL K FR FA+    +DL ALA+C     +
Sbjct: 130 IGANLVTSALP--RGLSEAMEAERIEDIDDPLLKMFRGFAEAS-RSDLAALAACARGANQ 186

Query: 191 PFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQG 250
              +  L  I  PVLI VG++D++AG P  L      +  ++I  RDH  AVGD+ +KQ 
Sbjct: 187 IIDRAALAHITAPVLICVGTRDEVAGDPHPLQPLFRDAHIVDIPGRDHNRAVGDRVYKQA 246

Query: 251 VVNFYAN 257
           V++F A+
Sbjct: 247 VLDFLAH 253


>gi|304391883|ref|ZP_07373825.1| hydrolase [Ahrensia sp. R2A130]
 gi|303296112|gb|EFL90470.1| hydrolase [Ahrensia sp. R2A130]
          Length = 293

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 139/248 (56%), Gaps = 4/248 (1%)

Query: 10  SWRKYQFAFYDVGDKDAP--TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           S  +   A++D+    A   T+LL+HG AS+ Q NW+ + W Q L   G+RVIA DN GH
Sbjct: 44  SGERASIAYFDLASVGAERGTVLLVHGFASTAQVNWIGTSWSQTLRQAGYRVIALDNRGH 103

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G S K Y   DY     AADA++LL++LG+ + ++MGYSMGARI+C +    P    +V+
Sbjct: 104 GASQKFYDPADYGPDIFAADALALLDYLGVERCYLMGYSMGARISCWLAHQAPQRFPAVV 163

Query: 128 LGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
            GG+G  +Y      +  + ++      D   NP  K FR FAD   G D  ALA+C+  
Sbjct: 164 FGGMGEHIYGGR-GGYAEIAEALEADDPDASDNPAAKGFRIFAD-RVGADRLALAACIRP 221

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQF 247
             +    + +  + VPVL+AVG +D + GS   L   IPS +   I  +DH+ AVGD  +
Sbjct: 222 SAQQLTPEIVAGLTVPVLVAVGDEDGIGGSATVLADQIPSGEAFVIEGKDHMKAVGDLSY 281

Query: 248 KQGVVNFY 255
           K+ VV F+
Sbjct: 282 KKRVVAFF 289


>gi|154253053|ref|YP_001413877.1| alpha/beta hydrolase fold protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154157003|gb|ABS64220.1| alpha/beta hydrolase fold [Parvibaculum lavamentivorans DS-1]
          Length = 250

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 128/236 (54%), Gaps = 3/236 (1%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V  +  P ILL+HG A + + NW  +GW+Q L     +V+ FD  GHGKS K Y   D
Sbjct: 13  YEVAGEGYP-ILLVHGFAGTAEDNWGRTGWVQALTRAKRQVVTFDLRGHGKSGKLYEPTD 71

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  MA DAV+LL+HLGI +  ++GYSMGA IA  +   + +  R V+LGGVG  + + 
Sbjct: 72  YTMEKMAGDAVALLDHLGIERADLIGYSMGAGIAMRLAARHGARFRFVVLGGVGGRMLEP 131

Query: 139 DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLY 198
                 +          + + +   + FR +A+   G DL+A+A+C    R+    D L 
Sbjct: 132 SSFGAATAEALEAA-DPETISDRTARGFRLYAE-GLGQDLRAIAACARAPREGAATDFLG 189

Query: 199 RIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            I    L+  G++DD+AG P  L + IP ++   I   DH+ A+ +  FK  V++F
Sbjct: 190 EIRNETLVIAGARDDMAGDPAVLAARIPGAKAETIPGTDHMFALPNPMFKGAVMDF 245


>gi|197106604|ref|YP_002131981.1| hydrolase, alpha/beta hydrolase fold family protein
           [Phenylobacterium zucineum HLK1]
 gi|196480024|gb|ACG79552.1| hydrolase, alpha/beta hydrolase fold family protein
           [Phenylobacterium zucineum HLK1]
          Length = 278

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 121/228 (53%), Gaps = 2/228 (0%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T++L+HG AS+    W  +GW      +G RVI  D+ GHG+S K +    Y    MA  
Sbjct: 39  TVVLLHGFASNRAEGWRRTGWYGAFERRGMRVIGIDHPGHGESGKPHDPAAYERAHMAHA 98

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD-SDVVDWQSL 146
            + LL+ LG+ +  ++GYSMG R A +M L  P    ++ILGGVG  +++ SD    ++L
Sbjct: 99  MLELLDVLGVGRCDLIGYSMGTRTAIAMALSAPDRFSNLILGGVGGRMFEPSDPARAEAL 158

Query: 147 IDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLI 206
           + + L    D + +PL + FR FAD + G D +ALA+       P  ++ L  + +PVL+
Sbjct: 159 VGAMLADDPDSIADPLLRSFRHFAD-EQGEDRQALAAFSEAPNPPPARESLAALPMPVLV 217

Query: 207 AVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             G +D LAG P+EL       + + +   DH  A+     K  V +F
Sbjct: 218 VAGQRDHLAGDPEELARAFADGRSVTVAGCDHFSAIPHALTKAAVFDF 265


>gi|323356587|ref|YP_004222983.1| hydrolase or acyltransferase [Microbacterium testaceum StLB037]
 gi|323272958|dbj|BAJ73103.1| predicted hydrolase or acyltransferase [Microbacterium testaceum
           StLB037]
          Length = 265

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 126/247 (51%), Gaps = 8/247 (3%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A Y  GD DA  +L +HG  SS + NW+ +GW++ L   GFRV+A D  GHG SDK +
Sbjct: 23  RLATYTWGDADAEAVLCVHGFGSSTRDNWVNTGWVRDLLRAGFRVVAVDQRGHGASDKPH 82

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV--G 132
               Y +  + +D V++L+   +  V  +GYS+G R+   + +  P +V   +LGG+  G
Sbjct: 83  DAASYTMPTLVSDLVAVLDTYLLDSVRYLGYSLGGRVGWQLAVDAPEHVERAVLGGIPDG 142

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIR-KP 191
             L    V   ++ +D  +      V++    ++   A+  PGNDL+AL +    +R   
Sbjct: 143 RPLARLKVDQARAFLDHGI-----PVEDATTLRYVSLAERVPGNDLRALVAIAEGMRLGE 197

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGV 251
              D       PVLIA G++D +    Q L S +P  ++ +I  R H+ A G + F++  
Sbjct: 198 TDPDPASPPQQPVLIATGTEDPIHDQSQHLASLLPRGEFADIPGRHHVNAPGARAFREAG 257

Query: 252 VNFYANE 258
             F + E
Sbjct: 258 REFLSRE 264


>gi|300782528|ref|YP_003762819.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
 gi|299792042|gb|ADJ42417.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
          Length = 257

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 126/239 (52%), Gaps = 9/239 (3%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           GD     +LL HG A+    NW+ +G +  L   GF VI+ D  GHG+S+K + E+ Y  
Sbjct: 19  GDGARRPVLLQHGFAADTNANWISTGVVAALRSAGFTVISLDARGHGRSEKPHDESRYTE 78

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             MA D  +LL+ LG+ +V ++GYSMGA IA + V      +RS+  GGVGS + D   V
Sbjct: 79  DAMARDVSALLDELGLDEVSMVGYSMGAIIALT-VTAADKRIRSLATGGVGSGIVDFGGV 137

Query: 142 DWQSL----IDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDL 197
           D + +    I S LL        P G  FR  AD   G D +ALA+  S  R+   + DL
Sbjct: 138 DLRVVKPADIASALLAEDPASVPPSGVPFRLLADA-VGGDRRALAAVASASRE--GRLDL 194

Query: 198 YRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYA 256
             I VP L+  G QD LA  P+ L + I  ++ + I   DH+ AV    F + +V+F A
Sbjct: 195 SAIGVPTLVLAGEQDQLAAQPERLAAAIAGARLVRIP-GDHMTAVMSPAFAEALVSFLA 252


>gi|218506775|ref|ZP_03504653.1| probable hydrolase protein [Rhizobium etli Brasil 5]
          Length = 137

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 91/135 (67%), Gaps = 2/135 (1%)

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           VRS++LGG+G  + D  V DW  + D+ L PS+D V +  G+ FR FA+    +D  ALA
Sbjct: 1   VRSLVLGGLGIGMTDG-VGDWDPIADALLAPSLDVVTHERGRMFRAFAE-QTKSDRTALA 58

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           +C+   R    + D+ ++D+P LI VG++DD+AGSPQ+L + +P ++ L+I  RDH+LAV
Sbjct: 59  ACIRGSRDLVARSDMAKLDIPALIGVGTKDDIAGSPQQLAALMPEAEALDIPGRDHMLAV 118

Query: 243 GDKQFKQGVVNFYAN 257
           GDK FKQ V+ FYA 
Sbjct: 119 GDKVFKQAVLAFYAR 133


>gi|257054852|ref|YP_003132684.1| lysophospholipase [Saccharomonospora viridis DSM 43017]
 gi|256584724|gb|ACU95857.1| lysophospholipase [Saccharomonospora viridis DSM 43017]
          Length = 258

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 128/262 (48%), Gaps = 12/262 (4%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRV 59
           M +   FR+      A Y+V ++D+  PT++L HG A+   TNW+  G +  L   G RV
Sbjct: 1   MAQRAVFRTPDGLDIA-YEVWERDSKLPTVVLHHGFAADGNTNWVAPGIVDALTAAGRRV 59

Query: 60  IAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
           +  D  GHG S K +    Y    MAAD  +LL+ LG     ++GYSMGA I  ++V   
Sbjct: 60  VTIDARGHGASSKPHDPLFYGEEKMAADVRTLLDLLGEPSYDLVGYSMGA-IVSALVASQ 118

Query: 120 PSYVRSVILGGVGSVLYDSDVVDWQ----SLIDSFLLPSIDEVQNPLGKKFRKFADLDPG 175
              +R +++GGVG+ + +   VD +     +I +        + +P    FR FA++   
Sbjct: 119 EPRIRRLVIGGVGASVVELGGVDTRVVGSGVIQALHTDDPSSITDPNAAAFRMFAEMTGA 178

Query: 176 NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICR 235
           + L   A   ++ +KP   DD   I    L+  G  D  AG P +L   +P +  L +  
Sbjct: 179 DRLALAAQVRTLHQKPIALDD---ITASCLVLAGDDDPFAGRPDKLADALPDAT-LRVLP 234

Query: 236 RDHLLAVGDKQFKQGVVNFYAN 257
            DHL  V D  F + +V+F A+
Sbjct: 235 GDHLSVVRDPDFAKLIVSFLAD 256


>gi|297562178|ref|YP_003681152.1| alpha/beta hydrolase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296846626|gb|ADH68646.1| alpha/beta hydrolase fold protein [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 243

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 112/232 (48%), Gaps = 18/232 (7%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HG  +    NW  +GW + L   G RVI  D  GHG SDK      Y      AD 
Sbjct: 27  VLLLHGFGTDFGMNWRAAGWTRALESAGLRVIGPDLRGHGNSDKPTDSAFYLPGHFVADL 86

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG--SVLYDSDVVDWQSL 146
           VS+L+ L + KV V+GYSMG+R+A  + L  P  VR V+LGG G  +    +D+ D  S 
Sbjct: 87  VSMLDELAVDKVDVVGYSMGSRLAWELALTAPERVRRVVLGGFGPKNAFAGTDLSDPGS- 145

Query: 147 IDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCL-SMIRKPFCQDDLYRIDVPVL 205
                         P    +R  A L P ND  ALA+C      +PF  +      +PVL
Sbjct: 146 -----------GDTPFDHVYRTVAAL-PSNDPAALAACARGQASRPFAAEPPLS-GLPVL 192

Query: 206 IAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
           +  G++D LA     L        ++ I  RDH  AV  + F+Q V++F A+
Sbjct: 193 LVSGARDPLAEGAAALAERC-GGTHVEIPGRDHANAVSSRHFRQAVLDFLAD 243


>gi|320011330|gb|ADW06180.1| alpha/beta hydrolase fold protein [Streptomyces flavogriseus ATCC
           33331]
          Length = 257

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D   P ++L+HG A+  + NW   G ++ L  +G RV A D  GHG SD+ + +  Y   
Sbjct: 23  DGALPPVVLLHGFAAHARLNWEGPGVVEALVARGRRVYALDARGHGASDRPHDDTHYGES 82

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD 142
            MA D   L++ +G  +VHV GYSMGA +   +     S +  ++ GG+G+   +   +D
Sbjct: 83  LMARDVRLLIDRIGADEVHVAGYSMGA-VVAVLAAAQDSRISRLVTGGIGAGAVEVGGLD 141

Query: 143 WQSL---IDSFLLPSIDEVQNP-LGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLY 198
            + +   + S  L + +    P   + FR  AD   G D  ALA+ +  + +      L 
Sbjct: 142 TRVMPPELVSAALTAENAADAPERTRAFRVLADT-AGGDRLALAAQIRAVHRGALP--LD 198

Query: 199 RIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
           RI VP L+  G+ D LA  P+ L S I  ++ L +   DHL AV D  F + + +F A 
Sbjct: 199 RITVPTLVLAGAGDPLATRPEVLASAIAGAE-LTVLPGDHLTAVRDPGFAEAIASFLAR 256


>gi|163840254|ref|YP_001624659.1| alpha/beta fold family hydrolase [Renibacterium salmoninarum ATCC
           33209]
 gi|162953730|gb|ABY23245.1| hydrolase, alpha/beta fold superfamily [Renibacterium salmoninarum
           ATCC 33209]
          Length = 262

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/254 (28%), Positives = 114/254 (44%), Gaps = 12/254 (4%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R      +  G      +L++HG  SS + NW+ SGWIQ L D G RVIA D  GHG + 
Sbjct: 11  RASTLRVHHFGADSGRPLLMLHGFGSSAEFNWVQSGWIQPLTDAGRRVIAVDLPGHGGNP 70

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGI---------SKVHVMGYSMGARIACSMVLFYPSY 122
                ++Y    + A+ + LL   G+         S V ++GYS+GAR A       P  
Sbjct: 71  APEALDEYTPSRIRAEILQLLADEGVKPLDAEDPTSGVDIIGYSLGARFAWEFGAAQPEL 130

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           V  ++LGG  +   D  + D+       +L S   + +P+      +A   PGND+ AL 
Sbjct: 131 VHRMVLGGPAA---DDPLADFNLAQAEEMLTSGTPIADPVTADLIGWAQQIPGNDMFALL 187

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAV 242
           S    ++            +P+L   G +D LA    +L      ++ L +  R+H  A+
Sbjct: 188 SMARAVKTEPYDATESVPKMPILFVAGEKDKLAEKMPKLAELNGHAEILILPARNHFNAI 247

Query: 243 GDKQFKQGVVNFYA 256
             + FKQ  + F+A
Sbjct: 248 TSRAFKQAAIAFFA 261


>gi|308177113|ref|YP_003916519.1| putative lipase/esterase [Arthrobacter arilaitensis Re117]
 gi|307744576|emb|CBT75548.1| putative lipase/esterase [Arthrobacter arilaitensis Re117]
          Length = 249

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 114/245 (46%), Gaps = 22/245 (8%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG----KSDKSYIEND 78
           +  AP +LLIHG ASS   NW+ S W+Q     G   I  D  GHG    ++D S+    
Sbjct: 15  ETGAPPVLLIHGFASSADMNWMRSRWVQHFTTHGRDAILLDLPGHGTDPYRNDGSWTPTR 74

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV--LY 136
            R    +A    L EH GISKV V+GYS+GAR+       +P  V  +++GG  S+  L 
Sbjct: 75  IRESIASA----LAEH-GISKVDVLGYSLGARLGWEFAAHFPELVNKLVMGGAASIDPLA 129

Query: 137 DSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRK-PFCQD 195
             ++   ++ ID       +EV +    K    A  +  ND +AL   +  I+  P+   
Sbjct: 130 AFELDQARAFIDHG-----EEVHDEYTAKVITIAKAEGSNDFEALFRLIEAIKTDPYVPA 184

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFI----PSSQYLNICRRDHLLAVGDKQFKQGV 251
                  PVL+  G  DDLA +  EL   +      S    +  R+H  AV  ++FK+  
Sbjct: 185 SKIPA-CPVLLVAGDHDDLATTMPELRRLLREAGTDSSIHWLPGRNHANAVTSREFKEKA 243

Query: 252 VNFYA 256
           V F++
Sbjct: 244 VEFFS 248


>gi|302523952|ref|ZP_07276294.1| predicted protein [Streptomyces sp. AA4]
 gi|302432847|gb|EFL04663.1| predicted protein [Streptomyces sp. AA4]
          Length = 281

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 115/233 (49%), Gaps = 11/233 (4%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L HG A+  Q NW+  G +  L   GF VIA D  GHG S+K +    Y    MAAD 
Sbjct: 40  VVLHHGFAADSQVNWVNPGVVDALVKAGFTVIALDARGHGASEKPHDPAAYGEDIMAADL 99

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL-----YDSDVVDW 143
            +L + LG+ +V + GYSMGA I   +V      VR + +GGVG+ +      D+ V++ 
Sbjct: 100 TALFDELGLDEVCLAGYSMGA-IVSLLVATRDRRVRCLAVGGVGAGIVDFGGVDARVINR 158

Query: 144 QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVP 203
             +    L     EV +   + FR+ A    G D++ALA+   M   P     L  +   
Sbjct: 159 SQIAAGLLAEDRSEVPS-AARPFRRLAR-RAGADVEALAAV--MHATPHGPMRLTNLSAA 214

Query: 204 VLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYA 256
            LI  G  D+LA  P+ L + I  ++ + +   +H+ AV    F   +V+F+A
Sbjct: 215 TLILAGESDELATQPERLAAGIAGARLVRVP-GNHMEAVAHPAFAAALVDFFA 266


>gi|152968081|ref|YP_001363865.1| alpha/beta hydrolase fold [Kineococcus radiotolerans SRS30216]
 gi|151362598|gb|ABS05601.1| alpha/beta hydrolase fold [Kineococcus radiotolerans SRS30216]
          Length = 268

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 118/231 (51%), Gaps = 10/231 (4%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L HG ++S    W  SG  + L   G RV+A D  GHG+S+  +    Y    MA D 
Sbjct: 41  VVLHHGFSASASLEWPRSGVPRALRAAGRRVLAPDARGHGESEAPHDPARYGEARMATDV 100

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           V +L+ LG+  V ++GYSMGA ++  +    P+ V  ++L GVG+ L +   VD + L  
Sbjct: 101 VEVLDALGVDDVDLVGYSMGAVVSALVASTRPARVHRLVLAGVGAGLAELGGVDTRVLPA 160

Query: 149 SFLLPSIDEVQ----NPLGKKFRKFADLDPGNDLKALASCLSMIR-KPFCQDDLYRIDVP 203
           + L  ++        +P+ + FR+FA+   GNDL ALA+    +  +P    DL  +  P
Sbjct: 161 AALAAALRARDPGDLDPVVRGFREFAE-GTGNDLLALAAQADAVHDRPL---DLAAVTAP 216

Query: 204 VLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            L+  G  D LA  P+ L + +P ++   + R DH  A+ D  F   V  F
Sbjct: 217 TLVLAGDADPLARRPEVLAAAVPGARS-QLVRGDHGAALTDPGFAAAVAAF 266


>gi|226364614|ref|YP_002782396.1| hydrolase [Rhodococcus opacus B4]
 gi|226243103|dbj|BAH53451.1| putative hydrolase [Rhodococcus opacus B4]
          Length = 277

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 124/244 (50%), Gaps = 26/244 (10%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+  VGD +   ++L+HG A S    W   G++  L D+ +R+I  D  GHG+SDK +
Sbjct: 17  RIAYRTVGDGE--PLVLVHGTALS-HAIWRGFGYVAALRDR-YRLILVDLRGHGRSDKPH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E+ Y +  ++ D +++L+HL +   HV+GYS+G R+A ++ +  P  + S+I+GG GS 
Sbjct: 73  DEDAYAMDLLSGDVLAVLDHLEVPSAHVLGYSLGGRVALALAVGAPERLESLIVGG-GSS 131

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF------RKFADLDPG-------NDLKAL 181
           L  +   D       F    ID ++      F      R+   +D G       ND KAL
Sbjct: 132 LPQAGAFDRL-----FFPGCIDVLERDGMDAFLAQWNARRAWPIDAGTRAAFMANDAKAL 186

Query: 182 ASCLSMIR-KPFCQDD-LYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRDH 238
           A+ +     +P   DD L RI VP L+ VGS D +  G  + + + IP +    +   DH
Sbjct: 187 AAYMRRSGVEPGVDDDVLRRIAVPTLLFVGSDDAERIGDTRRVAALIPGASLTILPGFDH 246

Query: 239 LLAV 242
             AV
Sbjct: 247 STAV 250


>gi|282862118|ref|ZP_06271181.1| alpha/beta hydrolase fold protein [Streptomyces sp. ACTE]
 gi|282563143|gb|EFB68682.1| alpha/beta hydrolase fold protein [Streptomyces sp. ACTE]
          Length = 257

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 119/255 (46%), Gaps = 16/255 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           +R+W +   +         P ++L+HG A+  + NW   G ++ L  +G RV A D  GH
Sbjct: 15  YRTWSRGPGSAL-------PPVVLLHGFAAHARLNWEGPGVVEALVSRGRRVYAPDARGH 67

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G SDK + +  Y    MA D   L++ +G  +V V GYSMGA +   +     + +  ++
Sbjct: 68  GDSDKPHDDAFYGEALMARDVRLLIDRVGADRVQVAGYSMGA-VVALLAAAEDARISRLV 126

Query: 128 LGGVGSVLYDSDVVDWQSLIDSFL---LPSIDEVQNP-LGKKFRKFADLDPGNDLKALAS 183
           +GG+G+   +   +D + +    +   L + D    P   + FR  AD   G+D  ALA+
Sbjct: 127 VGGIGAGAVEVGGLDTRVMPPELVAAALTAEDVAHAPERTRGFRILADAT-GSDRLALAA 185

Query: 184 CLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVG 243
            +  + +      L RI VP L+  G  D LA  P  L   I  ++ L +   DHL  V 
Sbjct: 186 QVRSVHRGALP--LDRITVPTLVLAGESDPLAERPGVLAGAIAKAE-LALLPGDHLGVVR 242

Query: 244 DKQFKQGVVNFYANE 258
           D  F   +  F + +
Sbjct: 243 DAGFAGAIARFLSED 257


>gi|325963788|ref|YP_004241694.1| lysophospholipase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323469875|gb|ADX73560.1| lysophospholipase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 276

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 115/246 (46%), Gaps = 22/246 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HG +SS + NW  +GW+  L D G RVI  D  GHG+S      + Y    + AD 
Sbjct: 37  VLLVHGFSSSSKLNWEDTGWVAALLDAGRRVITIDLPGHGRSGAPEDRDSYSPSRIRADL 96

Query: 89  VSLLEHLGISKVH---------VMGYSMGARIACSMVLFYPSYVRSVILGG--VGSVLYD 137
           +      G+  V          ++GYS+G+R+A       P  V  ++LGG  V   L +
Sbjct: 97  LQTAFDAGVRPVQDGDPSSGLDIVGYSLGSRLAWEFGATQPETVHRLVLGGPNVSDPLAE 156

Query: 138 SDVVDWQS-LIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD 196
            D+   Q  L D    P  DE          K A L PGN++ AL S +  I+       
Sbjct: 157 FDLRAAQDYLADG--TPIKDEST----ASLLKMALLLPGNNIFALLSLVEAIKAEPYDPS 210

Query: 197 LYRIDVPVLIAVGSQDD-LAGSPQ--ELM-SFIPSSQYLNICRRDHLLAVGDKQFKQGVV 252
                VP+L+  G +DD L+  PQ  EL  S   +++ L +  R+H  AV  + FKQ  +
Sbjct: 211 EAVPHVPMLLVAGDKDDRLSSLPQLAELARSAGSAAEQLILPGRNHTNAVTSRAFKQAAI 270

Query: 253 NFYANE 258
           +F A E
Sbjct: 271 SFLAGE 276


>gi|218462517|ref|ZP_03502608.1| probable hydrolase protein [Rhizobium etli Kim 5]
          Length = 96

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 64/92 (69%), Gaps = 1/92 (1%)

Query: 166 FRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFI 225
           FR FA+    +D  ALA+C+   R    + D+ ++D+P LI VG++DD+AGSPQ+L + +
Sbjct: 2   FRAFAE-QTKSDRTALAACIRGSRDLVARSDMAKLDMPALIGVGTKDDIAGSPQQLAALM 60

Query: 226 PSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
           P ++ L+I  RDH+LAVGDK FKQ V+ FYA 
Sbjct: 61  PEAEALDIPGRDHMLAVGDKVFKQAVLAFYAR 92


>gi|119960809|ref|YP_948262.1| hydrolase [Arthrobacter aurescens TC1]
 gi|119947668|gb|ABM06579.1| putative hydrolase [Arthrobacter aurescens TC1]
          Length = 280

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 112/243 (46%), Gaps = 24/243 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LLIHG +SS + NW+ SGWI  L D G RVI  D  GHG+S      + Y    + AD 
Sbjct: 42  VLLIHGFSSSTKLNWVDSGWITTLQDAGRRVITVDLPGHGRSHSPEDLDSYTPSRIRADL 101

Query: 89  VSLLEHLGI---------SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV--LYD 137
           + ++   G          + + V+GYS+G+R+A       P  V  ++LGG  S   L  
Sbjct: 102 LQIVNDAGARPLRDGDPSTGLDVIGYSLGSRLAWEFGATQPDLVHRIVLGGPSSADPLAA 161

Query: 138 SDVVDWQS-LIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIR-KPFCQD 195
            D+V  Q  L D         +++       K A + P N+L A+ S +  I+ +PF   
Sbjct: 162 FDLVAAQRHLADGT------PIEDGSTAGLLKMAQMLPSNNLFAMLSLIEAIKGEPFDPA 215

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSS----QYLNICRRDHLLAVGDKQFKQGV 251
           +     +P+L+  G +D+ A +  EL S         + L I  R H   +  + FK+  
Sbjct: 216 EAAP-HMPLLLVAGEKDERAATMPELASIAGKRGGMVETLVIPGRTHTNVITSRAFKEAA 274

Query: 252 VNF 254
           V F
Sbjct: 275 VGF 277


>gi|111022113|ref|YP_705085.1| hydrolase [Rhodococcus jostii RHA1]
 gi|110821643|gb|ABG96927.1| hydrolase [Rhodococcus jostii RHA1]
          Length = 267

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 120/245 (48%), Gaps = 28/245 (11%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+  VGD +   ++LIHG A S    W   G++  L D+ +R+I  D  GHG SDK +
Sbjct: 17  RIAYKTVGDGE--PLVLIHGTALS-HAIWRGFGYVAALRDR-YRLILVDLRGHGCSDKPH 72

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E+ Y +  ++ D +++L+HL +   HV+GYS+G R+A ++ +  P  + S+I+GG  S 
Sbjct: 73  DESAYAMDLVSGDVLAVLDHLDLPSAHVLGYSLGGRVALALAVGAPERLESLIVGGGSS- 131

Query: 135 LYDSDVVDWQSLIDSFLLPS-IDEVQNPLGKKF------RKFADLDPG-------NDLKA 180
                        D    P  ID ++      F      R+   +D G       ND +A
Sbjct: 132 ------RPQAGAFDRLFFPGCIDVLERDGMDAFLAQWNARRSWPIDAGTRAAFMANDAQA 185

Query: 181 LASCLSMIR-KPFCQDDLYR-IDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRD 237
           LA+ +     +P   DD+ R I VP L+ VGS D +  G  Q + + IP +    +   D
Sbjct: 186 LAAYMRRSGVEPGVDDDVLRGIAVPTLLFVGSNDAERIGDTQRVAALIPGASLTILPGFD 245

Query: 238 HLLAV 242
           H  AV
Sbjct: 246 HSTAV 250


>gi|284038477|ref|YP_003388407.1| alpha/beta hydrolase fold protein [Spirosoma linguale DSM 74]
 gi|283817770|gb|ADB39608.1| alpha/beta hydrolase fold protein [Spirosoma linguale DSM 74]
          Length = 264

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 116/240 (48%), Gaps = 12/240 (5%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           YDV     P +LL HG  S+ ++ W  +   Q L D GF+V+  D  G+G SDK +    
Sbjct: 36  YDVVGAGKPVVLL-HGFISTSES-WKRADVRQALIDAGFKVVMLDLRGNGLSDKPHTAEA 93

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           YR      D ++L+++LG+    V+GYS GA I  + +L     V   ++GG+     D 
Sbjct: 94  YRDNAELKDVIALMKYLGLKNYDVVGYSRGA-ILTAKLLTMDKQVHKAVMGGISVDFSDP 152

Query: 139 DVVDWQSLIDSFLLP-SIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDL 197
           +    ++  ++   P S  E+Q+ +    +  AD         + + L   +    + +L
Sbjct: 153 NWYRRRNFHEALTKPGSHPELQSAIDYAKKSGAD-------TVVLARLQEFQPVTTRTEL 205

Query: 198 YRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
            +I VPVL+  G +D   G P+ L+  IP S+ L I   DH  A+   +F + VVNF + 
Sbjct: 206 AKIRVPVLVVNGDKDTDNGDPKTLVDAIPGSR-LVIVPGDHGGAMRTPEFAKAVVNFLSK 264


>gi|114798212|ref|YP_761559.1| alpha/beta fold family hydrolase [Hyphomonas neptunium ATCC 15444]
 gi|114738386|gb|ABI76511.1| hydrolase, alpha/beta fold family [Hyphomonas neptunium ATCC 15444]
          Length = 254

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 112/247 (45%), Gaps = 6/247 (2%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F S+     ++  +G+   P +L++HG + + Q NW   G  Q +   G+ VIA D  GH
Sbjct: 9   FASFDGTPISYQTLGE--GPPVLMLHGFSGNAQINWFGPGIAQKIAAAGYTVIAPDLRGH 66

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G S  +  E  +    +A D ++L++HL      V+GYSMG+  A    L      R ++
Sbjct: 67  GASPFTAPEAGWPRDAIARDQIALMKHLKQKPYAVVGYSMGSLSALRYHLLSRDGGRLIL 126

Query: 128 LGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
            G   S   D    D  +   + L  +I     P  K  +  A    G  L+     LS 
Sbjct: 127 GGIGDSAA-DETNTDRNTAFRAALDAAIAGEDTPAAKAMQARAKAT-GGSLEGYRGALSS 184

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQF 247
            R    +D L   D+PVL+  G++D   GS  +L   IP ++Y+ +    HL AVGD   
Sbjct: 185 -RLYTGRDLLETFDLPVLVLTGNEDLDNGSGPKLAEIIPGAEYIELTGT-HLTAVGDPAL 242

Query: 248 KQGVVNF 254
            + ++ F
Sbjct: 243 PEAIITF 249


>gi|167648163|ref|YP_001685826.1| alpha/beta hydrolase fold protein [Caulobacter sp. K31]
 gi|167350593|gb|ABZ73328.1| alpha/beta hydrolase fold [Caulobacter sp. K31]
          Length = 272

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 107/227 (47%), Gaps = 9/227 (3%)

Query: 30  LLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAV 89
           LL+HG  ++ +TNW   G    +   G  VIA D  GHG+SD       +    +A D  
Sbjct: 46  LLLHGFLANAETNWFLPGIAAAIAATGREVIAPDLRGHGRSDAPTDPAAWPRDVLAMDQE 105

Query: 90  SLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDS 149
           +L+ HL ++   ++GYS+GAR A  M     +  R ++LGG+G     +         DS
Sbjct: 106 ALIAHLHLTDYDLVGYSLGARTAVRMAARG-ARPRKMVLGGMGLSGLTAAGARAAMFEDS 164

Query: 150 FLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA--SCLSMIRKPFCQDDLYRIDVPVLIA 207
                 +  Q+P  +  R+   +   + LKA A    LS    P    ++ RID+P L+ 
Sbjct: 165 IR--HGEAAQDP--RAGRRVHAMMAASGLKAEAMLGALSAF-APTPPGEIERIDIPTLVV 219

Query: 208 VGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
            G +DD  GS + L + +P+++   I   DHL AV +      +V F
Sbjct: 220 AGVRDDDNGSVEGLAALMPNARGTRIP-GDHLSAVMEPALAAEIVGF 265


>gi|226304546|ref|YP_002764504.1| hydrolase [Rhodococcus erythropolis PR4]
 gi|226183661|dbj|BAH31765.1| putative hydrolase [Rhodococcus erythropolis PR4]
          Length = 275

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 116/243 (47%), Gaps = 15/243 (6%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+  VGD   P +L++HG A S ++ W   G++++L +Q +R+I  D  GHG+SDK +
Sbjct: 24  RIAYQIVGD--GPPLLMVHGTALS-RSIWRGFGYVKVLQEQ-YRLILVDMRGHGRSDKPH 79

Query: 75  IENDYRLVFMAADAVSLLE-HLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
             + Y +  +  D + +L+        HV+GYS G R   S+ + +   VRS+ +GG  S
Sbjct: 80  DSDSYAMDLVVGDLLEILDTESPFEPAHVLGYSFGGRSVMSLTVEHSERVRSLTVGGGSS 139

Query: 134 VLYDS--DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG-----NDLKALASCLS 186
                  D + +   ID+     I+   +  G +  K  D         ND  ALA+ + 
Sbjct: 140 RPMTGAFDALFFPGCIDALESGGIEGFLSGWGARRGKPVDPQTATAFRINDALALAAYMR 199

Query: 187 MIRKPFCQDD--LYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRDHLLAVG 243
              K    DD  L RI  P L+ VGS+D +     + L S IP S    I   DH  AV 
Sbjct: 200 RAEKEQGIDDAVLQRITTPALLFVGSRDRERLPDTEHLASLIPDSALTVIEEADHASAVA 259

Query: 244 DKQ 246
           D +
Sbjct: 260 DSE 262


>gi|296285068|ref|ZP_06863066.1| hydrolase [Citromicrobium bathyomarinum JL354]
          Length = 252

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 108/230 (46%), Gaps = 13/230 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F+S+   + A + +G+     ++L+HGL S+   NW+  G  Q + +QG+ V+  D   H
Sbjct: 6   FQSFDGTKLALHRMGE--GRPVVLLHGLFSNADMNWIRFGHAQRIAEQGYEVLMLDFRVH 63

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SD  +   +Y    +  D  +L+EHLG++   + G+S+GAR A   V       + +I
Sbjct: 64  GQSDAPHGAENYPAGVLVRDVAALVEHLGLTDYDLAGFSLGARTAIHGVATGKLAPQRLI 123

Query: 128 LGGVGS---VLYDSDVVDWQSLIDSF-LLPSIDEVQNPLGKKFRKFADLDPGNDLKALAS 183
           LGG+G      +D     +  +ID F  +P  D        +F K   +D     +  A 
Sbjct: 124 LGGMGVDGLREWDKRAAFFIRVIDEFDAIPKGDPAY--FSMQFLKSQKVD-----RTAAR 176

Query: 184 CLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNI 233
            L    +     +L  I  P L+  G +D   GS QEL   +P++ Y  +
Sbjct: 177 LLLGSMENLDLGELANIACPTLVVCGDEDSDNGSAQELAGMLPNATYAEV 226


>gi|146306327|ref|YP_001186792.1| 3-oxoadipate enol-lactonase [Pseudomonas mendocina ymp]
 gi|145574528|gb|ABP84060.1| 3-oxoadipate enol-lactonase [Pseudomonas mendocina ymp]
          Length = 265

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 102/211 (48%), Gaps = 21/211 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  + D G   AP +LL+HGL SS + +W +   + +L  Q +RV+A D  GHG+SDK +
Sbjct: 10  QLHYEDYG-HGAP-LLLVHGLGSSTR-DWEYQ--VPVLS-QHYRVVALDVRGHGRSDKPH 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR+   A D  +L+EHL +S VH++G SMG  I   + + +P  +R++ +   G  
Sbjct: 64  --EAYRIADFADDVAALIEHLQLSPVHLVGISMGGMIGFQLAVDHPELLRTLTIVNSGPE 121

Query: 135 LYDSDVVDWQSLIDSFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKAL 181
           +      DW  +   + L    S++ +   L K            RK  +  P ND +A 
Sbjct: 122 VKAKSPRDWLEIGKRWTLARLLSLETIAKALAKLLFPRPEQAELRRKVEERWPQNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD 212
            + L  I     ++ L RI  P L+    QD
Sbjct: 182 LASLDAIIGWGVRERLKRITCPTLVITADQD 212


>gi|332185801|ref|ZP_08387548.1| alpha/beta hydrolase fold family protein [Sphingomonas sp. S17]
 gi|332014159|gb|EGI56217.1| alpha/beta hydrolase fold family protein [Sphingomonas sp. S17]
          Length = 253

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 115/255 (45%), Gaps = 15/255 (5%)

Query: 4   EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           E +FF S+     A+ ++G+     ++LIHG  S   TNW+  G    +  +G+RVI  D
Sbjct: 7   ETRFFDSFDGTPIAWRELGEGR--PVVLIHGYFSDAYTNWIRYGHAAAIAAKGYRVIMPD 64

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
              HG+S K +    Y    +  D  +L+EHLG++   + GYS+GAR    M+       
Sbjct: 65  LRAHGESGKPHDPAAYPADALTRDGHALVEHLGLTDYDLGGYSLGARTVSRMLATGAEPG 124

Query: 124 RSVILG-GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA 182
           +++  G G+  +L+    V+  + I + L          + + F K    DP        
Sbjct: 125 KAIFAGMGLEGLLHTDRRVEHFTNILTRLGEHKRGSPEWMAEAFLKTTGGDP-------- 176

Query: 183 SCLSMIRKPFCQDDLYRI---DVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHL 239
             L  I K F    L  I   D+P L+A G++D   G+  +L   +P  +Y+ I   +H+
Sbjct: 177 VALLHILKTFADTPLSAIEGFDLPALVAAGAEDFDNGAAVDLADALPRGRYVEIP-GNHM 235

Query: 240 LAVGDKQFKQGVVNF 254
            +V   +    +  F
Sbjct: 236 SSVTKPELGAAIAQF 250


>gi|241761641|ref|ZP_04759728.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260754006|ref|YP_003226899.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|241373949|gb|EER63482.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258553369|gb|ACV76315.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 250

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 118/256 (46%), Gaps = 20/256 (7%)

Query: 4   EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           +  +F +    + A++++GD     I+L+HGL SS  TNW+  G    L   GFRVI  D
Sbjct: 6   KTAYFTADDGVKLAWHEMGD--GFPIVLLHGLFSSAATNWIKPGHADFLAKSGFRVIMPD 63

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
             GHG+S   Y    +    +  D   L+E LG+    + GYS+GARI+     +   + 
Sbjct: 64  LRGHGES--GYQTGAWPKTILTQDCRQLVEQLGLKNWVLGGYSLGARISAHFY-WENGHP 120

Query: 124 RSVILGGVG-----SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL 178
             ++L G+G     +   + D+       D F   SI+         FR+      G + 
Sbjct: 121 EMLVLAGMGLEGLTNSYLNLDLFRRAIEQDDFPQASIERFIQGF---FRQ-----SGCNK 172

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDH 238
           +A+ + L   + P   D + +I    L+  G QD   GSP +L   +P++  +   + DH
Sbjct: 173 EAMIALLES-QSPLSPDQVSQISAKTLVLSGKQDQFNGSPLKLKDMLPNAA-IAWVKGDH 230

Query: 239 LLAVGDKQFKQGVVNF 254
           + AVG +     +V+F
Sbjct: 231 MSAVGQRSLAVDIVDF 246


>gi|229494488|ref|ZP_04388251.1| hydrolase [Rhodococcus erythropolis SK121]
 gi|229318850|gb|EEN84708.1| hydrolase [Rhodococcus erythropolis SK121]
          Length = 256

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 109/234 (46%), Gaps = 17/234 (7%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D P +L++HG A S ++ W   G+++ L +Q +R+I  D  GHG+SDK +  + Y +  +
Sbjct: 13  DGPPLLMVHGTALS-RSIWRGFGYVKALQEQ-YRLILVDMRGHGRSDKPHDSDSYAMDLV 70

Query: 85  AADAVSLLE-HLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS--DVV 141
             D + +L+        HV+GYS G R   S+ + +   VRS+ +GG  S       D +
Sbjct: 71  VGDLLEILDTESPFEPAHVLGYSFGGRSVMSLTVEHSERVRSLTVGGGSSRPMTGAFDAL 130

Query: 142 DWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG-------NDLKALASCLSMIRKPFCQ 194
            +   ID      I+      G   R+   +DP        ND  ALA+ +    K    
Sbjct: 131 FFPGCIDVLESGGIEGFLT--GWGVRRGKPVDPQTATAFRINDALALAAYMRRAEKEHGI 188

Query: 195 DD--LYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRDHLLAVGDK 245
           DD  L RI  P L+ VGS+D +     + L S IP S    I   DH  AV D 
Sbjct: 189 DDAVLQRITTPALLFVGSRDRERLPDTEHLASLIPDSALTVIEGADHASAVADS 242


>gi|254385836|ref|ZP_05001156.1| hydrolase [Streptomyces sp. Mg1]
 gi|194344701|gb|EDX25667.1| hydrolase [Streptomyces sp. Mg1]
          Length = 298

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 119/254 (46%), Gaps = 28/254 (11%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           +W   + A     D + P +LL+HGL       + ++G  + L ++  RV+A D  GHG+
Sbjct: 27  AWEFREPATEGAPDPERPAVLLLHGLMGRA---FHWAGTARWLAER-HRVVALDQRGHGQ 82

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           SD+       R  F+A DA +++E LG++ V ++G+SMGA  A  +   +P  VR++++ 
Sbjct: 83  SDRPATGPYTREAFVA-DAEAVIEQLGLAPVTLIGHSMGALTAWQLAARHPDLVRALVIC 141

Query: 130 GV-GSVLYDSDVVDWQSLIDSFLL--PSIDEVQNPLGKKFRKFADLDPG----------- 175
            +  S L ++   +W+     + L  P+ D  +   G+   +    DPG           
Sbjct: 142 DMRASALGEASQQEWEEWFHRWPLPFPTQDAARRWFGEDDPRVERPDPGRGAFFAEVMHQ 201

Query: 176 --NDLKALASCLSMI--RKPFCQD----DLYRIDVPVLIAVGSQDDLA-GSPQELMSFIP 226
             +  + L S   M+  R+ +  D    +L ++  P L+  G   +L     QE++  +P
Sbjct: 202 APDGWRPLFSRRQMLTARETWVHDAHWEELAQVRCPTLVVRGLDGELGRAEAQEMVRVLP 261

Query: 227 SSQYLNICRRDHLL 240
           + QY  I    H L
Sbjct: 262 AGQYAEIPDAGHYL 275


>gi|220913045|ref|YP_002488354.1| hydrolase protein [Arthrobacter chlorophenolicus A6]
 gi|219859923|gb|ACL40265.1| putative hydrolase protein [Arthrobacter chlorophenolicus A6]
          Length = 275

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 109/244 (44%), Gaps = 22/244 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HG +SS + NW  +GW+  L + G RVI  D  GHG+S      + Y    + AD 
Sbjct: 37  VLLLHGFSSSGKLNWEDTGWVGALLEAGRRVITVDLPGHGRSGAPEDRDSYSPSRIRADL 96

Query: 89  VSLLEHLGI---------SKVHVMGYSMGARIACSMVLFYPSYVRSVILGG--VGSVLYD 137
           +      G+         S + ++GYS+G+R+A       P  V  ++LGG  +   L +
Sbjct: 97  LQTAFDAGVRPLQDGDPSSGLDLVGYSLGSRLAWEFASTQPEIVHRLVLGGPNISDPLAE 156

Query: 138 SDVVDWQS-LIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD 196
            D+   Q  L D   +      Q        K A L P N++ AL + +  I+       
Sbjct: 157 FDLTAAQDYLADGTPIADGSTAQ------LLKMALLLPTNNIFALLTLVEAIKAEPYDPA 210

Query: 197 LYRIDVPVLIAVGSQDDLAGSPQELMSFIPSS----QYLNICRRDHLLAVGDKQFKQGVV 252
                VP+L+  G QD+  GS  +L     S+    + L +  R+H  AV  + FKQ  +
Sbjct: 211 EAVPHVPMLLVAGDQDERIGSLPKLAELANSTGGMAEQLVLPGRNHTNAVTSRAFKQAAI 270

Query: 253 NFYA 256
            F A
Sbjct: 271 AFLA 274


>gi|56552302|ref|YP_163141.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56543876|gb|AAV90030.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 250

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 118/256 (46%), Gaps = 20/256 (7%)

Query: 4   EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           +  +F +    + A++++G+     I+L+HGL SS  TNW+  G    L   GFRVI  D
Sbjct: 6   KTAYFTADDGVKLAWHEMGE--GFPIVLLHGLFSSAATNWIKPGHADFLAKSGFRVIMPD 63

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
             GHG+S   Y    +    +  D   L+E LG+    + GYS+GARI+     +   + 
Sbjct: 64  LRGHGES--GYQTGAWPKTILTQDCRQLVEQLGLKNWVLGGYSLGARISAHFY-WENGHP 120

Query: 124 RSVILGGVG-----SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL 178
             ++L G+G     +   + D+       D F   SI+         FR+      G + 
Sbjct: 121 EMLVLAGMGLEGLTNSYLNLDLFRRAIEQDDFPQASIERFIQGF---FRQ-----SGCNK 172

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDH 238
           +A+ + L   + P   D + +I    L+  G QD   GSP +L   +P++  +   + DH
Sbjct: 173 EAMIALLES-QSPLSPDQVSQISAKTLVLSGKQDQFNGSPLKLKDMLPNAA-IAWVKGDH 230

Query: 239 LLAVGDKQFKQGVVNF 254
           + AVG +     +V+F
Sbjct: 231 MSAVGQRSLAVDIVDF 246


>gi|158313485|ref|YP_001505993.1| hypothetical protein Franean1_1649 [Frankia sp. EAN1pec]
 gi|158108890|gb|ABW11087.1| conserved hypothetical protein [Frankia sp. EAN1pec]
          Length = 235

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 108/238 (45%), Gaps = 12/238 (5%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y  G  D   ++L+HGLASS +  W  +GWI LL + G  V+A D  GHG++ +    + 
Sbjct: 5   YCSGMADIAPVVLVHGLASSSEHGWRAAGWIDLLQEAGREVVAVDLPGHGRARR----DT 60

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGAR--IACSMVLFYPSYVRSVILGGVGSVLY 136
               +  A A       G   V  +G+S GA   + C++    P + R  +L GVG  L 
Sbjct: 61  DPAAYPDAAAEIAEAFAGRGAVDAVGFSAGAHLLLECAVRGLAP-FNRLALL-GVGPRLL 118

Query: 137 DSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD 196
           +        L  +   PS D+  + L +  R  A    GND+ A+ +     R+     +
Sbjct: 119 EPRPQRGPVLGAT---PSEDDGTDILARLIRGLAR-RAGNDMAAVDAFARRPRRTLTTAE 174

Query: 197 LYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           L  +   VLI  G +D+ AGSP+EL +  P +    I   DH     + +    V++F
Sbjct: 175 LAAVGCEVLIVTGERDEGAGSPEELAALFPKATGRTIEGADHYSVQANPRAMNAVLDF 232


>gi|295402065|ref|ZP_06812025.1| alpha/beta hydrolase fold protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294975847|gb|EFG51465.1| alpha/beta hydrolase fold protein [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 277

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 114/257 (44%), Gaps = 35/257 (13%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           D   +LL+HG   SV+T      W   L   + +R+I  D +GHG++D       Y +  
Sbjct: 17  DGEPLLLLHGFTGSVET------WKPFLPYWRDYRLILVDIIGHGRTDSPTDPARYEIEK 70

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW 143
           +AAD   +L HL +   HV+GYSMG R+A +  + YP  VR++IL      L  +    W
Sbjct: 71  VAADLEEILRHLHLQDAHVLGYSMGGRLALTFAILYPHRVRTLILESSSPGL-KTMQERW 129

Query: 144 QSLIDSFLLPSIDEVQNPLGKKFRKFADLDP---------------------GNDLKALA 182
           + +     L   +E++    KKF +  +  P                      N+ K LA
Sbjct: 130 ERIERDEAL--AEEIERYGIKKFVEKWENIPLFASQKRLPLSVRQQIRTERLSNNEKGLA 187

Query: 183 SCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
           + L  +   R+P   + L  + +P L+  G  D       +E+  ++P+ + + + R  H
Sbjct: 188 NSLRGMGTGRQPSWWNRLSEVSIPTLLLCGEWDQKFCRIAEEMKKYLPNCEMVKVARAGH 247

Query: 239 LLAVGDKQFKQGVVNFY 255
            + V  ++    +V+ +
Sbjct: 248 AIHVEQREIFAKIVSEF 264


>gi|206969886|ref|ZP_03230840.1| hydrolase, alpha/beta fold family [Bacillus cereus AH1134]
 gi|206735574|gb|EDZ52742.1| hydrolase, alpha/beta fold family [Bacillus cereus AH1134]
          Length = 270

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 99/218 (45%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W    S W        F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFISSW-----SGQFQVIVVDLVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +  +A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  AHYDIRNVALQMKELLDYLHIEKAHMLGYSMGGRLAITMACLYPEYVRSLLLENCTAGLK 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L K  ++    +   N+ 
Sbjct: 125 SEDERKERCEKDERLADKIEREGIESFVSMWENIPLFETQKRLAKNVQEAVRKERLANNP 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEHDE 222


>gi|87311457|ref|ZP_01093577.1| hypothetical protein DSM3645_25477 [Blastopirellula marina DSM
           3645]
 gi|87285869|gb|EAQ77783.1| hypothetical protein DSM3645_25477 [Blastopirellula marina DSM
           3645]
          Length = 266

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 103/231 (44%), Gaps = 23/231 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HG   +++  W+       L  + F VIA D  GHGKSDK +  +D     M  D 
Sbjct: 27  VILLHGFTRNIEQGWVNYKLFDRLS-EFFHVIALDARGHGKSDKPH--SDVYGKQMYVDI 83

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           V L++HL +   H++GYSMG R++    + YP  VRS +L   G+   D     W  L +
Sbjct: 84  VRLMDHLKLESAHLVGYSMGGRLSLKTTIHYPKRVRSTLLLAAGAGRSDEGRQLWSDLSE 143

Query: 149 SF-----LLPSIDEV----QNPLGKKFRKF-ADLDPGNDLKALASCLSMIRK-PFCQDDL 197
           S      L P +  +    + P  ++     A++  GND  ALA       +     DD+
Sbjct: 144 SLETAGQLHPLMKVLWSNRKPPSERQLTAMNANMMDGNDPLALAGVARGYHELGVTTDDV 203

Query: 198 YRIDVPVLIAVGSQDDLAGS---------PQELMSFIPSSQYLNICRRDHL 239
             I  P+ + +G +D  A S         P      +P + + ++  R  L
Sbjct: 204 AAITTPLQVVIGEEDAAARSDADRLCRDAPHATCILVPGTDHFSLLLRPEL 254


>gi|256394740|ref|YP_003116304.1| alpha/beta hydrolase fold protein [Catenulispora acidiphila DSM
           44928]
 gi|256360966|gb|ACU74463.1| alpha/beta hydrolase fold protein [Catenulispora acidiphila DSM
           44928]
          Length = 268

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 114/243 (46%), Gaps = 25/243 (10%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
             V F+      + A+ ++G+     ++L+HG A    T W   G  +     G+RVI  
Sbjct: 4   TSVSFYAGRDGARLAYRELGEGR--PLVLLHG-AIGDGTMWTRHGQAETFAGHGYRVILP 60

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVM---------------GYSM 107
           D  GHG SDK    + Y    +  DA++LLEHLG+ +                   GYS+
Sbjct: 61  DFRGHGSSDKPQGADAYPGDILTDDALALLEHLGLEEPEAKTETDSLHTPAAYDLGGYSL 120

Query: 108 GARIACSMVLFYPSYVRSVILG-GVGSVL-YDSDVVDWQSLIDSFLLPSIDEVQNPLGKK 165
           GARI   M++   +  R+V+ G G+  VL +   V +    I +   P     Q+     
Sbjct: 121 GARIVVRMLVRGATPGRAVVAGQGLQQVLGFGGGVGEMLRRIVTATEPFEPGSQDERTAA 180

Query: 166 FRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFI 225
           + K  + DP   +  L +  S++  P   +DL R+ VP L+A+G++D  A S + L++ +
Sbjct: 181 WLKAGEEDP---VALLHAVESVVATPV--EDLSRVQVPTLVAMGTEDARAESYEALIAAL 235

Query: 226 PSS 228
           P++
Sbjct: 236 PNA 238


>gi|75762876|ref|ZP_00742689.1| Menaquinone biosynthesis related protein [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218900026|ref|YP_002448437.1| hydrolase, alpha/beta fold family [Bacillus cereus G9842]
 gi|74489635|gb|EAO53038.1| Menaquinone biosynthesis related protein [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218545874|gb|ACK98268.1| hydrolase, alpha/beta fold family [Bacillus cereus G9842]
          Length = 270

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 101/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++     N 
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET---WRSFIPSWSEQ-FQVIVVDLVGHGKTESPEDVNH 66

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +   A     LL++L I K HV+GYSMG R+A ++   YP YV S++L    + L   
Sbjct: 67  YDIRNAALQMKELLDYLHIEKAHVLGYSMGGRLAITLACLYPEYVHSLLLENCTAGLESE 126

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
           +    +   D  L   I+                 E Q  L K  ++    +   N+ K 
Sbjct: 127 EDQKERCEKDERLADKIEREGIRSFVLMWENIPLFETQKSLAKNVQEAVRKERLANNPKG 186

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   D+L+ + +PVL+  G  D+
Sbjct: 187 LANSLRGMGTGAQPSWWDELHNLKMPVLLMNGEHDE 222


>gi|325677289|ref|ZP_08156955.1| hydrolase [Rhodococcus equi ATCC 33707]
 gi|325551986|gb|EGD21682.1| hydrolase [Rhodococcus equi ATCC 33707]
          Length = 265

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 114/248 (45%), Gaps = 20/248 (8%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D P ++L HG A S    W   G++  L D+ F++I  D  GHG+SDK +  + Y +  +
Sbjct: 22  DGPPLVLAHGTALS-SAIWRAFGYVGSLRDE-FQLILPDMRGHGRSDKPHEASSYAMDLV 79

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL----YDS-- 138
             D +++L+ LG  + H +GYS G R+  S+    P  +R++ +GG  S      +D   
Sbjct: 80  VGDILAVLDDLGHDRAHYLGYSFGGRVGLSLATAAPGRLRTLTVGGGSSQPQAGSFDKLF 139

Query: 139 -----DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI-RKPF 192
                DV+D + +  +FL         PL    R   D    ND +AL + L     +P 
Sbjct: 140 FPGCIDVLDHEGMT-AFLDKWNAHRPWPLDPATRAAFD---ANDTRALVAYLRRSEEEPG 195

Query: 193 CQD-DLYRIDVPVLIAVGSQDDLAGS-PQELMSFIPSSQYLNICRRDHLLAVGDKQFKQG 250
             D  L  +DVP L+ VGS+D    S  + L   IP S+   I   DH   V        
Sbjct: 196 VPDTSLQALDVPALLFVGSEDRPRLSDTKRLAELIPGSRLAVIPGFDHATTVAASPEVLA 255

Query: 251 VVNFYANE 258
           VV  + +E
Sbjct: 256 VVRPFLSE 263


>gi|300311050|ref|YP_003775142.1| esterase_lipase superfamily protein [Herbaspirillum seropedicae
           SmR1]
 gi|300073835|gb|ADJ63234.1| esterase_lipase superfamily protein [Herbaspirillum seropedicae
           SmR1]
          Length = 251

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 98/197 (49%), Gaps = 17/197 (8%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           + + P +LL HG  SS++  W F G+  +L  Q +RVI+FD LGHG+SDK +    Y   
Sbjct: 16  EGEGPPLLLHHGFTSSLEA-WRFFGFTDVL-RQHYRVISFDALGHGQSDKPHDSAAYSQH 73

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG-------SVL 135
               DA+++L+   + + H  GYS+G  +   +V   P  +RS+ILG           V 
Sbjct: 74  QRCRDALAVLDAAQVERTHFFGYSLGGWVGYGLVRQAPERLRSLILGAAHPYEDRSWEVF 133

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
              D  D ++ I +F    +DE  +P  K   +      GNDL ALA+     R P  ++
Sbjct: 134 RGIDGTDPEAFIAAF-EDLLDEAISPQVKMLIR------GNDLVALAAAAQQAR-PSQEE 185

Query: 196 DLYRIDVPVLIAVGSQD 212
            L R+D+P L   G  D
Sbjct: 186 LLARMDLPCLFFCGDAD 202


>gi|229169600|ref|ZP_04297303.1| hypothetical protein bcere0007_45470 [Bacillus cereus AH621]
 gi|228613875|gb|EEK70997.1| hypothetical protein bcere0007_45470 [Bacillus cereus AH621]
          Length = 266

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 99/216 (45%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 8   YEVAGSGEP-LLLLHGFTGSMET---WGSFIPSWSEQ-FQVILVDIVGHGKTESPEDVTH 62

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  +A     LL+HL I   H++GYSMG R+A +M   YP YVRS++L    + L  +
Sbjct: 63  YDIQNVALQMKELLDHLHIENAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLESA 122

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
                +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 123 KERKERKEKDERLADKIEQEGIRSFVSMWENIPLFETQKRLAQNVKEAVRKERLANNPKG 182

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  +  PVL+  G  D+
Sbjct: 183 LANSLRGMGTGAQPSWWNELQNLKTPVLLLNGESDE 218


>gi|312109833|ref|YP_003988149.1| alpha/beta hydrolase fold protein [Geobacillus sp. Y4.1MC1]
 gi|311214934|gb|ADP73538.1| alpha/beta hydrolase fold protein [Geobacillus sp. Y4.1MC1]
          Length = 273

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 114/257 (44%), Gaps = 35/257 (13%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           D   +LL+HG   SV+T      W   L   + +R+I  D +GHG++D       Y +  
Sbjct: 17  DGEPLLLLHGFTGSVET------WKPFLPYWRDYRLILVDIIGHGRTDSPTDPARYEIEK 70

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW 143
           +AAD   +L HL +   HV+GYSMG R+A +  + YP  VR++IL      L  +    W
Sbjct: 71  VAADLEEILRHLHLQDAHVLGYSMGGRLALTFAILYPHRVRTLILESSSPGL-KTMQERW 129

Query: 144 QSLIDSFLLPSIDEVQNPLGKKFRKFADLDP---------------------GNDLKALA 182
           + +     L   +E++    KKF +  +  P                      N+ K LA
Sbjct: 130 ERIERDEAL--AEEIERYGIKKFVEKWENIPLFASQKRLPLSVRQQIRTERLSNNEKGLA 187

Query: 183 SCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
           + L  +   R+P   + L  + +P L+  G  D       +E+  ++P+ + + + +  H
Sbjct: 188 NSLRGMGTGRQPSWWNRLSEVSIPTLLLCGEWDQKFCRIAEEMKKYLPNCEMVKVAQAGH 247

Query: 239 LLAVGDKQFKQGVVNFY 255
            + V  ++    +V+ +
Sbjct: 248 AIHVEQREIFAKIVSEF 264


>gi|212638231|ref|YP_002314751.1| alpha/beta superfamily hydrolase [Anoxybacillus flavithermus WK1]
 gi|212559711|gb|ACJ32766.1| Alpha/beta superfamily hydrolase [Anoxybacillus flavithermus WK1]
          Length = 275

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (51%), Gaps = 12/126 (9%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAF 62
           +KF    + Y    Y  G      +LL+HG   S QT W    S W      Q  + IA 
Sbjct: 1   MKFVVGGQTYYVEMYGSGQP----LLLLHGFTGSCQT-WHPFISTW-----SQHMQCIAI 50

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D LGHG++D       Y +  +A D  +LLE L I K HV+GYSMG R+A +  + YP Y
Sbjct: 51  DILGHGRTDAPSAVQRYDIEIVAKDIATLLEQLEIKKAHVLGYSMGGRLALTFAVLYPQY 110

Query: 123 VRSVIL 128
           V+++IL
Sbjct: 111 VQTLIL 116


>gi|217962345|ref|YP_002340917.1| hydrolase, alpha/beta fold family [Bacillus cereus AH187]
 gi|217063622|gb|ACJ77872.1| hydrolase, alpha/beta fold family [Bacillus cereus AH187]
          Length = 270

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 100/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET---WRSFIPSWSEQ-FQVILVDIVGHGKTESPEDVTH 66

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L   
Sbjct: 67  YDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLESE 126

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
           D    +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 127 DERKERCEKDERLAQKIEREGIESFVSMWENIPLFETQKSLAQNVQEAVRKERLANNPKG 186

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 187 LANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEHDE 222


>gi|42784060|ref|NP_981307.1| alpha/beta fold family hydrolase [Bacillus cereus ATCC 10987]
 gi|42739991|gb|AAS43915.1| hydrolase, alpha/beta fold family [Bacillus cereus ATCC 10987]
          Length = 270

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 100/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET---WRSFIPSWSEQ-FQVILVDIVGHGKTESPEDVTH 66

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L   
Sbjct: 67  YDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLESE 126

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
           D    +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 127 DERKERCEKDERLAQKIEREGIESFVSMWENIPLFETQKSLAQNVQEAVRKERLANNPKG 186

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 187 LANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEHDE 222


>gi|116671113|ref|YP_832046.1| putative hydrolase protein [Arthrobacter sp. FB24]
 gi|116611222|gb|ABK03946.1| putative hydrolase protein [Arthrobacter sp. FB24]
          Length = 275

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 109/243 (44%), Gaps = 24/243 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HG +SS + NW  +GW+  L D G RVI  D  GHG+S      + Y    + AD 
Sbjct: 37  VLLLHGFSSSTKLNWQDTGWLAALLDAGRRVITVDLPGHGRSGAPEDMDSYSPSRIRADL 96

Query: 89  VSLLEHLGI---------SKVHVMGYSMGARIACSMVLFYPSYVRSVILGG--VGSVLYD 137
           + +    G+         S + V+GYS+G+R+A       P  V  ++LGG  +   L  
Sbjct: 97  LQVAFDAGVRPLRDGDPASGLDVIGYSLGSRLAWEFGATQPELVHRLVLGGPNIADPLAA 156

Query: 138 SDVVDWQS-LIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIR-KPFCQD 195
            D+V  Q  L D    P  D     L K         P N++ AL S +  I+ +PF   
Sbjct: 157 FDLVAAQRYLADG--TPIADGSTAALLKMALGL----PSNNVFALLSLVEAIKGEPFDPA 210

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSS----QYLNICRRDHLLAVGDKQFKQGV 251
           +     +P+L+  G +DD A +  EL      +    + L I  R+H   +  + FKQ  
Sbjct: 211 EAVP-HMPMLLVAGEKDDRAATMPELAELGAKTGALVEQLLIPGRNHSNVITSRAFKQAA 269

Query: 252 VNF 254
             F
Sbjct: 270 TEF 272


>gi|312141498|ref|YP_004008834.1| alpha/beta hydrolase [Rhodococcus equi 103S]
 gi|311890837|emb|CBH50156.1| putative alpha/beta hydrolase [Rhodococcus equi 103S]
          Length = 265

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 114/248 (45%), Gaps = 20/248 (8%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D P ++L HG A S    W   G++  L D+ F++I  D  GHG+S+K +  + Y +  +
Sbjct: 22  DGPPLVLAHGTALS-SAIWRAFGYVGSLRDE-FQLILPDMRGHGRSEKPHEASSYAMDLV 79

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL----YDS-- 138
             D +++L+ LG  + H +GYS G R+  S+    P  +R++ +GG  S      +D   
Sbjct: 80  VGDILAVLDDLGHDRAHYLGYSFGGRVGLSLATAAPGRLRTLTVGGGSSRPQAGSFDKLF 139

Query: 139 -----DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI-RKPF 192
                DV+D + +  +FL         PL    R   D    ND +AL + L     +P 
Sbjct: 140 FPGCIDVLDHEGMT-AFLDKWNAHRPWPLDPATRAAFD---ANDTRALVAYLRRSEEEPG 195

Query: 193 CQD-DLYRIDVPVLIAVGSQDDLAGS-PQELMSFIPSSQYLNICRRDHLLAVGDKQFKQG 250
             D  L  +DVP L+ VGS+D    S  + L   IP S+   I   DH   V        
Sbjct: 196 VPDTSLQALDVPTLLFVGSEDRPRLSDTKRLAELIPGSRLAVIPGFDHATTVAASPEVLA 255

Query: 251 VVNFYANE 258
           VV  + +E
Sbjct: 256 VVRPFLSE 263


>gi|163942593|ref|YP_001647477.1| alpha/beta hydrolase fold [Bacillus weihenstephanensis KBAB4]
 gi|163864790|gb|ABY45849.1| alpha/beta hydrolase fold [Bacillus weihenstephanensis KBAB4]
          Length = 270

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 100/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 12  YEVAGSGEP-LLLLHGFTGSMET---WGSFIPSWSEQ-FQVILVDIVGHGKTESPEDVTH 66

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  +A     LL+HL I   H++GYSMG R+A +M   YP YVRS++L    + L  +
Sbjct: 67  YDIQNVALQMKELLDHLHIENAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLESA 126

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
                +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 127 KERKERKEKDERLADKIEQEGIRSFVSMWENIPLFETQKRLVQNVKEAVRKERLANNPKG 186

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 187 LANSLRGMGTGAQPSWWNELQNLKMPVLLMNGESDE 222


>gi|229062549|ref|ZP_04199860.1| hypothetical protein bcere0026_46160 [Bacillus cereus AH603]
 gi|228716723|gb|EEL68417.1| hypothetical protein bcere0026_46160 [Bacillus cereus AH603]
          Length = 266

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 100/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 8   YEVAGSGEP-LLLLHGFTGSMET---WGSFIPSWSEQ-FQVILVDIVGHGKTESPEDVTH 62

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  +A     LL+HL I   H++GYSMG R+A +M   YP YVRS++L    + L  +
Sbjct: 63  YDIQNVALQMKELLDHLHIENAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLESA 122

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
                +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 123 KERKERKEKDERLADKIEQEGIRIFVSMWENIPLFETQKRLVQNVKEAVRKERLANNPKG 182

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 183 LANSLRGMGTGAQPSWWNELQNLKMPVLLLNGESDE 218


>gi|229135704|ref|ZP_04264481.1| hypothetical protein bcere0014_45920 [Bacillus cereus BDRD-ST196]
 gi|228647802|gb|EEL03860.1| hypothetical protein bcere0014_45920 [Bacillus cereus BDRD-ST196]
          Length = 266

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 100/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 8   YEVAGSGEP-LLLLHGFTGSMET---WGSFIPSWSEQ-FQVILVDIVGHGKTESPEDVTH 62

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  +A     LL+HL I   H++GYSMG R+A +M   YP YVRS++L    + L  +
Sbjct: 63  YDIQNVALQMKELLDHLHIENAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLESA 122

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
                +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 123 KERKERKEKDERLADKIEQEGIRSFVSMWENIPLFETQKRLVQSVKEAVRKERLANNPKG 182

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 183 LANSLRGMGTGAQPSWWNELQNLKMPVLLLNGESDE 218


>gi|290956777|ref|YP_003487959.1| hydrolase [Streptomyces scabiei 87.22]
 gi|260646303|emb|CBG69398.1| putative hydrolase [Streptomyces scabiei 87.22]
          Length = 275

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 110/237 (46%), Gaps = 35/237 (14%)

Query: 19  YDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           YD  GD DAP +LLI GL + +   W  + + +L+ D GF V+ FDN   G S K + + 
Sbjct: 14  YDTFGDPDAPPLLLIQGLGAHM-LGW-HADFCRLIADAGFHVVRFDNRDVGLSQK-FPQG 70

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL------GG- 130
            Y L  MA DA SLL  L I   H++G SMG  IA  + L +P+ V S+ L       G 
Sbjct: 71  GYTLADMANDAASLLTALEIPAAHIVGQSMGGMIAQQLTLDHPTQVLSLALIYTAPNAGF 130

Query: 131 -VGSVLYDSDV---------------VDWQSLIDSFLLPS-IDEVQNPLGKKFRKFADLD 173
            VG  L D                  +D ++   S   P  ID ++   G+ +R+  D D
Sbjct: 131 LVGRDLVDERTQRPRARDQDEAIALYLDNEAACASPGYPQDIDWLRELGGQTYRR--DYD 188

Query: 174 PGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL--AGSPQELMSFIPSS 228
           P   ++ +    ++   P     L+RI VP  I  G  D L  +G+ Q +   IP S
Sbjct: 189 PDGIVRQME---ALDNSPDRAPHLHRITVPTTIVHGDGDQLIDSGASQAMHELIPDS 242


>gi|324328758|gb|ADY24018.1| hydrolase [Bacillus thuringiensis serovar finitimus YBT-020]
          Length = 270

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 99/216 (45%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  ++    +Q F+VI  D +GHGK++       
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET---WRSFVPSWSEQ-FQVILVDIVGHGKTESPEDVTH 66

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +   A     LLE+L I K H++GYSMG R+A +M   YP YV S++L    + L   
Sbjct: 67  YDIRNAALQMKELLEYLHIEKAHILGYSMGGRLAITMACLYPEYVHSLLLENCTAGLKSE 126

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
           D    +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 127 DERKERREKDERLADKIEREGIGNFVTMWENIPLFETQKRLAQNVQEAVRKERLANNQKG 186

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 187 LANSLRGMGTGAQPSWWNELKNLKMPVLLMNGEHDE 222


>gi|294011674|ref|YP_003545134.1| putative alpha/beta hydrolase [Sphingobium japonicum UT26S]
 gi|292675004|dbj|BAI96522.1| putative alpha/beta hydrolase [Sphingobium japonicum UT26S]
          Length = 253

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 105/228 (46%), Gaps = 9/228 (3%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHG  S+  TNW+  G    L + GFR+I  D  GHG+S K +    Y    +  D 
Sbjct: 30  LVLIHGYFSNAWTNWIRYGHAARLVEAGFRLILPDLRGHGESGKPHDPAAYPPDALTEDG 89

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG--SVLYDSDVVDWQSL 146
           ++L+E +G++   + GYS+GAR    M L   +  R VIL G+G   ++   D   +   
Sbjct: 90  LALVEQMGLTDYDLGGYSLGARTTVRM-LARGATPRRVILAGMGLRGLVQTLDNGGYYRK 148

Query: 147 IDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLI 206
           + + L          + + F K    DP   L  L + +   R     D +     P  +
Sbjct: 149 VLTNLGTFERGTSEWMTEAFLKTTKGDPVAMLHILNTFVDTPR-----DVIAGFQQPTEV 203

Query: 207 AVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             G+ D   G  QEL   +P+ +Y+ I   +H+ AV  K+  Q + +F
Sbjct: 204 ICGADDRDNGVAQELADLLPNGRYVEIP-GNHMNAVTRKELGQAMADF 250


>gi|307292820|ref|ZP_07572666.1| alpha/beta hydrolase fold protein [Sphingobium chlorophenolicum
           L-1]
 gi|306880886|gb|EFN12102.1| alpha/beta hydrolase fold protein [Sphingobium chlorophenolicum
           L-1]
          Length = 253

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 105/228 (46%), Gaps = 9/228 (3%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHG  S+  TNW+  G    L + GFR+I  D  GHG+S K +    Y    +  D 
Sbjct: 30  LVLIHGYFSNAWTNWIRYGHAAKLVEAGFRLILPDLRGHGESGKPHDAAAYPPDALTEDG 89

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG--SVLYDSDVVDWQSL 146
           ++L+E LG++   + GYS+GAR +  M L   +  R VIL G+G   ++   D   +   
Sbjct: 90  LALVEQLGLTDYDLGGYSLGARTSVRM-LARGATPRRVILAGMGLRGLVQTLDNGGYYRK 148

Query: 147 IDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLI 206
           +   L          + + F K    DP   L  L + +   R+            P  +
Sbjct: 149 VLINLGTFERGTSEWMTEAFLKTTKGDPVAMLNILNTFVDTPREVIAG-----FQQPTEV 203

Query: 207 AVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             G+ D   G  QEL   +P+ +Y+ I   +H+ AV  K+  Q +V+F
Sbjct: 204 ICGADDRDNGVAQELADLLPNGRYVEIP-GNHMNAVTRKELGQAMVDF 250


>gi|326942641|gb|AEA18537.1| menaquinone biosynthesis related protein [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 270

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 102/216 (47%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET---WRSFIPSWSEQ-FQVIVVDLVGHGKTESPEDVAH 66

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  +A     LL++L I K H++GYSMG R+A +M   YP YV S++L    + L + 
Sbjct: 67  YDIRNVALQMKELLDYLQIEKAHILGYSMGGRLAITMACLYPDYVHSLLLENCTAGLENE 126

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
           +    +   D  L   I+                 E Q  L K  ++    +   N+ K 
Sbjct: 127 EDRKERREKDDRLANKIEREGVQSFVSMWENIPLFETQKRLAKNVQEAVRKERLANNPKG 186

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   D+L+ + +PVL+  G  D+
Sbjct: 187 LANSLRGMGTGAQPSWWDELHNLKMPVLLMNGEYDE 222


>gi|301056368|ref|YP_003794579.1| hydrolase [Bacillus anthracis CI]
 gi|300378537|gb|ADK07441.1| hydrolase; menaquinone biosynthesis related protein; possible
           prolyl aminopeptidase [Bacillus cereus biovar anthracis
           str. CI]
          Length = 270

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 98/218 (44%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  THYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLE 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 REDERKERCEKDERLADKIEREGIESFVSMWESIPLFETQKRLAQNVQEAVRKERLANNP 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWNELKNLKMPVLLMNGEHDE 222


>gi|218233875|ref|YP_002369669.1| SHCHC synthase [Bacillus cereus B4264]
 gi|218161832|gb|ACK61824.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylante synthase
           [Bacillus cereus B4264]
          Length = 270

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 107/220 (48%), Gaps = 34/220 (15%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W    S W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFISSW-----SEQFQVIVVDLVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +  +A     LL++L I KVH++GYSMG R+A +M   YP YV S++L    + L 
Sbjct: 65  AHYDIRNVALQMKELLDYLHIEKVHILGYSMGGRLAITMACLYPDYVHSLLLENCTAGLE 124

Query: 137 D--------------SDVVDWQSLIDSFL-----LPSIDEVQNPLGKKFRKFADLDP-GN 176
           D              +D ++ +  I+SF+     +P +   Q  L K  ++    +   N
Sbjct: 125 DEADRKERREKDDRLADKIEREG-IESFVSMWKNIP-LFATQKRLAKNVQEAVRKERLAN 182

Query: 177 DLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           + K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 183 NPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEYDE 222


>gi|229014065|ref|ZP_04171188.1| hypothetical protein bmyco0001_44720 [Bacillus mycoides DSM 2048]
 gi|228747211|gb|EEL97091.1| hypothetical protein bmyco0001_44720 [Bacillus mycoides DSM 2048]
          Length = 266

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 100/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 8   YEVAGSGEP-LLLLHGFTGSMET---WGSFIPSWSEQ-FQVILVDIVGHGKTESPEDVMH 62

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  +A     LL+HL I   H++GYSMG R+A +M   YP YVRS++L    + L  +
Sbjct: 63  YDIQNVALQMKELLDHLHIENAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLESA 122

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
                +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 123 KERKERKEKDERLADKIEQEGIRSFVSMWENIPLFETQKRLVQNVKEAVRKERLANNPKG 182

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 183 LANSLRGMGTGAQPSWWNELQNLKMPVLLLNGESDE 218


>gi|14210844|gb|AAK57191.1|AF319998_10 putative acetyl transferase [Stigmatella aurantiaca]
          Length = 286

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 100/231 (43%), Gaps = 13/231 (5%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HG   +    W+  G+ Q L   G RVI  D  GHG+SDK    + Y    M  D 
Sbjct: 57  VVLLHGFLGTASGTWVAPGFAQALAAAGHRVILLDQRGHGESDKPLEPSAYG-EQMVTDV 115

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           + +L+ L I++ HV GYSMG  +   ++   P    +  LGG G V  D  +    + +D
Sbjct: 116 IEMLDDLKINQAHVGGYSMGGEMTAMLMRRVPERFITAHLGGAGIVETDEALRAAAAALD 175

Query: 149 SFLLPSIDEVQNP-LGKKFRKFADLDPGNDLKALASCLSMI----RKPFCQDDLYRIDVP 203
               P   + + P +   F +     P  D + +A+          +P    DL  ID P
Sbjct: 176 ----PKGTDPEEPRILALFEEATANLPPPDPRVIAAMTEAWAVWGPRPV---DLTVIDFP 228

Query: 204 VLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           VL   G  D+       +   +   + + + RR HL  + D  + Q +V F
Sbjct: 229 VLTVNGEFDNPYSKTLRMTRELSQFENVVVPRRSHLTTLIDPLYLQSLVAF 279


>gi|296505321|ref|YP_003667021.1| menaquinone biosynthesis related protein [Bacillus thuringiensis
           BMB171]
 gi|296326373|gb|ADH09301.1| menaquinone biosynthesis related protein [Bacillus thuringiensis
           BMB171]
          Length = 270

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 101/218 (46%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W    S W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFISSW-----SEQFQVIVVDLVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +  +A     LL++L I K H++GYSMG R+A +M   YP YV S++L    + L 
Sbjct: 65  AHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPDYVHSLLLENCTAGLE 124

Query: 137 DS-----------------DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDP-GNDL 178
           +                  +  D +S +  +    + E Q  L K  ++    +   N+ 
Sbjct: 125 NEADRKERREKDDRLADKIEREDIESFVSMWENIPLFETQKRLAKNVQEAVRKERLANNP 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEYDE 222


>gi|308178429|ref|YP_003917835.1| putative hydrolase [Arthrobacter arilaitensis Re117]
 gi|307745892|emb|CBT76864.1| putative hydrolase [Arthrobacter arilaitensis Re117]
          Length = 261

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 107/233 (45%), Gaps = 18/233 (7%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F+D        IL +HG A S ++ W   G+ + L  +G R I  D  GHGKS KS+   
Sbjct: 12  FFDDDQDGGEPILFLHGSALS-RSIWRGLGYTKALG-EGHRTIRMDLRGHGKSAKSHDVA 69

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
           DY +  +  D  ++L+HLGI ++H++GYS GAR    M + +P  V S+I+ G    + D
Sbjct: 70  DYTMDKVVGDIQAVLDHLGIERIHIVGYSFGARTGLHMAMHHPEQVISLIMLGGTYEITD 129

Query: 138 SDV----------VDWQSLIDSFLLPSIDEVQNPLGKKFR-KFADLDPGNDLKALASCLS 186
            ++          V     I+ F++    E    L    R  F   DP        +  +
Sbjct: 130 GEIGKLFFPGYLEVLRNGDIEGFVIGQ--EKNGRLDPSTRLAFKSNDPLALAAYYEAAET 187

Query: 187 MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM-SFIPSSQYLNICRRDH 238
           +        DL +I +P L+ +G++D       ++M   +P ++ + +  R H
Sbjct: 188 LQNIDLA--DLAKIRIPTLLLIGTRDQPRFDQNKIMVRTLPDARMVVLPERTH 238


>gi|49481645|ref|YP_038899.1| hydrolase; menaquinone biosynthesis related protein; prolyl
           aminopeptidase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|49333201|gb|AAT63847.1| hydrolase; menaquinone biosynthesis related protein; possible
           prolyl aminopeptidase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
          Length = 270

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 98/218 (44%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  THYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLE 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 REDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNS 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 222


>gi|30022922|ref|NP_834553.1| menaquinone biosynthesis related protein [Bacillus cereus ATCC
           14579]
 gi|29898481|gb|AAP11754.1| Menaquinone biosynthesis related protein [Bacillus cereus ATCC
           14579]
          Length = 270

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 101/218 (46%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W    S W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVSSW-----SEQFQVIVVDLVGHGKTESPENV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +  +A     LL++L I K H++GYSMG R+A +M   YP YV S++L    + L 
Sbjct: 65  VHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPDYVHSLLLENCTAGLE 124

Query: 137 DS-----------------DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDP-GNDL 178
           +                  +  D +S +  +    + E Q  L K  ++    +   N+ 
Sbjct: 125 NEADRKERREKDDRLADKIEREDIESFVSMWENIPLFETQKRLAKNVQEAVRKERLANNP 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEYDE 222


>gi|225866854|ref|YP_002752232.1| hydrolase, alpha/beta fold family [Bacillus cereus 03BB102]
 gi|225790778|gb|ACO30995.1| alpha/beta hydrolase family protein [Bacillus cereus 03BB102]
          Length = 270

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 98/218 (44%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +  +A     LL++L I K H++GYSMG R+A +M   YP YV S++L    + L 
Sbjct: 65  THYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVHSLLLENCTAGLK 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 SEDERKERCEKDERLADKIEREGIESFVSMWESIPLFETQKRLAQNLQEAVRKERLANNP 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEHDE 222


>gi|228993594|ref|ZP_04153502.1| hypothetical protein bpmyx0001_43210 [Bacillus pseudomycoides DSM
           12442]
 gi|228999630|ref|ZP_04159207.1| hypothetical protein bmyco0003_41850 [Bacillus mycoides Rock3-17]
 gi|228760156|gb|EEM09125.1| hypothetical protein bmyco0003_41850 [Bacillus mycoides Rock3-17]
 gi|228766185|gb|EEM14831.1| hypothetical protein bpmyx0001_43210 [Bacillus pseudomycoides DSM
           12442]
          Length = 257

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 110/242 (45%), Gaps = 30/242 (12%)

Query: 29  ILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           +LL+HG   S++T W      W      + F+VI  D +GHGK++       Y +  +A 
Sbjct: 8   LLLLHGFTGSMET-WHSFIPAW-----SKQFQVITVDLVGHGKTESPEELMHYDIQNVAL 61

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL-YDSDVVDWQS 145
              +LL+HL I K H++GYSMG R+A +M   YP+ V+S++L    + L  +SD  + ++
Sbjct: 62  QMTTLLDHLNIEKAHILGYSMGGRLAITMACLYPNRVKSLLLENCTAGLEMESDRKERRA 121

Query: 146 ----LIDSFLLPSIDEVQN-----PLGKKFRKFAD--------LDPGNDLKALASCLSMI 188
               L D   L  I+   N     PL    +K +             N+ K LA+ L  +
Sbjct: 122 RDEQLADRIELERIEAFVNRWENIPLFATQKKLSQGVQEQVRKERLANNPKGLANSLRGM 181

Query: 189 ---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDHLLAVGD 244
               +P     L  + +PVL+  G  D       Q +   IP ++++ I    H + V  
Sbjct: 182 GTGAQPSWWSQLEELKMPVLLMNGESDQKFFHILQNIQKRIPHAKFVKIDGAGHAIHVEQ 241

Query: 245 KQ 246
            Q
Sbjct: 242 PQ 243


>gi|330502243|ref|YP_004379112.1| 3-oxoadipate enol-lactonase [Pseudomonas mendocina NK-01]
 gi|328916529|gb|AEB57360.1| 3-oxoadipate enol-lactonase [Pseudomonas mendocina NK-01]
          Length = 265

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 107/238 (44%), Gaps = 22/238 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  + D G      +LL+HGL SS + +W +   I +L  + +RVIA D  GHG+SDK  
Sbjct: 10  QLHYEDYGHGQ--PLLLVHGLGSSTR-DWEYQ--IPVLA-RHYRVIALDVRGHGRSDKP- 62

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               YR+   A D  +L+E L +  VH++G SMG  I   + +  P  +RS+ +   G  
Sbjct: 63  -RGAYRIADFANDVAALIEFLQLPPVHLVGISMGGMIGFQLGVDRPELLRSLTIVNSGPE 121

Query: 135 LYDSDVVDWQSLIDSFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKAL 181
           +      DW  +   + L    S++ +   L K            RK  +  P ND +A 
Sbjct: 122 VKARSARDWLEIGKRWTLSRLLSLETIAKALAKLLFPKPEQAELRRKVEERWPQNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRDH 238
            + L  I     ++ L RI  P L+    +D       +E ++ +P ++ L I    H
Sbjct: 182 LASLDAIIGWGVRERLGRITSPTLVITADRDYTPVERKREYVAEMPDARLLVIENSRH 239


>gi|284992583|ref|YP_003411137.1| alpha/beta hydrolase fold protein [Geodermatophilus obscurus DSM
           43160]
 gi|284065828|gb|ADB76766.1| alpha/beta hydrolase fold protein [Geodermatophilus obscurus DSM
           43160]
          Length = 262

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 110/235 (46%), Gaps = 10/235 (4%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D P + L HG  +  + NW+ +G + +L   G  V+  D  GHG+SDK +    Y  + M
Sbjct: 28  DLPPVYLQHGFVADTRLNWVGTGTVGVLLSAGREVVGVDARGHGRSDKPHDPAAYGELRM 87

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ 144
           A D   + + LG     + GYSMGA +A  +       VR +++GG G+   +S   +  
Sbjct: 88  ADDLRRVADALGHDSFDLAGYSMGATVAM-LTAATDRRVRRLVVGGAGAAFVESGGAERH 146

Query: 145 SLIDSFLLPSID-----EVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYR 199
            ++ + L  +++     +V++P    FR+ AD    +     A   ++  +   + DL  
Sbjct: 147 RVLMARLAAALEATDVGDVRDPATVDFRRMADALAADRRALAAHARAVHTR---EVDLAA 203

Query: 200 IDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           I  P L+  G  D LA  P+ L + IP ++ + +   DH   +    F   +V+F
Sbjct: 204 ITAPTLVLAGDADPLAARPEALAAAIPGAR-VAVVPGDHSTTLRTPAFAAALVDF 257


>gi|152989488|ref|YP_001347457.1| putative hydrolytic enzyme [Pseudomonas aeruginosa PA7]
 gi|150964646|gb|ABR86671.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA7]
          Length = 333

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 113/241 (46%), Gaps = 43/241 (17%)

Query: 16  FAFYDVGDK--DAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K  +  TI+L+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 52  MAYLDVAPKRPNGRTIVLMHG------KNFCAGTWERTIDVLADAGYRVIAADQVGFCKS 105

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+   LLEHLGI++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 106 SKP-AHYQYSFQQLAANTRGLLEHLGITRASVIGHSMGGMLATRYALLYPRQVERLVLVN 164

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 165 PIGLEDWKALGVPWRSVDDWYRRDLQASAEGIRQYQQATYYAGEWRPEFERWVQMQAGMY 224

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ VP L+ +G +D+ A     +P EL 
Sbjct: 225 RGKGREAVAWNSALTYDMI---FTQPVVYELDRLQVPTLLLIGEKDNTAIGKDAAPAELK 281

Query: 223 S 223
           +
Sbjct: 282 A 282


>gi|330984905|gb|EGH83008.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 262

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 115/258 (44%), Gaps = 25/258 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
            +  Y +G+     +LL+HGL SS Q +W +   I  L  Q +RVI  D  GHG+SDK Y
Sbjct: 12  HYEEYGLGE----PVLLLHGLGSSCQ-DWEYQ--IPALASQ-YRVIVMDMRGHGRSDKPY 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  M+ D  +L+EHL +  VH++G SMG  I   + +  P  ++S+ +      
Sbjct: 64  --GRYSIQAMSNDVEALIEHLRLGPVHLIGLSMGGMIGFQLAVDQPRLLKSLCIVNSAPQ 121

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQN---PLGKKF----------RKFADLDPGNDLKAL 181
           +      D   L   + L  I  +Q     LGK            RK A+    ND +A 
Sbjct: 122 VKVRSAGDLWQLARRWTLSRIVSMQTLGEALGKLLFPKPEQADLRRKMAERWGKNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLL 240
            +    I     ++ L RI  P LI     D    S +E  +  +P+++ L I    H  
Sbjct: 182 LASFDAIVGWGVENKLGRITCPTLIIAAEHDYTPVSLKEAYVKRLPNARLLVIKDSRHAT 241

Query: 241 AVGD-KQFKQGVVNFYAN 257
            +   +QF + ++ F A+
Sbjct: 242 PLDQPEQFNRTLLEFMAS 259


>gi|228955137|ref|ZP_04117151.1| hypothetical protein bthur0006_45010 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228804548|gb|EEM51153.1| hypothetical protein bthur0006_45010 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 240

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 83/178 (46%), Gaps = 21/178 (11%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +M 
Sbjct: 15  FQVIVVDLVGHGKTESPEDVAHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMA 74

Query: 117 LFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------EVQ 159
             YP YVRS++L    + L   D    +   D  L   I+                 E Q
Sbjct: 75  CLYPEYVRSLLLENCTAGLKSEDERKERCEKDERLADKIEREGIESFVSMWENIPLFETQ 134

Query: 160 NPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
             L K  ++    +   N+ K LA+ L  +    +P   D+L+ + +PVL+  G  D+
Sbjct: 135 KRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELHNLKMPVLLMNGEHDE 192


>gi|229163857|ref|ZP_04291798.1| hypothetical protein bcere0009_46210 [Bacillus cereus R309803]
 gi|228619599|gb|EEK76484.1| hypothetical protein bcere0009_46210 [Bacillus cereus R309803]
          Length = 262

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 100/216 (46%), Gaps = 26/216 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  ++    +Q F+VI  D +GHGK++       
Sbjct: 4   YEVIGSGEP-LLLLHGFTGSMET---WRSFVPSWSEQ-FQVILVDIVGHGKTESPEDVTR 58

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +   A     LL++L I K H++GYSMG R+A +M   YP YV S++L    + L   
Sbjct: 59  YDIRNAAVQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVHSLLLENCTAGLKSE 118

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
           D  + +   D  L   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 119 DEREERLEKDERLADKIEREGIGNFVTMWENIPLFETQKRLAQNVQEAVRKERLANNPKG 178

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 179 LANSLRGMGTGAQPSWWNELPNLKMPVLLMNGEHDE 214


>gi|229181175|ref|ZP_04308507.1| hypothetical protein bcere0005_45180 [Bacillus cereus 172560W]
 gi|228602366|gb|EEK59855.1| hypothetical protein bcere0005_45180 [Bacillus cereus 172560W]
          Length = 240

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   D    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLKSEDERKERCEKDERLADKIEREGIESFVSMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 133 TQKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEHDE 192


>gi|329915688|ref|ZP_08276298.1| 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone
           decarboxylase [Oxalobacteraceae bacterium IMCC9480]
 gi|327544857|gb|EGF30231.1| 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone
           decarboxylase [Oxalobacteraceae bacterium IMCC9480]
          Length = 269

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 107/225 (47%), Gaps = 38/225 (16%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFRVIAFDNLGHGKS 70
            Y   + D G    P ++LIHGLA        +S W+  +    Q +RVIAFDN G G+S
Sbjct: 12  NYTLRYIDEGS--GPAVVLIHGLAGD------YSAWLAQIAVLRQSYRVIAFDNRGAGQS 63

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG- 129
            +  ++       +A D + L++HL I++ HV+G SMG  +A  M L  P+ V S++L  
Sbjct: 64  TQ--VDEPVSTADLARDTLGLMDHLQIARAHVVGRSMGGAVAQQMALLAPARVLSMVLCA 121

Query: 130 --------GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF-----RKFADLDP-- 174
                   G   +L   D ++W+    S+   +   VQN +   F      + A ++   
Sbjct: 122 SFARLDPLGRRVLLNMRDALEWRM---SWADHARHSVQNFVSADFFNSQPERVAAIERLI 178

Query: 175 GNDLKALASCLSMIRKPFCQD-----DLYRIDVPVLIAVGSQDDL 214
           G + + L +C  + +   CQ+     DL RI  PVL+  G+ D +
Sbjct: 179 GGETR-LPACY-VRQNTACQEHDTLPDLARIHQPVLVMAGASDPI 221


>gi|218906079|ref|YP_002453913.1| hydrolase, alpha/beta fold family [Bacillus cereus AH820]
 gi|218539696|gb|ACK92094.1| hydrolase, alpha/beta fold family [Bacillus cereus AH820]
          Length = 270

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 97/218 (44%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  THYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLE 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 REDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNS 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
             LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 185 NGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 222


>gi|229020111|ref|ZP_04176891.1| hypothetical protein bcere0030_46050 [Bacillus cereus AH1273]
 gi|229026339|ref|ZP_04182698.1| hypothetical protein bcere0029_46170 [Bacillus cereus AH1272]
 gi|228735055|gb|EEL85691.1| hypothetical protein bcere0029_46170 [Bacillus cereus AH1272]
 gi|228741186|gb|EEL91404.1| hypothetical protein bcere0030_46050 [Bacillus cereus AH1273]
          Length = 266

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 113/246 (45%), Gaps = 27/246 (10%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V     P +LL+HG   S++T   +  +I    +Q F+VI  D +GHGK++       
Sbjct: 8   YEVVGSGEP-LLLLHGFTGSMET---WRSFIPSWSEQ-FQVILVDIVGHGKTESPEDVTH 62

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y +  +A     LL++L I K H++GYSMG R+A +M   YP YV S++L    + L ++
Sbjct: 63  YDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAVTMACLYPEYVCSLVLENCTAGLENA 122

Query: 139 DVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKA 180
           D    +   D  +   I+                 E Q  L +  ++    +   N+ K 
Sbjct: 123 DARKERQEKDERIADKIEQEGIRSFVTMWENIPLFETQKRLEQNVKEAVRKERLANNPKG 182

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRR 236
           LA+ L  +    +P    +L  + +PVL+  G  D+      + +   IP ++++ I   
Sbjct: 183 LANSLRGMGTGAQPSWWKELQNLKMPVLLLNGEYDEKFFRILKNIEKCIPHAKFVKIDGA 242

Query: 237 DHLLAV 242
            H + V
Sbjct: 243 GHAIHV 248


>gi|118479974|ref|YP_897125.1| alpha/beta fold family hydrolase [Bacillus thuringiensis str. Al
           Hakam]
 gi|196032945|ref|ZP_03100358.1| hydrolase, alpha/beta fold family [Bacillus cereus W]
 gi|196044047|ref|ZP_03111284.1| hydrolase, alpha/beta fold family [Bacillus cereus 03BB108]
 gi|254725225|ref|ZP_05187008.1| alpha/beta fold family hydrolase [Bacillus anthracis str. A1055]
 gi|118419199|gb|ABK87618.1| hydrolase, alpha/beta fold family [Bacillus thuringiensis str. Al
           Hakam]
 gi|195994374|gb|EDX58329.1| hydrolase, alpha/beta fold family [Bacillus cereus W]
 gi|196025383|gb|EDX64053.1| hydrolase, alpha/beta fold family [Bacillus cereus 03BB108]
          Length = 270

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 97/218 (44%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  THYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLE 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 REDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNS 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
             LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 185 NGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 222


>gi|229072363|ref|ZP_04205567.1| hypothetical protein bcere0025_45250 [Bacillus cereus F65185]
 gi|229082115|ref|ZP_04214591.1| hypothetical protein bcere0023_47390 [Bacillus cereus Rock4-2]
 gi|228701197|gb|EEL53707.1| hypothetical protein bcere0023_47390 [Bacillus cereus Rock4-2]
 gi|228710788|gb|EEL62759.1| hypothetical protein bcere0025_45250 [Bacillus cereus F65185]
          Length = 240

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 82/178 (46%), Gaps = 21/178 (11%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +M 
Sbjct: 15  FQVIVVDLVGHGKTESPEDVAHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMA 74

Query: 117 LFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------EVQ 159
             YP YVRS++L    + L   D    +   D  L   I+                 E Q
Sbjct: 75  CLYPEYVRSLLLENCTAGLKSEDERKERCEKDERLADKIEREGIESFVSMWENIPLFETQ 134

Query: 160 NPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
             L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 135 KRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEHDE 192


>gi|206977013|ref|ZP_03237914.1| hydrolase, alpha/beta fold family [Bacillus cereus H3081.97]
 gi|222098330|ref|YP_002532387.1| hydrolase, alpha/beta fold family [Bacillus cereus Q1]
 gi|206744818|gb|EDZ56224.1| hydrolase, alpha/beta fold family [Bacillus cereus H3081.97]
 gi|221242388|gb|ACM15098.1| hydrolase, alpha/beta fold family [Bacillus cereus Q1]
          Length = 270

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 100/218 (45%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +  +A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  THYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLE 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             +  + +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 REEEREERCEKDERLAQKIEREGIESFVSMWENIPLFETQKRLAQNVQEAVRKERLANNP 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWNELKNLKIPVLLMNGEHDE 222


>gi|85708899|ref|ZP_01039965.1| hydrolase [Erythrobacter sp. NAP1]
 gi|85690433|gb|EAQ30436.1| hydrolase [Erythrobacter sp. NAP1]
          Length = 262

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 114/256 (44%), Gaps = 22/256 (8%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F S+   + A +  G+     ++L+HGL SS   NW   G    L D GF  I  D   H
Sbjct: 17  FESFDGTRLAVHRAGE--GRPVVLLHGLFSSAFMNWTKWGHHTRLADAGFEAIMLDFRVH 74

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGIS--KVHVMGYSMGARIACSMV---LFYPSY 122
           G SD  +    Y    +  DA +L+EHL +   +  ++G+S+GAR A   V   +  P  
Sbjct: 75  GDSDAPHDPASYPKGVLVRDAAALVEHLALEPGEFDLVGFSLGARTAIHAVGHGILEPRK 134

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQ--NP--LGKKFRKFADLDPGNDL 178
           +    +G  G   ++     ++ +ID F     D ++  +P  + + F K   +D     
Sbjct: 135 LAICGMGVAGLAEWERRAAHFKRVIDEF-----DTIKPGDPAYVARTFLKSQGVD----- 184

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDH 238
           +  A  L    + F    L  I +P  +  G +D+  GS +EL + +P++ Y  +    H
Sbjct: 185 RIAARLLLDAMEDFDLARLASITMPTGVICGDEDNDNGSAEELTALLPNATYYEVP-GSH 243

Query: 239 LLAVGDKQFKQGVVNF 254
           L +V   +  + +V F
Sbjct: 244 LNSVTKPELGEALVEF 259


>gi|330994202|ref|ZP_08318130.1| Dihydrolipoyllysine-residue acetyltransferase component of acetoin
           cleaving system [Gluconacetobacter sp. SXCC-1]
 gi|329758669|gb|EGG75185.1| Dihydrolipoyllysine-residue acetyltransferase component of acetoin
           cleaving system [Gluconacetobacter sp. SXCC-1]
          Length = 380

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 6/116 (5%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           +Y    ++ G+ D   ++LIHG    ++ NW+F+        QG RVIAFD  GHG S K
Sbjct: 123 EYTLRLHERGEGDEIPLVLIHGFGGDLK-NWMFN---HAALAQGRRVIAFDLPGHGGSSK 178

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
                   L F A   + LL+HL + +VHVMG+S+G  IA ++    P  V S++L
Sbjct: 179 DV--GPGTLEFFAGVTIRLLDHLDLPRVHVMGHSLGGGIALTLARMAPQRVASLVL 232


>gi|330889629|gb|EGH22290.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 262

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 115/258 (44%), Gaps = 25/258 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
            +  Y +G+     +LL+HGL SS Q +W +   I  L  Q +RVI  D  GHG+SDK Y
Sbjct: 12  HYEEYGLGE----PVLLLHGLGSSCQ-DWEYQ--IPALASQ-YRVIVMDMRGHGRSDKPY 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  M+ D  +L+EHL +  VH++G SMG  I   + +  P  ++S+ +      
Sbjct: 64  --GRYSIQAMSNDVEALIEHLRLGPVHLIGLSMGGMIGFQLAVDQPHLLKSLCIVNSAPQ 121

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQN---PLGKKF----------RKFADLDPGNDLKAL 181
           +      D   L   + L  I  +Q     LGK            RK A+    ND +A 
Sbjct: 122 VKVRSAGDLWQLARRWTLSRIVSMQTLGEALGKLLFPKPEQADLRRKMAERWGKNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLL 240
            +    I     ++ L RI  P LI     D    S +E  +  +P+++ + I    H  
Sbjct: 182 LASFDAIVGWGVENKLGRITCPTLIIAAEHDYTPVSLKEAYVKRLPNARLVVINDSRHAT 241

Query: 241 AVGD-KQFKQGVVNFYAN 257
            +   +QF + ++ F A+
Sbjct: 242 PLDQPEQFNRTLLEFMAS 259


>gi|150377549|ref|YP_001314144.1| alpha/beta hydrolase fold [Sinorhizobium medicae WSM419]
 gi|150032096|gb|ABR64211.1| alpha/beta hydrolase fold [Sinorhizobium medicae WSM419]
          Length = 272

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 6/132 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ ++GD D   ILL+HG   S ++  L + ++      GFRVIA D  GHG SD+  
Sbjct: 23  RLAYVEMGDPDGVPILLLHGFTDSARSWSLTAPYLA----TGFRVIAPDLRGHGHSDQP- 77

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E  Y +  MA D   L+E L ++  HV+G+S+G R+A ++   +P  VR ++L    + 
Sbjct: 78  -EGCYTIPEMANDVRFLIEALDLAPTHVVGHSLGGRLAQAIAERWPHLVRKIVLISTSAA 136

Query: 135 LYDSDVVDWQSL 146
           L +     W+++
Sbjct: 137 LRERRGWLWENI 148


>gi|196041456|ref|ZP_03108749.1| alpha/beta hydrolase family protein [Bacillus cereus NVH0597-99]
 gi|196027704|gb|EDX66318.1| alpha/beta hydrolase family protein [Bacillus cereus NVH0597-99]
          Length = 270

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 97/218 (44%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS+++    + L 
Sbjct: 65  THYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLVENCTAGLE 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 REDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNS 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
             LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 185 NGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 222


>gi|307321667|ref|ZP_07601058.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti AK83]
 gi|306892696|gb|EFN23491.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti AK83]
          Length = 198

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 6/132 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ ++GD D   ILL+HG   S ++  L + ++      GFRVIA D  GHG SD+  
Sbjct: 24  RLAYVEMGDPDGVPILLLHGFTDSARSWSLTAPYLA----TGFRVIAPDLRGHGHSDQP- 78

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E  Y +  MA D   L+E L ++  HV+G+S+G R+A ++   +P  VR ++L    + 
Sbjct: 79  -EGCYTIPEMANDVRFLIEALDLAPTHVVGHSLGGRLAQAIAERWPHLVRKIVLISTSAA 137

Query: 135 LYDSDVVDWQSL 146
           L +     W+++
Sbjct: 138 LRERRGWLWENI 149


>gi|289627797|ref|ZP_06460751.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289651272|ref|ZP_06482615.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330867308|gb|EGH02017.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 262

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 115/258 (44%), Gaps = 25/258 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
            +  Y +G+     +LL+HGL SS Q +W +   I  L  Q +RVI  D  GHG+SDK Y
Sbjct: 12  HYEEYGLGE----PVLLLHGLGSSCQ-DWEYQ--IPALASQ-YRVIVMDMRGHGRSDKPY 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  M+ D  +L+EHL +  VH++G SMG  I   + +  P  ++S+ +      
Sbjct: 64  --GRYSIQAMSNDVEALIEHLRLGPVHLIGLSMGGMIGFQLAVDQPHLLKSLCIVNSAPQ 121

Query: 135 LYDSDVVDWQSLIDSFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKAL 181
           +      D   L   + L    S+  +   LGK            RK A+    ND +A 
Sbjct: 122 VKVRSAGDLWQLARRWTLSRIVSMHTLGEALGKLLFPKPEQADLRRKMAERWGKNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLL 240
            +    I     ++ L RI  P LI     D    S +E  +  +P+++ L I    H  
Sbjct: 182 LASFDAIVGWGVENKLGRITCPTLIIAAEHDYTPVSLKEAYVKRLPNARLLVIKDSRHAT 241

Query: 241 AVGD-KQFKQGVVNFYAN 257
            +   +QF + ++ F A+
Sbjct: 242 PLDQPEQFNRTLLEFMAS 259


>gi|298488798|ref|ZP_07006826.1| Menaquinone biosynthesis related protein MenX [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298156716|gb|EFH97808.1| Menaquinone biosynthesis related protein MenX [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 262

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 114/258 (44%), Gaps = 25/258 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
            +  Y +GD     +LL+HGL SS Q +W +   I  L  Q +RVI  D  GHG+SDK Y
Sbjct: 12  HYEEYGLGD----PVLLLHGLGSSCQ-DWEYQ--IPALASQ-YRVIVMDMRGHGRSDKPY 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  M+ D  +L+EHL +  VH++G SMG  I   + +  P  + S+ +      
Sbjct: 64  --GRYSIQAMSNDVEALIEHLRLGPVHLIGLSMGGMIGFQLAVDQPHLLTSLCIVNSAPQ 121

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQN---PLGKKF----------RKFADLDPGNDLKAL 181
           +      D   L   + L  I  ++     LGK            RK A+    ND +A 
Sbjct: 122 VKVRSAGDLWQLARRWTLSRIVSMRTLGEALGKLLFPKPEQADLRRKMAERWGKNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLL 240
            +    I     ++ L RI  P LI     D    S +E  +  +P+++ L I    H  
Sbjct: 182 LASFDAIVGWGVENKLGRITCPTLIIAAEHDYTPVSLKEAYVKRLPNARLLVIKDSRHAT 241

Query: 241 AVGD-KQFKQGVVNFYAN 257
            +   +QF + ++ F A+
Sbjct: 242 PLDQPEQFNRTLLEFMAS 259


>gi|257486702|ref|ZP_05640743.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331010173|gb|EGH90229.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 262

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 115/258 (44%), Gaps = 25/258 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
            +  Y +G+     +LL+HGL SS Q +W +   I  L  Q +RVI  D  GHG+SDK Y
Sbjct: 12  HYEEYGLGE----PVLLLHGLGSSCQ-DWEYQ--IPALVSQ-YRVIVMDMRGHGRSDKPY 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  M+ D  +L+EHL +  VH++G SMG  I   + +  P  ++S+ +      
Sbjct: 64  --GRYSIQAMSNDVEALIEHLRLGPVHLIGLSMGGMIGFQLAVDQPHLLKSLCIVNSAPQ 121

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQN---PLGKKF----------RKFADLDPGNDLKAL 181
           +      D   L   + L  I  +Q     LGK            RK A+    ND +A 
Sbjct: 122 VKVRSAGDLWQLARRWTLSRIVSMQTLGEALGKLLFPKPEQADLRRKMAERWGKNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE-LMSFIPSSQYLNICRRDHLL 240
            +    I     ++ L RI  P LI     D    S +E  +  +P+++ + I    H  
Sbjct: 182 LASFDAIVGWGVENKLGRITYPTLIIAAEHDYTPVSLKEAYVKRLPNARLVVINDSRHAT 241

Query: 241 AVGD-KQFKQGVVNFYAN 257
            +   +QF + ++ F A+
Sbjct: 242 PLDQPEQFNRTLLEFMAS 259


>gi|229118347|ref|ZP_04247703.1| hypothetical protein bcere0017_46160 [Bacillus cereus Rock1-3]
 gi|228665177|gb|EEL20663.1| hypothetical protein bcere0017_46160 [Bacillus cereus Rock1-3]
          Length = 240

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EKFQVILVDIVGHGKTESPEAVPHYDIQNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   +    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLESEEARKERREKDERLAHKIEREGTRSFISMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +K ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKRLAEKVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELQNLKMPVLLVNGEHDE 192


>gi|188589877|ref|YP_001920031.1| putative arylesterase [Clostridium botulinum E3 str. Alaska E43]
 gi|188500158|gb|ACD53294.1| hydrolase, alpha/beta fold family [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 241

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 120/241 (49%), Gaps = 26/241 (10%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V     P I+ +HG   +++    F   I+   ++ + VIA D  GHGKS K  I  
Sbjct: 17  YYEVYGNGEP-IVFLHGNGENLE---YFKNQIEYFSNK-YMVIAIDTRGHGKSTKGNIPF 71

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
           D+ L   A D +S+L+ L I KVH++G+S G   A  + L Y + ++S+IL G     ++
Sbjct: 72  DFWL--FADDVISVLDSLNIKKVHILGFSDGGNTALHLGLKYHNRIKSLILNGAN---FN 126

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGN-DLKALASCLSMIRKP-FCQD 195
            + V        FL+ +   ++  + + F  F++    N D+  L     M+  P   ++
Sbjct: 127 PNGV-------KFLVQAPVIMEYYISRLFSLFSNKAKNNRDILNL-----MVSNPKLSEE 174

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMS-FIPSSQYLNICRRDHLLAVGD-KQFKQGVVN 253
            L +I +PVL+  G  D +  +  +L+S  I +S+   I    H +A  + K+F + V +
Sbjct: 175 QLQKIKIPVLVVAGDNDMIKENHTKLISRLIQNSEVNIISNSSHFVASENPKEFNKVVED 234

Query: 254 F 254
           F
Sbjct: 235 F 235


>gi|228903373|ref|ZP_04067504.1| hypothetical protein bthur0014_45380 [Bacillus thuringiensis IBL
           4222]
 gi|228856334|gb|EEN00863.1| hypothetical protein bthur0014_45380 [Bacillus thuringiensis IBL
           4222]
          Length = 240

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++     N Y +   A     LL++L I K HV+GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVNHYDIRNAALQMKELLDYLHIEKAHVLGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           +   YP YV S++L    + L   +    +   D  L   I+                 E
Sbjct: 73  LACLYPEYVHSLLLENCTAGLESEEDQKERCEKDERLADKIEREGIRSFVLMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L K  ++    +   N+ K LA+ L  +    +P   D+L+ + +PVL+  G  D+
Sbjct: 133 TQKSLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELHNLKMPVLLMNGEHDE 192


>gi|52140646|ref|YP_086184.1| hydrolase; menaquinone biosynthesis related protein; prolyl
           aminopeptidase [Bacillus cereus E33L]
 gi|51974115|gb|AAU15665.1| hydrolase; menaquinone biosynthesis related protein; possible
           prolyl aminopeptidase [Bacillus cereus E33L]
          Length = 270

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 104/220 (47%), Gaps = 34/220 (15%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL+ L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  THYDIRNAALQMKELLDFLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLE 124

Query: 137 D--------------SDVVDWQSLIDSFL-----LPSIDEVQNPLGKKFRKFADLDP-GN 176
                          +D ++ +  I+SF+     +P + E Q  L +  ++    +   N
Sbjct: 125 SEDEREERREKDERLADKIEREG-IESFVTMWENIP-LFETQKSLAQNVQEAVRKERLAN 182

Query: 177 DLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           + K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 183 NSKGLANSLRSMGTGAQPSWWNELQNLKMPVLLMNGEYDE 222


>gi|228967977|ref|ZP_04128986.1| hypothetical protein bthur0004_47640 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228791701|gb|EEM39294.1| hypothetical protein bthur0004_47640 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 240

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++     N Y +   A     LL++L I K HV+GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVNHYDIRNAALQMKELLDYLHIEKAHVLGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           +   YP YV S++L    + L   +    +   D  L   I+                 E
Sbjct: 73  LACLYPEYVHSLLLENCTAGLESEEDQKERCEKDERLADKIEREGIRSFVLMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L K  ++    +   N+ K LA+ L  +    +P   D+L+ + +PVL+  G  D+
Sbjct: 133 TQKSLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELHNLKMPVLLMNGEHDE 192


>gi|229105495|ref|ZP_04236136.1| hypothetical protein bcere0019_46280 [Bacillus cereus Rock3-28]
 gi|228677920|gb|EEL32156.1| hypothetical protein bcere0019_46280 [Bacillus cereus Rock3-28]
          Length = 240

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EKFQVILVDIVGHGKTESPEAVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   +  + +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLESENEREERCEKDERLAHKIEREGIESFVAMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +K ++    +   N  K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKRLAEKVQEAVRKERLANSPKGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEHDE 192


>gi|47568033|ref|ZP_00238739.1| hydrolase, alpha/beta hydrolase fold family [Bacillus cereus G9241]
 gi|47555336|gb|EAL13681.1| hydrolase, alpha/beta hydrolase fold family [Bacillus cereus G9241]
          Length = 270

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 99/218 (45%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W   F  W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFFPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL++L I K H++GYSMG R+A +M   YP YV S++L    + L 
Sbjct: 65  THYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVHSLLLENCTAGLK 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             +  + +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 SENEREERREKDERLADKIEREGIGNFVSMWENIPLFETQKSLAQNVQEAVRKERLANNP 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           K LA+ L  +    +P   D+L  + +P+L+  G  D+
Sbjct: 185 KGLANSLRGMGTGAQPSWWDELPNLKMPILLMNGEYDE 222


>gi|254829596|ref|ZP_05234283.1| hydrolase [Listeria monocytogenes FSL N3-165]
 gi|258602013|gb|EEW15338.1| hydrolase [Listeria monocytogenes FSL N3-165]
          Length = 275

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 105/249 (42%), Gaps = 28/249 (11%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R Y       G+K  P +L++HG   + +T   F   I  L +  F +IA D LGHG + 
Sbjct: 6   RHYHLTTAISGEK--PALLMLHGFTGTSET---FQDSISGLKEH-FNIIAPDLLGHGNTA 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
                + Y +  +  D   +L  L +S+  V+GYSMG R+A +    +P  VR +IL   
Sbjct: 60  SPEEISSYTMENICEDLAGILHQLNVSRCFVLGYSMGGRVATAFAATFPKRVRGLILVSS 119

Query: 132 GSVLYDSDV-----------VDW------QSLIDSF----LLPSIDEVQNPLGKKFRKFA 170
              L  +D+            DW      +S +D +    L  S + +   + K+ R   
Sbjct: 120 SPGLEQADIRASRVEADNRLADWIEEEDMESFVDYWENLALFASQEVLSAEMKKRIRSER 179

Query: 171 DLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQ 229
                + L      +   ++P   + L     PVL+  G+ D+      QE+   +P+S 
Sbjct: 180 LSQNSHGLAMSLRGMGTGKQPSYWNHLANFTFPVLLITGALDEKFEKIAQEMQQLLPNST 239

Query: 230 YLNICRRDH 238
           +++I    H
Sbjct: 240 HVSIQEAGH 248


>gi|115524988|ref|YP_781899.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisA53]
 gi|115518935|gb|ABJ06919.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisA53]
          Length = 263

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           + D P ++L+HGL      +W  +G +  L D+ FR++  D+LGHG SDK      Y   
Sbjct: 16  EGDGPLVVLLHGLLFDA-ASWKATGIVDYLQDR-FRLVCIDSLGHGDSDKPLDAKLYVQP 73

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
             A D V++L+ LG ++ HV+G+ MG  +A  +  F+P ++ S+++GG
Sbjct: 74  QRAGDVVAVLDELGYARAHVIGHGMGGWLAVRLAKFFPQHLSSLVIGG 121


>gi|229099336|ref|ZP_04230267.1| hypothetical protein bcere0020_45560 [Bacillus cereus Rock3-29]
 gi|228684154|gb|EEL38101.1| hypothetical protein bcere0020_45560 [Bacillus cereus Rock3-29]
          Length = 240

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EKFQVILVDIVGHGKTESPEAVLHYDIQNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   +    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLESEEARKERREKDERLAHKIEREGIESFVVMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +K ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKRLAEKVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELQNLKMPVLLVNGEHDE 192


>gi|28871231|ref|NP_793850.1| alpha/beta fold family hydrolase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971418|ref|ZP_03399532.1| hydrolase, alpha/beta fold family [Pseudomonas syringae pv. tomato
           T1]
 gi|301383604|ref|ZP_07232022.1| hydrolase, alpha/beta fold family protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302059969|ref|ZP_07251510.1| hydrolase, alpha/beta fold family protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302132092|ref|ZP_07258082.1| hydrolase, alpha/beta fold family protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28854481|gb|AAO57545.1| hydrolase, alpha/beta fold family [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923861|gb|EEB57442.1| hydrolase, alpha/beta fold family [Pseudomonas syringae pv. tomato
           T1]
 gi|331015748|gb|EGH95804.1| hydrolase, alpha/beta fold family protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 262

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 113/243 (46%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HGL SS Q +W +   I +L    +RVI  D  GHG+SDK +    Y +  M+ D 
Sbjct: 22  VLLLHGLGSSCQ-DWEYQ--IPVLASH-YRVIVMDMRGHGRSDKPH--ERYSIKAMSNDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDSDVVDWQSLI 147
            +L+EHL +  VH++G SMG  I   + +  P  ++S+ I+     V   S    WQ + 
Sbjct: 76  EALIEHLRLGPVHLVGLSMGGMIGFQLAVDQPHLLKSLCIVNSAPQVKVKSPGDLWQWIR 135

Query: 148 DSFL--LPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
              L  L S++ +   LGK            RK A+    ND +A  +    I     ++
Sbjct: 136 RWTLSRLVSMETLGKALGKLLFPKPEQAELRRKMAERWGRNDKRAYLASFDAIVGWGVEN 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLLAVGD-KQFKQGVVN 253
            L RI  P LI     D    S +E  +  +P+++ + I    H   +   +QF + ++ 
Sbjct: 196 RLGRITCPTLIVAAEHDYTPVSLKEAYVKSLPNARLVIINDSRHATPLDQPEQFNRTLLE 255

Query: 254 FYA 256
           F A
Sbjct: 256 FIA 258


>gi|251777865|ref|ZP_04820785.1| alpha/beta hydrolase family protein [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243082180|gb|EES48070.1| alpha/beta hydrolase family protein [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 241

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 119/241 (49%), Gaps = 26/241 (10%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V  K  P I+ +HG   +++    F   I+   ++ + VIA D  GHGKS K  I  
Sbjct: 17  YYEVYGKGEP-IVFLHGNGENLE---YFKNQIEYFSNK-YMVIAIDTRGHGKSTKGNIPF 71

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
           D+ L   A D +S+L+ L I KVH++G+S G   A  + L Y + ++S+IL G     ++
Sbjct: 72  DFWL--FADDVISVLDSLNIKKVHILGFSDGGNTALHLGLKYHNRIKSLILNGAN---FN 126

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGN-DLKALASCLSMIRKP-FCQD 195
            + V        FL+ +   ++  +   F  F++    N D+  L     M+  P   ++
Sbjct: 127 PNGV-------KFLVQAPVIIEYYISILFSLFSNKAKNNRDILNL-----MVSNPKLSEE 174

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQELMS-FIPSSQYLNICRRDHLLAVGD-KQFKQGVVN 253
            L +I +P L+  G  D +  +  +L+S  I +S+   I    H +A  + K+F + V +
Sbjct: 175 QLQKIKIPTLVVAGDNDMIKENHTKLISQLIQNSEVNIISNSSHFVASENPKEFNKVVED 234

Query: 254 F 254
           F
Sbjct: 235 F 235


>gi|33601467|ref|NP_889027.1| putative hydrolase [Bordetella bronchiseptica RB50]
 gi|33575903|emb|CAE32981.1| putative hydrolase [Bordetella bronchiseptica RB50]
          Length = 272

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 89/191 (46%), Gaps = 12/191 (6%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           APT+LL+HG  ++ Q    F  W+  L  + +RV+  D  GHG SD    +    L  + 
Sbjct: 27  APTLLLLHGAMANAQR---FYSWVPGL-SRDYRVVRADLRGHGLSDVPPADKPLDLQVLT 82

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW-- 143
            D ++LL+HLG  +VH+ G S G  +   + + +P  + ++ L G    L +S    W  
Sbjct: 83  EDILALLDHLGCERVHLAGNSAGGYVGQHLAMQHPQRIETLALFGSAPGLRNSQASTWLE 142

Query: 144 ---QSLIDSFLLPSIDEVQNPL---GKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDL 197
              +  +  FL  +ID+   P      +  +F D    +D+  +   +  + +    D L
Sbjct: 143 RVAEKGLRQFLADTIDDRFPPELVGTPRCEQFLDALSDHDMAYIGRFVGYMAQQEWGDQL 202

Query: 198 YRIDVPVLIAV 208
           +RI  P L+ +
Sbjct: 203 HRITCPTLVVI 213


>gi|163795124|ref|ZP_02189092.1| 3-oxoadipate enol-lactonase [alpha proteobacterium BAL199]
 gi|159179522|gb|EDP64051.1| 3-oxoadipate enol-lactonase [alpha proteobacterium BAL199]
          Length = 261

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 120/262 (45%), Gaps = 36/262 (13%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFRVIAFDNLGHGKSDK 72
           Q  +   G+ D PT+LL + LAS++        W   +   ++ FRV+ +D+ GHG+S+ 
Sbjct: 10  QLHYKVSGNADGPTLLLSNSLASTLNM------WDPQMPAFEKRFRVVRYDSRGHGQSEA 63

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
              +  Y +  + ADAV LL+HL I+K H  G S G  +   +   +P  V  +IL    
Sbjct: 64  P--DGAYSIDTLTADAVGLLDHLDIAKTHFCGLSKGGMVGQRLATLHPGRVDRLILCDTA 121

Query: 133 SVLYDSDVVDWQSLI----DSFLLPSID-EVQNPLGKKFRKFADLDP-----------GN 176
           S +  +++  W+  I    D  +   +D  ++    + FR     DP           G 
Sbjct: 122 SYMGPAEL--WEGRIQLAEDKGMAGVVDATIERWFTESFRVN---DPTAVATVRAMILGT 176

Query: 177 DLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNI 233
            +   A C   I+    ++ +  I  P LI VG+ DD + +P   +E+   I  S+ + +
Sbjct: 177 PVAGFAGCCRAIQAMDQRESIRSIAAPTLIIVGA-DDPSTTPDKAREIQEQIRGSKLVVL 235

Query: 234 CRRDHLLAVGD-KQFKQGVVNF 254
               HL  +   ++F Q V++F
Sbjct: 236 PEAAHLSNIEQPEKFDQAVLHF 257


>gi|312193940|ref|YP_004014001.1| alpha/beta hydrolase fold protein [Frankia sp. EuI1c]
 gi|311225276|gb|ADP78131.1| alpha/beta hydrolase fold protein [Frankia sp. EuI1c]
          Length = 222

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 104/231 (45%), Gaps = 15/231 (6%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D+  ++L+HG ASS +  W  +GWI++L + G  VIA D  GHG + +S    DY  V  
Sbjct: 3   DSAPVVLVHGFASSSEHGWGPAGWIEMLREAGREVIAVDLPGHGTAARSTDPADYADVAA 62

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG-SVLYDSDVVDW 143
              A           V  +G+S GAR    +     +    + L G+G +VL   +   +
Sbjct: 63  TVAAAFADR----GPVDAVGFSAGARTLLEIAARGIASFDRLALMGIGPAVLEIREAAPF 118

Query: 144 QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVP 203
              ID+      D+  +   + FR  A    GNDL  LA+      +     +L  I   
Sbjct: 119 A--IDN------DDPTDVRARLFRGLAK-SAGNDLGPLAAFARRPVESLTAVELAAITCE 169

Query: 204 VLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           VL+  G +D  AG P+ L + +P++  + + R DH     + +    V++F
Sbjct: 170 VLVVTGERDQ-AGDPEALAAMLPNATGVLVERADHFSLQSNMRAMAAVLDF 219


>gi|159900122|ref|YP_001546369.1| alpha/beta hydrolase fold-domain containing protein [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159893161|gb|ABX06241.1| alpha/beta hydrolase fold [Herpetosiphon aurantiacus ATCC 23779]
          Length = 284

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 70/134 (52%), Gaps = 10/134 (7%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V  + AP +LLI GL  +        GW + L    + F+VI +DN G GK+      
Sbjct: 13  YEVAGQGAP-LLLIMGLGGTT------DGWRKELPFLTKHFQVIYYDNRGVGKTTAPTDF 65

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   AADA+ LL+HLGI + HV G SMG  IA  + L YP  V+ ++L G     Y
Sbjct: 66  TAYSMEHFAADAIGLLDHLGIERAHVWGVSMGGMIAQHVALNYPERVQGLVL-GCTLPHY 124

Query: 137 DSDVVDWQSLIDSF 150
            +D  +  +L D F
Sbjct: 125 ANDPANIPALPDEF 138


>gi|228917506|ref|ZP_04081055.1| hypothetical protein bthur0012_47160 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228842178|gb|EEM87277.1| hypothetical protein bthur0012_47160 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 240

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   D    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLEREDERKERCEKDERLADKIEREGIESFVTMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+   LA+CL  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKSLAQNVQEAVRKERLANNSNGLANCLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 192


>gi|296156895|ref|ZP_06839732.1| 3-oxoadipate enol-lactonase [Burkholderia sp. Ch1-1]
 gi|295892781|gb|EFG72562.1| 3-oxoadipate enol-lactonase [Burkholderia sp. Ch1-1]
          Length = 265

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 107/240 (44%), Gaps = 24/240 (10%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  +   G   APT++L HGLA+ +    +++  + +L  + F V+ +D  GHG +  S 
Sbjct: 11  QTHYRLTGKAGAPTVILSHGLAADLS---MWAPQLDML-SRSFSVLCYDIRGHGGT--SA 64

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS- 133
              DY L  +A D ++L++ LGI++ H +G S+G  I   +  ++   + S+ L    S 
Sbjct: 65  TPGDYSLALLADDVIALMDSLGIARAHYVGLSLGGMIGQQLGAWHGERLASLTLCATTSN 124

Query: 134 ---VLYDSDVVDW---------QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKAL 181
                +D+ V +          ++ +D ++ P+    Q  L ++ R+      G  L   
Sbjct: 125 APKASWDARVHEARAHGIAPLVEATVDRWVTPAFKREQPELMEQMRRMVL---GTSLDGY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHL 239
           A   + IR       L RI VP L+  G  D     P  + +   IP +  L +    H+
Sbjct: 182 AGSAAAIRDMELAPVLGRIKVPTLVIAGEADTSTPLPILEHIADSIPGATLLTVPEAAHM 241


>gi|269792125|ref|YP_003317029.1| alpha/beta hydrolase fold protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269099760|gb|ACZ18747.1| alpha/beta hydrolase fold protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 265

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 71/134 (52%), Gaps = 10/134 (7%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSYIE 76
           Y+V   + P +L+I GLAS V      S W  +L +  + FRVI  DN G G+S     +
Sbjct: 11  YEVHGSEGPPLLMIAGLASDV------SSWQSVLPELSKRFRVILVDNRGVGRSKPE--D 62

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
            +  +  MA D  +L++HLG   VHV+G+SMG  +A  + + +P   RS++L   G  + 
Sbjct: 63  PEISIGLMADDCAALIDHLGYGPVHVLGHSMGGMVAMDLAIRHPQKARSLVLAATGDRVS 122

Query: 137 DSDVVDWQSLIDSF 150
             + + +  L D +
Sbjct: 123 GRNAMLFSDLADRY 136


>gi|330967457|gb|EGH67717.1| alpha/beta fold family hydrolase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 262

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 112/244 (45%), Gaps = 21/244 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HGL SS Q +W +   I +L    +RVI  D  GHG+SDK +    Y +  M+ D 
Sbjct: 22  VLLLHGLGSSCQ-DWEYQ--IPVLASH-YRVIVMDMRGHGRSDKPH--ERYSIKAMSNDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDSDVVDWQSLI 147
            +L+EHL +  VHV+G SMG  I   + +  P  ++S+ I+     V   S    WQ + 
Sbjct: 76  EALIEHLRLGPVHVVGLSMGGMIGFQLAVDQPHLLKSLCIVNSAPQVKVRSPGDLWQWIR 135

Query: 148 DSFL--LPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
              L  L S+  +   LGK            RK A+    ND +A  +    I     ++
Sbjct: 136 RWTLSRLVSMATLGQALGKLLFPKPEQAELRRKMAERWGRNDKRAYLASFDAIVGWGVEN 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQE-LMSFIPSSQYLNICRRDHLLAVGD-KQFKQGVVN 253
            L RI  P LI     D    S +E  +  +P+++ + I    H   +   +QF + ++ 
Sbjct: 196 RLGRITCPTLIVAAEHDYTPVSLKEGYVKSLPNARLVVINDSRHATPLDQPEQFNRTLLE 255

Query: 254 FYAN 257
           F A 
Sbjct: 256 FIAG 259


>gi|229141595|ref|ZP_04270127.1| hypothetical protein bcere0013_46870 [Bacillus cereus BDRD-ST26]
 gi|228641875|gb|EEK98174.1| hypothetical protein bcere0013_46870 [Bacillus cereus BDRD-ST26]
          Length = 240

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   D    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLESEDERKERCEKDERLAQKIEREGIESFVSMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKSLAQNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEHDE 192


>gi|77404670|ref|YP_345244.1| 3-oxoadipate enol-lactonase [Rhodobacter sphaeroides 2.4.1]
 gi|77390320|gb|ABA81503.1| 3-oxoadipate enol-lactonase [Rhodobacter sphaeroides 2.4.1]
          Length = 266

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 121/254 (47%), Gaps = 25/254 (9%)

Query: 15  QFAFYD-VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
            + +YD +G  DAP + + H L S    + +++  +  L + GF+V+  D  GHG S  S
Sbjct: 8   HWIYYDLIGAPDAPVVCMSHSLTSD---HGMWAEQVPALLEAGFQVLRIDTRGHGGS--S 62

Query: 74  YIENDYRLVFMAADAVSLLEHLGI-SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
               DYR+  +A D +S+L+ LG  S VH++G SMG  I   +   +P  + S+++    
Sbjct: 63  APPGDYRIEELAGDVLSVLDALGFESGVHMIGLSMGGMIGQVIAADHPGRLASLMVCCSA 122

Query: 133 SV-LYDSDVVDWQ--SLIDSFLLPSI--DEVQNPLGKKFRKFADLD--------PGNDLK 179
           S  + D++++  +  ++ +S  L SI    ++   G  FR+   L          G  L 
Sbjct: 123 SKWMGDTELMKGRIRAVKESGTLESIVAANMERRYGPGFRERRPLRWEALRQTFLGTKLD 182

Query: 180 ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNICRR 236
               C++       +  L +ID+PVL+  GS+D     P +   + S IP ++Y  I   
Sbjct: 183 GYFGCMNACLTHNVEPRLGQIDIPVLVVAGSEDPTT-PPADNRLIASCIPGARYAEIAGG 241

Query: 237 DHLLAVG-DKQFKQ 249
            H   V  D +F +
Sbjct: 242 YHFPNVEFDGEFNR 255


>gi|30264919|ref|NP_847296.1| alpha/beta fold family hydrolase [Bacillus anthracis str. Ames]
 gi|47530412|ref|YP_021761.1| alpha/beta fold family hydrolase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49187740|ref|YP_030993.1| alpha/beta fold family hydrolase [Bacillus anthracis str. Sterne]
 gi|65322222|ref|ZP_00395181.1| COG0596: Predicted hydrolases or acyltransferases (alpha/beta
           hydrolase superfamily) [Bacillus anthracis str. A2012]
 gi|165869632|ref|ZP_02214290.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0488]
 gi|167633952|ref|ZP_02392275.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0442]
 gi|167638134|ref|ZP_02396412.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0193]
 gi|170685826|ref|ZP_02877049.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0465]
 gi|170705444|ref|ZP_02895908.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0389]
 gi|177651102|ref|ZP_02933933.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0174]
 gi|190567263|ref|ZP_03020178.1| hydrolase, alpha/beta fold family [Bacillus anthracis
           Tsiankovskii-I]
 gi|227817650|ref|YP_002817659.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. CDC 684]
 gi|229603202|ref|YP_002869124.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0248]
 gi|254687661|ref|ZP_05151517.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254736967|ref|ZP_05194673.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742001|ref|ZP_05199688.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Kruger B]
 gi|254754400|ref|ZP_05206435.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Vollum]
 gi|254757232|ref|ZP_05209259.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Australia 94]
 gi|30259594|gb|AAP28782.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylante synthase
           [Bacillus anthracis str. Ames]
 gi|47505560|gb|AAT34236.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49181667|gb|AAT57043.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. Sterne]
 gi|164714461|gb|EDR19980.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0488]
 gi|167513951|gb|EDR89319.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0193]
 gi|167530753|gb|EDR93455.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0442]
 gi|170129569|gb|EDS98432.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0389]
 gi|170670290|gb|EDT21030.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0465]
 gi|172082928|gb|EDT67990.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0174]
 gi|190561767|gb|EDV15737.1| hydrolase, alpha/beta fold family [Bacillus anthracis
           Tsiankovskii-I]
 gi|227004235|gb|ACP13978.1| alpha/beta hydrolase family protein [Bacillus anthracis str. CDC
           684]
 gi|229267610|gb|ACQ49247.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0248]
          Length = 270

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 96/218 (44%), Gaps = 30/218 (13%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           Y+V     P +LL+HG   S++T W      W      + F+VI  D +GHGK++     
Sbjct: 12  YEVVGSGEP-LLLLHGFTGSMET-WRSFVPSW-----SEQFQVILVDIVGHGKTESPEDV 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +   A     LL++L I K H++GYSMG R+A +M   YP YVRS++L    + L 
Sbjct: 65  THYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLE 124

Query: 137 DSDVVDWQSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDL 178
             D    +   D  L   I+                 E Q  L +  ++    +   N+ 
Sbjct: 125 REDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNS 184

Query: 179 KALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
             LA+ L  +    +P   ++L  + + VL+  G  D+
Sbjct: 185 NGLANSLRGMGTGAQPSWWNELQNLKMSVLLMNGEYDE 222


>gi|108799139|ref|YP_639336.1| alpha/beta hydrolase fold [Mycobacterium sp. MCS]
 gi|119868254|ref|YP_938206.1| alpha/beta hydrolase fold [Mycobacterium sp. KMS]
 gi|108769558|gb|ABG08280.1| alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]
 gi|119694343|gb|ABL91416.1| alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]
          Length = 340

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 68/133 (51%), Gaps = 8/133 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           +R+   Y+ AF   G+   P ILLIHG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 20  YRTIHGYRRAFRIAGE--GPAILLIHGIGDN-STTW---NTVQTKLAQRFTVIAPDLLGH 73

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           GKSDK     DY +   A     LL  L I +V V+G+S+G  +A      +P +V  +I
Sbjct: 74  GKSDKP--RADYSVAAYANGMRDLLSVLDIDRVTVVGHSLGGGVAMQFAYQFPQFVDRLI 131

Query: 128 LGGVGSVLYDSDV 140
           L G G V  D ++
Sbjct: 132 LVGAGGVTKDVNI 144


>gi|126434747|ref|YP_001070438.1| alpha/beta hydrolase fold [Mycobacterium sp. JLS]
 gi|126234547|gb|ABN97947.1| alpha/beta hydrolase fold protein [Mycobacterium sp. JLS]
          Length = 340

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 68/133 (51%), Gaps = 8/133 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           +R+   Y+ AF   G+   P ILLIHG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 20  YRTIHGYRRAFRIAGE--GPAILLIHGIGDN-STTW---NTVQTKLAQRFTVIAPDLLGH 73

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           GKSDK     DY +   A     LL  L I +V V+G+S+G  +A      +P +V  +I
Sbjct: 74  GKSDKP--RADYSVAAYANGMRDLLSVLDIDRVTVVGHSLGGGVAMQFAYQFPQFVDRLI 131

Query: 128 LGGVGSVLYDSDV 140
           L G G V  D ++
Sbjct: 132 LVGAGGVTKDVNI 144


>gi|152977176|ref|YP_001376693.1| alpha/beta hydrolase fold [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152025928|gb|ABS23698.1| alpha/beta hydrolase fold [Bacillus cytotoxicus NVH 391-98]
          Length = 270

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 5/110 (4%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+V       +LL+HG   S++T   +  ++ L   Q F+VI  D +GHGK++       
Sbjct: 12  YEVAG-SGEALLLLHGFTGSMET---WRSFLPLWSKQ-FQVITVDIVGHGKTESPESLVH 66

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           Y +  +A     LL+HL I K H++GYSMG R+A +M   YP  V+S+IL
Sbjct: 67  YDIQNVAVQMTKLLDHLQIEKAHILGYSMGGRLAITMSCLYPERVKSLIL 116


>gi|229158476|ref|ZP_04286537.1| hypothetical protein bcere0010_46510 [Bacillus cereus ATCC 4342]
 gi|228624995|gb|EEK81761.1| hypothetical protein bcere0010_46510 [Bacillus cereus ATCC 4342]
          Length = 240

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   D    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLESEDERKERCEKDERLAQKIEREGIESFVSMWESIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKRLAQNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELKNLKMPVLLMNGEHDE 192


>gi|91779497|ref|YP_554705.1| putative lactone hydrolase [Burkholderia xenovorans LB400]
 gi|91692157|gb|ABE35355.1| 3-oxoadipate enol-lactonase [Burkholderia xenovorans LB400]
          Length = 265

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 107/240 (44%), Gaps = 24/240 (10%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  +   G   APT++L HGLA+ +    +++  + +L  + F V+ +D  GHG +  S 
Sbjct: 11  QTHYRLTGKAGAPTVILSHGLAADLS---MWAPQLDML-SRSFSVLCYDIRGHGGT--SA 64

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS- 133
              DY L  +A D ++L++ LGI+  H +G S+G  I   +  ++   + S+ L    S 
Sbjct: 65  TPGDYSLALLADDVIALMDSLGIASAHYVGLSLGGMIGQQLGAWHGERLASLTLCATTSN 124

Query: 134 ---VLYDSDVVDW---------QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKAL 181
                +D+ V +          ++ +D ++ P+    Q  L ++ R+      G  L   
Sbjct: 125 APKASWDARVHEARARGIAPLVEATVDRWVTPAFKREQPELMEQMRRMVL---GTSLDGY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHL 239
           A   + IR       L RI VP L+  G  D     P  + +   IP++  L +    H+
Sbjct: 182 AGSAAAIRDMELAPVLGRIGVPTLVIAGEADTSTPLPILEHIADSIPAATLLTVPEAAHM 241


>gi|107102602|ref|ZP_01366520.1| hypothetical protein PaerPA_01003666 [Pseudomonas aeruginosa PACS2]
          Length = 333

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 113/241 (46%), Gaps = 43/241 (17%)

Query: 16  FAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K A   TILL+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 52  MAYLDVAPKKANGRTILLMHG------KNFCAGTWERTIDVLADAGYRVIAVDQVGFCKS 105

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+  +LLE LG+++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 106 SKP-AHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVN 164

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 165 PIGLEDWKALGVPWRSIDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMY 224

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ +P L+ +G +D+ A     +P EL 
Sbjct: 225 RGKGRESVAWNSALTYDMI---FTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELK 281

Query: 223 S 223
           +
Sbjct: 282 A 282


>gi|15598249|ref|NP_251743.1| hydrolytic enzyme [Pseudomonas aeruginosa PAO1]
 gi|9949159|gb|AAG06441.1|AE004730_5 probable hydrolytic enzyme [Pseudomonas aeruginosa PAO1]
          Length = 335

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 113/241 (46%), Gaps = 43/241 (17%)

Query: 16  FAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K A   TILL+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 54  MAYLDVAPKKANGRTILLMHG------KNFCAGTWERTIDVLADAGYRVIAVDQVGFCKS 107

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+  +LLE LG+++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 108 SKP-AHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVN 166

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 167 PIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMY 226

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ +P L+ +G +D+ A     +P EL 
Sbjct: 227 RGKGRESVAWNSALTYDMI---FTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELK 283

Query: 223 S 223
           +
Sbjct: 284 A 284


>gi|49087432|gb|AAT51458.1| PA3053 [synthetic construct]
          Length = 336

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 113/241 (46%), Gaps = 43/241 (17%)

Query: 16  FAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K A   TILL+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 54  MAYLDVAPKKANGRTILLMHG------KNFCAGTWERTIDVLADAGYRVIAVDQVGFCKS 107

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+  +LLE LG+++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 108 SKP-AHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVN 166

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 167 PIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMY 226

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ +P L+ +G +D+ A     +P EL 
Sbjct: 227 RGKGRESVAWNSALTYDMI---FTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELK 283

Query: 223 S 223
           +
Sbjct: 284 A 284


>gi|296388451|ref|ZP_06877926.1| putative hydrolytic enzyme [Pseudomonas aeruginosa PAb1]
          Length = 333

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 117/250 (46%), Gaps = 43/250 (17%)

Query: 16  FAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K A   TILL+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 52  MAYLDVAPKKANGRTILLMHG------KNFCAGTWERTIDVLADAGYRVIAVDQVGFCKS 105

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+  +LLE LG+++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 106 SKP-AHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVN 164

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 165 PIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMY 224

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ +P L+ +G +D+ A     +P EL 
Sbjct: 225 RGKGRESVAWNSALTYDMI---FTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELK 281

Query: 223 SFIPSSQYLN 232
           + + +  +L 
Sbjct: 282 ARLGNYAHLG 291


>gi|71736193|ref|YP_273690.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71556746|gb|AAZ35957.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320325478|gb|EFW81541.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320327026|gb|EFW83040.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330877227|gb|EGH11376.1| 3-oxoadipate enol-lactonase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 262

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 93/211 (44%), Gaps = 23/211 (10%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
            +  Y +G+     +LL+HGL SS Q +W +   I  L  Q +RVI  D  GHG+SDK Y
Sbjct: 12  HYEEYGLGE----PVLLLHGLGSSCQ-DWEYQ--IPALARQ-YRVIVMDMRGHGRSDKPY 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  M+ D  +L+EHL +  VH++G SMG  I   + +  P  ++S+ +      
Sbjct: 64  --GRYSIQAMSNDVEALIEHLHLGPVHLIGLSMGGMIGFQLAVDQPHLLKSLCIVNSAPQ 121

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQN---PLGKKF----------RKFADLDPGNDLKAL 181
           +      D   L   + L  I  +Q     LGK            RK A+    ND +A 
Sbjct: 122 VKVRSAGDLWQLARRWTLSRIVSMQTLGEALGKLLFPKPEQADLRRKMAERWGKNDKRAY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD 212
            +    I     ++ L RI  P LI     D
Sbjct: 182 LASFDAIVGWGVENKLGRITCPTLIIAAEHD 212


>gi|218890747|ref|YP_002439611.1| hypothetical protein PLES_20071 [Pseudomonas aeruginosa LESB58]
 gi|254241756|ref|ZP_04935078.1| hypothetical protein PA2G_02467 [Pseudomonas aeruginosa 2192]
 gi|126195134|gb|EAZ59197.1| hypothetical protein PA2G_02467 [Pseudomonas aeruginosa 2192]
 gi|218770970|emb|CAW26735.1| hypothetical protein PLES_20071 [Pseudomonas aeruginosa LESB58]
          Length = 333

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 113/241 (46%), Gaps = 43/241 (17%)

Query: 16  FAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K A   TILL+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 52  MAYLDVAPKKANGRTILLMHG------KNFCAGTWERTIDVLADAGYRVIAVDQVGFCKS 105

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+  +LLE LG+++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 106 SKP-AHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVN 164

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 165 PIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMY 224

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ +P L+ +G +D+ A     +P EL 
Sbjct: 225 RGKGRESVAWNSALTYDMI---FTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELK 281

Query: 223 S 223
           +
Sbjct: 282 A 282


>gi|116051053|ref|YP_790118.1| putative hydrolytic enzyme [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313108348|ref|ZP_07794380.1| putative hydrolase [Pseudomonas aeruginosa 39016]
 gi|115586274|gb|ABJ12289.1| putative hydrolase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310880882|gb|EFQ39476.1| putative hydrolase [Pseudomonas aeruginosa 39016]
          Length = 333

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 113/241 (46%), Gaps = 43/241 (17%)

Query: 16  FAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K A   TILL+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 52  MAYLDVAPKKANGRTILLMHG------KNFCAGTWERTIDVLADAGYRVIAVDQVGFCKS 105

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+  +LLE LG+++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 106 SKP-AHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVN 164

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 165 PIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMY 224

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ +P L+ +G +D+ A     +P EL 
Sbjct: 225 RGKGRESVAWNSALTYDMI---FTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELK 281

Query: 223 S 223
           +
Sbjct: 282 A 282


>gi|330878911|gb|EGH13060.1| alpha/beta fold family hydrolase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 262

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 112/243 (46%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HGL SS Q +W +   I +L    +RV+  D  GHG+SDK +    Y +  M+ D 
Sbjct: 22  VLLLHGLGSSCQ-DWEYQ--IPVLASH-YRVMVMDMRGHGRSDKPH--ERYSIKAMSNDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDSDVVDWQSLI 147
            +L+EHL +  VHV+G SMG  I   + +  P  ++S+ I+     V   S    WQ + 
Sbjct: 76  EALIEHLRLGPVHVVGLSMGGMIGFQLAVDQPHLLKSLCIVNSAPQVKVRSPGDLWQWIR 135

Query: 148 DSFL--LPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
              L  L S+  +   LGK            RK A+    ND +A  +    I     ++
Sbjct: 136 RWTLSRLVSMATLGKALGKLLFPKPEQAELRRKMAERWGRNDKRAYLASFDAIVGWGVEN 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLLAVGD-KQFKQGVVN 253
            L RI  P LI     D    S +E  +  +P+++ + I    H   +   +QF + ++ 
Sbjct: 196 RLGRITCPTLIVAAEHDYTPVSLKEAYVKSLPNARLVVINDSRHATPLDQPEQFNRTLLE 255

Query: 254 FYA 256
           F A
Sbjct: 256 FIA 258


>gi|226228875|ref|YP_002762981.1| putative hydrolase [Gemmatimonas aurantiaca T-27]
 gi|226092066|dbj|BAH40511.1| putative hydrolase [Gemmatimonas aurantiaca T-27]
          Length = 287

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 6/111 (5%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +++V  +  P +LL HG   S+ +NW  +GWI  L  +  +VIA +  GHG++  + I  
Sbjct: 41  YHEVHGQGDPVVLL-HGAFMSITSNW--TGWIDELS-KTRKVIAVEMQGHGRT--AGIPR 94

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            +     A D  +LLEHLGI++  ++GYSMG  +A  M + +P +VR V++
Sbjct: 95  AFSSANHADDVAALLEHLGIARADIIGYSMGGGVAMQMAVRHPDHVRKVVV 145


>gi|149184762|ref|ZP_01863080.1| hydrolase [Erythrobacter sp. SD-21]
 gi|148832082|gb|EDL50515.1| hydrolase [Erythrobacter sp. SD-21]
          Length = 251

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 114/256 (44%), Gaps = 10/256 (3%)

Query: 4   EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           +++ F S+   + A +  G+     ++L+HGL SS + NW+  G  QLL ++GF V+  D
Sbjct: 2   KMEIFESFDGTKLALHRSGE--GRPLVLLHGLFSSAEMNWIKWGHAQLLAERGFEVLMLD 59

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
              HG+S        Y    +  D  +L+EHL +    + G+S+GAR +   V       
Sbjct: 60  FRVHGESAAPEDPAAYPQNVLVRDVAALVEHLALEDYDLGGFSLGARTSLHAVAHGVLEP 119

Query: 124 RSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQN-PLGKKFRKFADLDPGNDLKALA 182
             +I+GG+G+    + + +W     +F    IDE    P G              +  +A
Sbjct: 120 ARLIVGGMGT----AGLGEWAKR-SAFFKRVIDEFDAIPRGDPAYFSMQFLKSQGVNRVA 174

Query: 183 SCLSMIRKP-FCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLA 241
           + L +   P      L  + VP L+  G++D   GS +EL + +  + Y  +    H+ +
Sbjct: 175 ARLLLDTMPDLDLAMLSDVTVPTLVVCGNEDRDNGSAEELAALLSDATYAEVPGT-HMGS 233

Query: 242 VGDKQFKQGVVNFYAN 257
           V      Q + ++ A 
Sbjct: 234 VTKPDLGQTMADWLAR 249


>gi|271968747|ref|YP_003342943.1| alpha/beta hydrolase fold protein [Streptosporangium roseum DSM
           43021]
 gi|270511922|gb|ACZ90200.1| alpha/beta hydrolase fold protein [Streptosporangium roseum DSM
           43021]
          Length = 246

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 102/231 (44%), Gaps = 9/231 (3%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D+P +LL+H  AS    +W+ +G +  L   G  V+  D  GHG+S      ++     +
Sbjct: 19  DSPPVLLLHSFASDGAADWVETGVVAALTGAGRTVVVPDLRGHGESPAPTAAHESGARAV 78

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ 144
           A D V++L+  G++   V+GYS+GAR+   +    P  VR  + GG+      S V  + 
Sbjct: 79  AEDIVAVLDGAGVTTFDVVGYSLGARLGWELPEAAPGRVRRAVFGGL------SPVEPFA 132

Query: 145 SLIDSFLLPSIDEVQNPLGKKFRKFADL--DPGNDLKALASCLSMIRKPFCQDDLYRIDV 202
           ++  + L  ++ +   P        A +    G     LA C+  ++    +   +    
Sbjct: 133 AVDAAALHRAVRDGAEPEDPFTAMIAGMVRSRGERAAGLALCVEGLQGTPFEAAPWGGPT 192

Query: 203 PVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVN 253
           P +  VG  D +    + ++S +  ++ + +   DH   +G   F+  +V 
Sbjct: 193 PPVFVVGEDDVMTRGIERIVSLVGGAEPITVP-GDHFQVLGGAAFRDTIVR 242


>gi|254236025|ref|ZP_04929348.1| hypothetical protein PACG_01982 [Pseudomonas aeruginosa C3719]
 gi|126167956|gb|EAZ53467.1| hypothetical protein PACG_01982 [Pseudomonas aeruginosa C3719]
          Length = 333

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 113/241 (46%), Gaps = 43/241 (17%)

Query: 16  FAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKS 70
            A+ DV  K A   TILL+HG       N+    W   I +L D G+RVIA D +G  KS
Sbjct: 52  MAYLDVAPKKANGRTILLMHG------KNFCAGTWERTIDVLADAGYRVIAVDQVGFCKS 105

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILG 129
            K      Y    +AA+  +L+E LG+++  V+G+SMG  +A    L YP  V R V++ 
Sbjct: 106 SKP-AHYQYSFQQLAANTHALMEQLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVN 164

Query: 130 GVGSVLYDSDVVDWQSLIDSF---LLPSIDEVQN---------PLGKKFRKFADLDP--- 174
            +G   + +  V W+S+ D +   L  S + ++              +F ++  +     
Sbjct: 165 PIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMY 224

Query: 175 ---GNDLKALASCLS--MIRKPFCQDDLY---RIDVPVLIAVGSQDDLA----GSPQELM 222
              G +  A  S L+  MI   F Q  +Y   R+ +P L+ +G +D+ A     +P EL 
Sbjct: 225 RGKGRESVAWNSALTYDMI---FTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELK 281

Query: 223 S 223
           +
Sbjct: 282 T 282


>gi|118618679|ref|YP_907011.1| hydrolase [Mycobacterium ulcerans Agy99]
 gi|118570789|gb|ABL05540.1| conserved hypothetical hydrolase [Mycobacterium ulcerans Agy99]
          Length = 341

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 66/134 (49%), Gaps = 8/134 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ AF   G    P ILLIHG+  +  T W     I     Q F VIA D LGH
Sbjct: 21  FRTIHGYKRAFRIAGS--GPAILLIHGIGDN-STTWT---GIHAKLAQRFTVIAPDLLGH 74

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 75  GRSDKP--RADYSIAAYANGMRDLLSVLDIERVTIIGHSLGGGVAMQFAYQFPQLVDRLI 132

Query: 128 LGGVGSVLYDSDVV 141
           L G G V  D +VV
Sbjct: 133 LVGAGGVTKDVNVV 146


>gi|183982011|ref|YP_001850302.1| hydrolase [Mycobacterium marinum M]
 gi|183175337|gb|ACC40447.1| conserved hypothetical hydrolase [Mycobacterium marinum M]
          Length = 341

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 66/134 (49%), Gaps = 8/134 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ AF   G    P ILLIHG+  +  T W     I     Q F VIA D LGH
Sbjct: 21  FRTIHGYKRAFRIAGS--GPAILLIHGIGDN-STTWT---GIHAKLAQRFTVIAPDLLGH 74

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 75  GRSDKP--RADYSIAAYANGMRDLLSVLDIERVTIIGHSLGGGVAMQFAYQFPQLVDRLI 132

Query: 128 LGGVGSVLYDSDVV 141
           L G G V  D +VV
Sbjct: 133 LVGAGGVTKDVNVV 146


>gi|294500414|ref|YP_003564114.1| alpha/beta fold family hydrolase [Bacillus megaterium QM B1551]
 gi|294350351|gb|ADE70680.1| hydrolase, alpha/beta fold family [Bacillus megaterium QM B1551]
          Length = 278

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 112/254 (44%), Gaps = 33/254 (12%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHG   S ++ W +   +  L + G+RVI +D  G GKS + +   DY     AAD 
Sbjct: 27  VVLIHGWPLSGRS-WEYQ--VPALVEAGYRVITYDRRGFGKSSQPWDGYDYET--FAADL 81

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPS--YVRSVILGGVGSVLYDSDVVDWQSL 146
             LLEHL ++ V ++G+SMG       V  Y +    ++V  G V   LY S+     +L
Sbjct: 82  HQLLEHLDLTNVTLVGFSMGGGEVARYVGTYGTDRVEKAVFAGAVPPFLYKSEDHPEGAL 141

Query: 147 IDSFLLPSIDEVQNP----LGKKFRKFADLDPGNDL------------------KALASC 184
            D+ +    + V+N     L    + F  ++ GNDL                  K    C
Sbjct: 142 DDAGIQEFENGVKNDRLAFLDNFTKTFFGMEDGNDLVSEPFRLYNRDIAAAASPKGTLDC 201

Query: 185 LSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG---SPQELMSFIPSSQYLNICRRDH-LL 240
           ++   K   +DDL +  +P LI  G  D++     S +     IP S+   I    H L 
Sbjct: 202 IAAFSKTDFRDDLAKFTIPALIIHGDSDEIVPFEYSGKRTHEAIPGSKLALIKGGPHGLN 261

Query: 241 AVGDKQFKQGVVNF 254
           A    +F + +++F
Sbjct: 262 ATHAHEFNEALLSF 275


>gi|218288775|ref|ZP_03493038.1| alpha/beta hydrolase fold protein [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241133|gb|EED08309.1| alpha/beta hydrolase fold protein [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 274

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 71/115 (61%), Gaps = 5/115 (4%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V  + +P +LLI G+  +++  W  SG+++ L  Q   VIAFDN G G+S+    + 
Sbjct: 12  YYEVHGEGSP-LLLIMGVGGNIR--WWGSGFVRRLS-QKHAVIAFDNRGAGQSEADPAK- 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
            + +  MA DA ++L+  G+ + HV+GYSMG  IA  + L +P+ V S++LG  G
Sbjct: 67  PWTIEQMADDARAVLDAAGVERAHVLGYSMGGMIAQELALRHPAAVTSLVLGATG 121


>gi|307309008|ref|ZP_07588688.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
 gi|306900481|gb|EFN31095.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
          Length = 256

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 71/132 (53%), Gaps = 6/132 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ ++GD D   ILL+HG   S ++  L + ++      GFRVIA D  GHG SD+  
Sbjct: 7   RLAYVEMGDPDGVPILLLHGFTDSARSWSLTAPYLA----TGFRVIAPDLRGHGHSDQP- 61

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E  Y +  MA D   L+  L ++  HV+G+S+G R+  ++   +P  VR +IL    + 
Sbjct: 62  -EGCYTIPEMANDVRLLMVALDLAPCHVVGHSLGGRLVQALAERWPHLVRKIILMSTSAA 120

Query: 135 LYDSDVVDWQSL 146
           L +     W+++
Sbjct: 121 LRERRGRLWENI 132


>gi|41408930|ref|NP_961766.1| hypothetical protein MAP2832 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41397289|gb|AAS05149.1| hypothetical protein MAP_2832 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 343

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 70/140 (50%), Gaps = 9/140 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ A+   G    P ILLIHG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 23  FRTIHGYRRAYRIAGS--GPAILLIHGIGDN-STTW---NTVQAKLAQRFTVIAPDLLGH 76

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 77  GQSDKP--RADYSVAAYANGMRDLLAVLDIERVTIVGHSLGGGVAMQFAYQFPHLVERLI 134

Query: 128 LGGVGSVLYDSD-VVDWQSL 146
           L G G V  D + V+ W SL
Sbjct: 135 LVGAGGVTKDVNFVLRWASL 154


>gi|228942039|ref|ZP_04104582.1| hypothetical protein bthur0008_46730 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228974970|ref|ZP_04135531.1| hypothetical protein bthur0003_47200 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228981563|ref|ZP_04141860.1| hypothetical protein bthur0002_47240 [Bacillus thuringiensis Bt407]
 gi|228778242|gb|EEM26512.1| hypothetical protein bthur0002_47240 [Bacillus thuringiensis Bt407]
 gi|228784823|gb|EEM32841.1| hypothetical protein bthur0003_47200 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228817708|gb|EEM63790.1| hypothetical protein bthur0008_46730 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 240

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVAHYDIRNVALQMKELLDYLQIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YV S++L    + L + +    +   D  L   I+                 E
Sbjct: 73  MACLYPDYVHSLLLENCTAGLENEEDRKERREKDDRLANKIEREGVQSFVSMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L K  ++    +   N+ K LA+ L  +    +P   D+L+ + +PVL+  G  D+
Sbjct: 133 TQKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELHNLKMPVLLMNGEYDE 192


>gi|240169683|ref|ZP_04748342.1| hydrolase [Mycobacterium kansasii ATCC 12478]
          Length = 341

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 66/134 (49%), Gaps = 8/134 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ AF   G    P ILL+HG+  +  T W     I     Q F VIA D LGH
Sbjct: 21  FRTIHGYKRAFRIAGS--GPAILLVHGIGDN-STTWT---GIHAKLAQRFTVIAPDLLGH 74

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           GKSDK     DY +   A     LL  L + +V V+G+S+G  +A      +P  V  +I
Sbjct: 75  GKSDKP--RADYSVAAYANGMRDLLSVLDVERVTVIGHSLGGGVAMQFAYQFPQLVDRLI 132

Query: 128 LGGVGSVLYDSDVV 141
           L G G V  D +VV
Sbjct: 133 LVGAGGVTKDVNVV 146


>gi|118464984|ref|YP_882786.1| hydrolase [Mycobacterium avium 104]
 gi|118166271|gb|ABK67168.1| hydrolase [Mycobacterium avium 104]
          Length = 343

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 70/140 (50%), Gaps = 9/140 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ A+   G    P ILLIHG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 23  FRTIHGYRRAYRIAGS--GPAILLIHGIGDN-STTW---NTVQAKLAQRFTVIAPDLLGH 76

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 77  GQSDKP--RADYSVAAYANGMRDLLAVLDIERVTIVGHSLGGGVAMQFAYQFPHLVERLI 134

Query: 128 LGGVGSVLYDSD-VVDWQSL 146
           L G G V  D + V+ W SL
Sbjct: 135 LVGAGGVTKDVNFVLRWASL 154


>gi|254776049|ref|ZP_05217565.1| hydrolase [Mycobacterium avium subsp. avium ATCC 25291]
          Length = 343

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 70/140 (50%), Gaps = 9/140 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ A+   G    P ILLIHG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 23  FRTIHGYRRAYRIAGS--GPAILLIHGIGDN-STTW---NTVQAKLAQRFTVIAPDLLGH 76

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 77  GQSDKP--RADYSVAAYANGMRDLLAVLDIERVTIVGHSLGGGVAMQFAYQFPHLVERLI 134

Query: 128 LGGVGSVLYDSD-VVDWQSL 146
           L G G V  D + V+ W SL
Sbjct: 135 LVGAGGVTKDVNFVLRWASL 154


>gi|226224277|ref|YP_002758384.1| prolyl aminopetidase [Listeria monocytogenes Clip81459]
 gi|254824261|ref|ZP_05229262.1| hydrolase [Listeria monocytogenes FSL J1-194]
 gi|254933650|ref|ZP_05267009.1| hydrolase [Listeria monocytogenes HPB2262]
 gi|254992388|ref|ZP_05274578.1| prolyl aminopetidase [Listeria monocytogenes FSL J2-064]
 gi|255520988|ref|ZP_05388225.1| prolyl aminopetidase [Listeria monocytogenes FSL J1-175]
 gi|225876739|emb|CAS05448.1| Putative prolyl aminopetidase [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|293585213|gb|EFF97245.1| hydrolase [Listeria monocytogenes HPB2262]
 gi|293593497|gb|EFG01258.1| hydrolase [Listeria monocytogenes FSL J1-194]
 gi|328465040|gb|EGF36319.1| prolyl aminopeptidase [Listeria monocytogenes 1816]
 gi|328474013|gb|EGF44826.1| prolyl aminopeptidase [Listeria monocytogenes 220]
          Length = 275

 Score = 72.4 bits (176), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 105/251 (41%), Gaps = 32/251 (12%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R Y       G+K  P +L++HG   + +T   F   I  L +  F +IA D LGHG + 
Sbjct: 6   RHYHLTTAISGEK--PALLMLHGFTGTSET---FQDSISGLKEH-FNIIAPDLLGHGNTA 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
                + Y +  +  D   +L  L IS+  V+GYSMG R+A +    +P  VR +IL   
Sbjct: 60  SPEEISPYTMENICEDLAGILHQLNISRCFVLGYSMGGRVATAFAATFPKRVRGLILVSS 119

Query: 132 GSVLYDSDV-----------VDWQSLIDSFLLPSIDEVQN------------PLGKKFRK 168
              L  +D+            DW  + +  L+P +D  +N             + ++ R 
Sbjct: 120 SPGLEQADIRESRVAADNRLADW--IEEEGLVPFVDYWENLALFASQKVLSPEMKRRIRS 177

Query: 169 FADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPS 227
                  + L      +   ++P   + L     PVL+  G+ D+      QE+   +P+
Sbjct: 178 ERLSQNSHGLAMSLRGMGTGKQPSYWNCLANFTFPVLLITGALDEKFEKIAQEMHQLLPN 237

Query: 228 SQYLNICRRDH 238
           S +++I    H
Sbjct: 238 STHVSIQEAGH 248


>gi|325958970|ref|YP_004290436.1| alpha/beta hydrolase fold protein [Methanobacterium sp. AL-21]
 gi|325330402|gb|ADZ09464.1| alpha/beta hydrolase fold protein [Methanobacterium sp. AL-21]
          Length = 240

 Score = 72.4 bits (176), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 32  IHGLASSVQTNWLFSGWIQLLCDQ-----GFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           I G    +   W   G I    D+      +++I FDN G G++DK    ++Y +  MA 
Sbjct: 14  IFGEGKPLMIIWGMGGEIGSFVDKLKETKNYKLITFDNRGTGRTDKP--NDEYTIEIMAE 71

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           DA+SLL+ L I KV ++G SMG+RIA +M   YP  V ++IL
Sbjct: 72  DAISLLDELKIQKVSILGISMGSRIAITMAAKYPDRVSNLIL 113


>gi|187934215|ref|YP_001884874.1| hydrolase, alpha/beta hydrolase fold family [Clostridium botulinum
           B str. Eklund 17B]
 gi|187722368|gb|ACD23589.1| hydrolase, alpha/beta hydrolase fold family [Clostridium botulinum
           B str. Eklund 17B]
          Length = 243

 Score = 72.4 bits (176), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 112/240 (46%), Gaps = 24/240 (10%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V  K    ++L+HG    ++    F   I+   ++ + VIA D  GHGKS K  I  
Sbjct: 17  YYEVHGK-GEALVLLHGNGEDLE---YFKNQIEYFSNK-YMVIAIDTRGHGKSTKGNIPF 71

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
           D+ L   + D +S+L+ + I K H++G+S G   A  + L YP  +RS+IL G     ++
Sbjct: 72  DFWL--FSDDVISILDKVNIKKAHILGFSDGGNTALHLGLKYPDRIRSLILNGAN---FN 126

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP-FCQDD 196
            + V +       L   +  + +P   K +   D+              M+  P   ++ 
Sbjct: 127 PNGVKFLVQAPVILGYYLSIIFSPCSNKAKNNRDI-----------LNLMVNNPKLFKEQ 175

Query: 197 LYRIDVPVLIAVGSQDDLAGSPQELMS-FIPSSQYLNICRRDHLLAVGD-KQFKQGVVNF 254
           L +I +P L+  G  D +  +  +L+S  I +S+   I    H +A  + K+F + V +F
Sbjct: 176 LEKIKIPTLVIAGDNDMIKENHTKLISKLIENSEVNIISNSSHFVAAENPKEFNKIVEDF 235


>gi|296171816|ref|ZP_06852930.1| alpha/beta hydrolase fold family hydrolase [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295893952|gb|EFG73720.1| alpha/beta hydrolase fold family hydrolase [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 343

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 66/133 (49%), Gaps = 8/133 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   YQ A+   GD   P ILL+HG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 23  FRTIHGYQRAYRIAGD--GPAILLVHGIGDN-STTW---NTVQAKLAQRFTVIAPDLLGH 76

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 77  GRSDKP--RADYSVAAYANGMRDLLSVLDIERVTIVGHSLGGGVAMQFAYQFPHLVERLI 134

Query: 128 LGGVGSVLYDSDV 140
           L   G V  D +V
Sbjct: 135 LVAAGGVTKDVNV 147


>gi|229199027|ref|ZP_04325712.1| hypothetical protein bcere0001_45410 [Bacillus cereus m1293]
 gi|228584440|gb|EEK42573.1| hypothetical protein bcere0001_45410 [Bacillus cereus m1293]
          Length = 240

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 82/178 (46%), Gaps = 21/178 (11%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           F++I  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +M 
Sbjct: 15  FQIILVDIVGHGKTESPEDVTHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMA 74

Query: 117 LFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------EVQ 159
             YP YVRS++L    + L   D    +   D  L   I+                 E Q
Sbjct: 75  CLYPEYVRSLLLENCTAGLEREDERKERCEKDERLAQKIEREGIESFVSMWENIPLFETQ 134

Query: 160 NPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
             L +  ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 135 KRLAQNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 192


>gi|163794834|ref|ZP_02188804.1| putative beta-ketoadipate enol-lactone hydrolase protein [alpha
           proteobacterium BAL199]
 gi|159180107|gb|EDP64632.1| putative beta-ketoadipate enol-lactone hydrolase protein [alpha
           proteobacterium BAL199]
          Length = 264

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 107/239 (44%), Gaps = 29/239 (12%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFRVIAFDNLGHGKSDKSYIENDY 79
           G +DAP ++  + L +       F  W ++L   D  FR + +D  GHG +       D+
Sbjct: 17  GPEDAPALVFANSLGTD------FRIWDRVLSHLDNRFRTLRYDMRGHGLTGAG--SGDF 68

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +  +AAD   LL+H+G  +  V G S+G  IA  +V  +PS VR+++L    S +   +
Sbjct: 69  DIPRLAADLEGLLQHVGFDRTLVCGLSIGGLIALQLVRDHPSRVRALVLCDTASKIGTPE 128

Query: 140 VVDWQSLIDSFLLPSIDEVQNPLGKK-FRKFADLDPGNDLKA------------LASCLS 186
           +  WQ+ I +     ++ + + + ++ F     L   ++L A             A   +
Sbjct: 129 M--WQARITAIEQNGLESLADGVMERWFAPSFRLSRRDELAAWRTMLVRTPAEGYARACA 186

Query: 187 MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRDHLLAV 242
            IR      D  RI VP L   GS+D  A +P   + L   IP +QY  I    HL  V
Sbjct: 187 AIRDADLTADAARIAVPTLAICGSEDG-ATTPAVVKALAESIPGAQYREIADAGHLPCV 244


>gi|46907905|ref|YP_014294.1| alpha/beta fold family hydrolase [Listeria monocytogenes str. 4b
           F2365]
 gi|254852301|ref|ZP_05241649.1| hydrolase [Listeria monocytogenes FSL R2-503]
 gi|300766041|ref|ZP_07076010.1| hypothetical protein LMHG_12843 [Listeria monocytogenes FSL N1-017]
 gi|46881174|gb|AAT04471.1| hydrolase, alpha/beta fold family [Listeria monocytogenes serotype
           4b str. F2365]
 gi|258605607|gb|EEW18215.1| hydrolase [Listeria monocytogenes FSL R2-503]
 gi|300513243|gb|EFK40321.1| hypothetical protein LMHG_12843 [Listeria monocytogenes FSL N1-017]
          Length = 275

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 105/251 (41%), Gaps = 32/251 (12%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R Y       G+K  P +L++HG   + +T   F   I  L +  F +IA D LGHG + 
Sbjct: 6   RHYHLTTAISGEK--PALLMLHGFTGTSET---FQDSISDLKEH-FNIIAPDLLGHGNTA 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
                + Y +  +  D   +L  L IS+  V+GYSMG R+A +    +P  VR +IL   
Sbjct: 60  SPEEISPYTMENICEDLAGILHQLNISRCFVLGYSMGGRVATAFAATFPKRVRGLILVSS 119

Query: 132 GSVLYDSDV-----------VDWQSLIDSFLLPSIDEVQN------------PLGKKFRK 168
              L  +D+            DW  + +  L+P +D  +N             + ++ R 
Sbjct: 120 SPGLEQADIRESRVAADNRLADW--IEEEGLVPFVDYWENLALFASQKVLSPEMKRRIRS 177

Query: 169 FADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPS 227
                  + L      +   ++P   + L     PVL+  G+ D+      QE+   +P+
Sbjct: 178 ERLSQNSHGLAMSLRGMGTGKQPSYWNCLANFTFPVLLITGALDEKFEKIAQEMHQLLPN 237

Query: 228 SQYLNICRRDH 238
           S +++I    H
Sbjct: 238 STHVSIQEAGH 248


>gi|221218193|ref|YP_002524220.1| Esterase/lipase/thioesterase [Rhodobacter sphaeroides KD131]
 gi|221163220|gb|ACM04186.1| Esterase/lipase/thioesterase [Rhodobacter sphaeroides KD131]
          Length = 266

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 120/254 (47%), Gaps = 25/254 (9%)

Query: 15  QFAFYD-VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
            + +YD +G  DAP + + H L S    + +++  +  L + GF+V+  D  GHG S   
Sbjct: 8   HWIYYDLIGAPDAPVVCMSHSLTSD---HGMWAEQVPALLEAGFQVLRIDTRGHGGSGAP 64

Query: 74  YIENDYRLVFMAADAVSLLEHLGI-SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
               DYR+  +A + +S+L+ LG  S VH++G SMG  I   +   +P  + S+++    
Sbjct: 65  --PGDYRIEELAGNVLSVLDALGFESGVHMIGLSMGGMIGQVIAADHPGRLASLMVCCSA 122

Query: 133 SV-LYDSDVVDWQ--SLIDSFLLPSI--DEVQNPLGKKFRKFADLD--------PGNDLK 179
           S  + D++++  +  ++ +S  L SI    ++   G  FR+   L          G  L 
Sbjct: 123 SKWMGDTELMQGRIRAVKESGTLESIVAANMERRYGPGFRERRPLRWEALRQTFLGTKLD 182

Query: 180 ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNICRR 236
               C++       +  L +ID+PVL+  GS+D     P +   + S IP ++Y  I   
Sbjct: 183 GYFGCMNACLTHNVEPRLGQIDIPVLVVAGSEDPTT-PPADNRLIASCIPGARYAEIAGG 241

Query: 237 DHLLAVG-DKQFKQ 249
            H   V  D +F +
Sbjct: 242 YHFPNVEFDGEFNR 255


>gi|229175574|ref|ZP_04303084.1| hypothetical protein bcere0006_46520 [Bacillus cereus MM3]
 gi|228607970|gb|EEK65282.1| hypothetical protein bcere0006_46520 [Bacillus cereus MM3]
          Length = 240

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIQNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YV S++L    + L   +    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVHSLLLENCTAGLESEEARKERCEKDERLADKIEREGINSFVTMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKRLAQNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELQNLKIPVLLMNGEHDE 192


>gi|254821020|ref|ZP_05226021.1| hydrolase [Mycobacterium intracellulare ATCC 13950]
          Length = 343

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 69/140 (49%), Gaps = 9/140 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ A+   G    P ILLIHG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 23  FRTIHGYRRAYRIAGS--GPAILLIHGIGDN-STTW---NAVQAKLAQRFTVIAPDLLGH 76

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +  ++G+S+G  +A      +P  V  +I
Sbjct: 77  GRSDKP--RADYSIAAYANGMRDLLSVLDIERATIVGHSLGGGVAMQFAYQFPHLVERLI 134

Query: 128 LGGVGSVLYDSD-VVDWQSL 146
           L G G V  D + V+ W SL
Sbjct: 135 LVGAGGVTKDVNFVLRWASL 154


>gi|300785244|ref|YP_003765535.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
 gi|299794758|gb|ADJ45133.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
          Length = 241

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 110/259 (42%), Gaps = 25/259 (9%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
           ++ FR+    + A+ +VG      ++L HG   S + +WL  G   +L + G RVI  D 
Sbjct: 1   MESFRARDDRELAWREVGGGR--PLVLFHGFTGSSR-DWL--GPAAVLAEHGHRVILPDL 55

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
            GHG S   +    Y    +A D ++LL+HLG+    + GYS G R+   ++       R
Sbjct: 56  RGHGASAAPHDPAAYPPDVLADDGLALLDHLGLDDYDLGGYSYGGRVVLRLLARGARPGR 115

Query: 125 SVILG-GVGSVLYDSDVVD-----WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL 178
           +V+ G G+ ++   +           +LID        E   P    +        G D 
Sbjct: 116 AVVAGQGLDAIRRTTSRTGVYHDALTALIDG-------EPAEPGSPAYWMH---QAGGDP 165

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDH 238
            AL   L          DL RI  P L+ VG +DD   +  EL + +P+ ++  +   +H
Sbjct: 166 VALRHVLGTH---VPTTDLDRITTPTLVVVGDEDDGHATAGELAAALPNGRFARVP-GNH 221

Query: 239 LLAVGDKQFKQGVVNFYAN 257
             A+   +    +V F A 
Sbjct: 222 FTAMTGPELTAAMVEFLAQ 240


>gi|297193737|ref|ZP_06911135.1| hydrolase [Streptomyces pristinaespiralis ATCC 25486]
 gi|297151914|gb|EFH31420.1| hydrolase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 291

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 115/256 (44%), Gaps = 37/256 (14%)

Query: 14  YQFAFYDVGDKDA---PTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGK 69
           ++FA    G  +    P +LL+HGL     ++W  +  W+     +  R +A D  GHG+
Sbjct: 22  WEFADPPKGRAEGDTTPGVLLLHGLMGRA-SHWASTARWLS----ERHRAVALDQRGHGR 76

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           SDK   E  Y      ADA + +E LG++ V ++G++MGA  A  +    P  VR++I+ 
Sbjct: 77  SDKP-AEGPYTRDAYVADAEAAIEQLGLAPVTLIGHAMGALTAWQLAAKRPDLVRALIIC 135

Query: 130 GV-GSVLYDSDVVDWQSLIDSFLLPSID---------------EVQNPLGKKFRKFADL- 172
            +  S L  +   +W+    S+ +P                  E  NP   +F  FA++ 
Sbjct: 136 DMRASALGAASQREWEEWFRSWPVPFATLADVRKWFGEDDPRVERPNPARGEF--FAEVM 193

Query: 173 -DPGNDLKALASCLSMI--RKPFCQD----DLYRIDVPVLIAVGSQDDLA-GSPQELMSF 224
            +  +  + + S   M+  R+ +  D    +L ++  P L+  G   +L     QE++  
Sbjct: 194 AERADGWRPVFSRRQMLTSRETWVHDAHWEELAQVRCPTLVVRGLDGELGRAEAQEMVRV 253

Query: 225 IPSSQYLNICRRDHLL 240
           +P  QY  +    HL+
Sbjct: 254 LPRGQYGEVSDAGHLV 269


>gi|242086460|ref|XP_002443655.1| hypothetical protein SORBIDRAFT_08g022970 [Sorghum bicolor]
 gi|241944348|gb|EES17493.1| hypothetical protein SORBIDRAFT_08g022970 [Sorghum bicolor]
          Length = 326

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 87/186 (46%), Gaps = 24/186 (12%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           G  D P +LLIHG         L+  W   +  L  +GFR +A D  G+G S        
Sbjct: 27  GPADGPAVLLIHGFPE------LWLSWRHQMAALAARGFRALAPDLRGYGDSSVPTDPAA 80

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y ++ +  D V+LL+HL ++KV V+G+  GA++A  + LF P  VR+ ++ G+      S
Sbjct: 81  YSILHIVGDLVALLDHLQLTKVFVVGHDWGAQVAWHLCLFRPDRVRAAVVLGIPYFPRGS 140

Query: 139 DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASC-LSMIRKPFCQDDL 197
                + L D F+         PLG  +     L+PG   +A A   ++ + K F   ++
Sbjct: 141 -----RPLTDRFV---------PLGDGYYINQFLEPGRTERAFARYDVATVLKKFYAMEI 186

Query: 198 YRIDVP 203
             I  P
Sbjct: 187 DEILAP 192


>gi|228988120|ref|ZP_04148219.1| hypothetical protein bthur0001_47800 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228771618|gb|EEM20085.1| hypothetical protein bthur0001_47800 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 240

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 81/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           Q F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  QQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
               YP YVRS++L    + L   D    +   D  L   I+                 E
Sbjct: 73  TACLYPEYVRSLLLENCTAGLESEDERKDRCEKDERLAQKIEREGIESFVSMWESIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKRLAQNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELKNLKMPVLLMNGEHDE 192


>gi|85374310|ref|YP_458372.1| hydrolase [Erythrobacter litoralis HTCC2594]
 gi|84787393|gb|ABC63575.1| hydrolase [Erythrobacter litoralis HTCC2594]
          Length = 264

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 106/237 (44%), Gaps = 19/237 (8%)

Query: 4   EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           + + F S+   + A + VG+  A   +L+HGL SS   NW+  G  + +   G+ V+  D
Sbjct: 13  KTERFVSFDGTELALHRVGEGQA--FVLLHGLFSSADMNWIKWGHAERIAAAGYEVLMLD 70

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
              HG+S+  +    Y    +  D  +L++HL +    + G+S+GAR +   V     + 
Sbjct: 71  FRVHGQSEAPHDPEKYPENVLVRDVAALVDHLALEDYVLGGFSLGARTSLHAVAQGVLHP 130

Query: 124 RSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQ-----NP--LGKKFRKFADLDPGN 176
           + +++GG+G+    + + +W      FL   IDE +     +P     +F K   +D   
Sbjct: 131 QRLVIGGMGT----AGLGEWSKRSAHFLR-VIDEFETIERGDPAYFSMQFLKSQGVD--- 182

Query: 177 DLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNI 233
             +  A  L           L  I +P L+  G +D   GS  EL   +P + Y+ +
Sbjct: 183 --RVAARMLLTTLPDMDLAALANITIPSLVVCGDEDRDNGSAAELAGLLPDATYVEV 237


>gi|220908773|ref|YP_002484084.1| alpha/beta hydrolase fold protein [Cyanothece sp. PCC 7425]
 gi|219865384|gb|ACL45723.1| alpha/beta hydrolase fold protein [Cyanothece sp. PCC 7425]
          Length = 283

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 110/265 (41%), Gaps = 26/265 (9%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           YQF +   G++ +P IL +HG     +    F   IQLL    FR ++ D  GHG +  +
Sbjct: 18  YQFHYTWTGNEQSPVILFLHGFLGDCRE---FESVIQLLSTD-FRCLSVDLPGHGLTQVT 73

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
             E DY +   AA  V+ L  LGI   +++GYSMG R+A  + L +P     V+L     
Sbjct: 74  E-EEDYTMPRTAAALVNWLNQLGIKSCYLVGYSMGGRLALYLALNFPQCFPKVVLESASP 132

Query: 134 VLYDS-----DVVDWQSLIDSFLLPSIDEV-----QNPLGKKFRKFADLD-------PGN 176
            L  +          + L +     +  E        PL    +K    D        GN
Sbjct: 133 GLKTAAERQQRRQRDRQLAEELATGNFREFVRRWYDQPLFASLKKHPQFDQLLERRLQGN 192

Query: 177 DLKALASC--LSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNI 233
            L+   S   L +  +P   + L    VP+L+ VG  D       QE+    P +Q  ++
Sbjct: 193 PLQLAHSLAHLGLGDQPSLWEKLPEAQVPLLLLVGEADQKFLAVNQEMAQSCPVAQLYSL 252

Query: 234 CRRDHLLAVGDK-QFKQGVVNFYAN 257
               H L + D   F + + NF+ +
Sbjct: 253 PGCGHNLHIEDSLGFAEILQNFFGD 277


>gi|229591942|ref|YP_002874061.1| putative esterase [Pseudomonas fluorescens SBW25]
 gi|229363808|emb|CAY51245.1| putative esterase [Pseudomonas fluorescens SBW25]
          Length = 267

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 90/197 (45%), Gaps = 19/197 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHGL SS Q +W     + +L  + +R+I  D  GHG+SDK      Y +     D 
Sbjct: 22  LILIHGLGSSSQ-DWELQ--VPVLA-RHYRLIVVDVRGHGRSDKP--RERYSIQGFTHDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDS--DVVDWQS 145
           ++L+EHL +   HV+G SMG  IA  + +  P+ VRS+ I+     V   S  D   W  
Sbjct: 76  LALIEHLHLPPAHVVGLSMGGMIAFQLAVDEPALVRSLCIVNSAPEVKVRSADDYWQWAK 135

Query: 146 LIDSFLLPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
                 + S+  + N LG++           RK A+    ND +A  +    I     Q+
Sbjct: 136 RWTLARVLSLATIGNALGERLFPKPHQADLRRKMAERWAKNDKRAYLASFDAIVGWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQD 212
            L RI  P L+     D
Sbjct: 196 RLSRITCPTLVISADHD 212


>gi|296536174|ref|ZP_06898300.1| 3-oxoadipate enol-lactone hydrolase [Roseomonas cervicalis ATCC
           49957]
 gi|296263504|gb|EFH10003.1| 3-oxoadipate enol-lactone hydrolase [Roseomonas cervicalis ATCC
           49957]
          Length = 182

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 69/131 (52%), Gaps = 12/131 (9%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFRVIAFDNLGHGKSDKSYIENDY 79
           G ++AP +LL+H + +S+        W   +    + +RVI  D  GHG S       D+
Sbjct: 16  GPEEAPPLLLLHSIGTSLHV------WDPQMAALTRRYRVIRADLRGHGLS--GVTPGDH 67

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +  +A DAV+LL+ LGI++ HV G S+G R+A  M    P  V S++L  V + L   D
Sbjct: 68  GMARLARDAVALLDALGIARAHVAGLSIGGRVALEMAALAPERVASLLL--VCTALEFPD 125

Query: 140 VVDWQSLIDSF 150
              WQ+ I++ 
Sbjct: 126 AATWQARIEAV 136


>gi|229193141|ref|ZP_04320096.1| hypothetical protein bcere0002_47910 [Bacillus cereus ATCC 10876]
 gi|228590405|gb|EEK48269.1| hypothetical protein bcere0002_47910 [Bacillus cereus ATCC 10876]
          Length = 240

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 90/182 (49%), Gaps = 25/182 (13%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVAHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYD--------------SDVVDWQSLIDSFL-----LPSI 155
           M   YP YV S++L    + L +              +D ++ +  I+SF+     +P +
Sbjct: 73  MACLYPDYVHSLLLENCTAGLENEADRKERREKDDRLADKIEREG-IESFVSMWENIP-L 130

Query: 156 DEVQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQ 211
            E Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  
Sbjct: 131 FETQRRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEH 190

Query: 212 DD 213
           D+
Sbjct: 191 DE 192


>gi|156741296|ref|YP_001431425.1| alpha/beta hydrolase fold protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232624|gb|ABU57407.1| alpha/beta hydrolase fold [Roseiflexus castenholzii DSM 13941]
          Length = 269

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 62/118 (52%), Gaps = 10/118 (8%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKS 70
           +  + + D G  D   ++L+HG   S  T      W +++    Q FRVI  D  GHG++
Sbjct: 8   RIAYHYLDTGRGD--PLVLLHGFTGSSAT------WDEVVPHFMQRFRVIRIDLPGHGRT 59

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
                     L  +AAD  +LL HL  +  H++GYSMGAR+A  + + +P  VRS+IL
Sbjct: 60  PAPVGPTRGALPSVAADIAALLRHLNAAPAHLLGYSMGARLALGIAVLHPDVVRSLIL 117


>gi|284044168|ref|YP_003394508.1| alpha/beta hydrolase fold protein [Conexibacter woesei DSM 14684]
 gi|283948389|gb|ADB51133.1| alpha/beta hydrolase fold protein [Conexibacter woesei DSM 14684]
          Length = 284

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 67/126 (53%), Gaps = 2/126 (1%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           M +  + F    K    + D G+++   +LL+ GL+S +  +W     +  L ++G+RVI
Sbjct: 1   MSDPRERFAELTKVTACYRDEGNENGEPLLLVMGLSSQL-IHWPQE-IVDALGERGYRVI 58

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
            FDN   G +        Y L  MA DAV LL+HLGI + HV+G SMG  I+  + +  P
Sbjct: 59  RFDNRDSGLTRWKVTPAQYFLQAMADDAVELLDHLGIEQAHVVGASMGGMISQLIAIGRP 118

Query: 121 SYVRSV 126
             VR++
Sbjct: 119 ERVRTL 124


>gi|288922817|ref|ZP_06416983.1| hydrolase, alpha/beta hydrolase fold family protein [Frankia sp.
           EUN1f]
 gi|288345832|gb|EFC80195.1| hydrolase, alpha/beta hydrolase fold family protein [Frankia sp.
           EUN1f]
          Length = 224

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 92/217 (42%), Gaps = 17/217 (7%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D P ++L+HGL SS +  W  +GWI +L + G  V+  D  GHG S +      Y     
Sbjct: 3   DNPPVVLVHGLGSSSEHGWRGAGWIDMLQEAGREVLLVDLPGHGTSRRDTDPASY----- 57

Query: 85  AADAVSLLEHL--GISKVHVMGYSMGARIAC-SMVLFYPSYVRSVILGGVGSVLYDSDVV 141
            ADA + +     G   V  +G+S GA +   S V    S+ R  ++G          ++
Sbjct: 58  -ADAAAEIAETFAGRGPVDAVGFSAGAHLLLESAVRGLASFNRLALIG------LGPRML 110

Query: 142 DWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRID 201
           +++        P   +  + L +  +  A    GND+ A+ +       P     L  + 
Sbjct: 111 EFRPEQGRAFTPDASDGTDVLARVIKGLA-RRAGNDIDAVLAFARRPATPLTAAGLATVA 169

Query: 202 VPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDH 238
             VL+ +G + D AGSP E  +  P +    I   DH
Sbjct: 170 CEVLVVIGER-DTAGSPDEFAALFPKATGRTIDGADH 205


>gi|261418048|ref|YP_003251730.1| alpha/beta hydrolase fold protein [Geobacillus sp. Y412MC61]
 gi|319767993|ref|YP_004133494.1| alpha/beta hydrolase fold protein [Geobacillus sp. Y412MC52]
 gi|261374505|gb|ACX77248.1| alpha/beta hydrolase fold protein [Geobacillus sp. Y412MC61]
 gi|317112859|gb|ADU95351.1| alpha/beta hydrolase fold protein [Geobacillus sp. Y412MC52]
          Length = 270

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 9/106 (8%)

Query: 25  DAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           +   +LL+HG   S  T W  L   W        FRV+A D LGHG+++       YR+ 
Sbjct: 17  EGEPLLLLHGFTGSADT-WRPLAPFWPD------FRVMAVDLLGHGRTEAPKDARRYRIE 69

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             AAD  +LL+  G+ +V+V+GYSMG R+A +  +++P  VR ++L
Sbjct: 70  HAAADLTALLDEWGVEQVNVLGYSMGGRLALAFAVWHPHRVRRLVL 115


>gi|254516362|ref|ZP_05128421.1| putative epoxide hydrolase 2 [gamma proteobacterium NOR5-3]
 gi|219674785|gb|EED31152.1| putative epoxide hydrolase 2 [gamma proteobacterium NOR5-3]
          Length = 280

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +  YD GD D   +LL+HG+     T+ L+      L   GFRVIA D LG+G++DK   
Sbjct: 15  YHVYDEGDSDR-VVLLLHGMPD---TSALWEHQAASLVAAGFRVIAPDMLGYGETDKPQA 70

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
              Y    + AD ++L EHL I+K+ V+G+  GA +A  +VL  P   R  +   VG
Sbjct: 71  TARYAAEHILADMLALFEHLKIAKMDVVGHDWGAFVAWELVLLKPELFRKHVALAVG 127


>gi|94496365|ref|ZP_01302942.1| alpha/beta hydrolase [Sphingomonas sp. SKA58]
 gi|94424111|gb|EAT09135.1| alpha/beta hydrolase [Sphingomonas sp. SKA58]
          Length = 254

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 100/228 (43%), Gaps = 9/228 (3%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHG  S+  TNW+  G    L + GFR+I  D  GHG+S K +    Y    +  D 
Sbjct: 31  LVLIHGYFSNAWTNWIRYGHAAKLVEAGFRLILPDLRGHGESAKPHDAAAYPADALTDDN 90

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG--SVLYDSDVVDWQSL 146
           + L+E L ++   + GYS+GAR    M L   +  R VIL G+G   +    D   + + 
Sbjct: 91  LGLIEQLDLTDYDLGGYSLGARTTVRM-LARGATPRRVILSGMGLRGLTQTLDNGGYYTN 149

Query: 147 IDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLI 206
           + + L          + + F K    DP   +  L    + +  P   D +        +
Sbjct: 150 VLTNLGTFARGTSEWMTEAFLKTTKGDP---VALLHILNTFVDTP--ADVIANFPQRAAV 204

Query: 207 AVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             G+ DD  GS  EL   +    Y  +   +H+ AV  K+  Q +V+F
Sbjct: 205 ICGADDDSNGSAHELADILRDGHYFEVP-GNHMNAVTRKELGQAMVDF 251


>gi|13366133|dbj|BAB39459.1| BioH [Kurthia sp. 538-KA26]
          Length = 267

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 118/270 (43%), Gaps = 45/270 (16%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V  +  P +LLI GL  +   +W  +  +  L  + F+VI FDN G GKS K   E 
Sbjct: 12  YYEVHGQGDP-LLLIMGLGYN-SLSWHRT--VPTLAKR-FKVIVFDNRGVGKSSKP--EQ 64

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-----GGVG 132
            Y +  MA DA ++L+ + +   HV G SMG  IA  + + YP  VRS++L     GG  
Sbjct: 65  PYSIEMMAEDARAVLDAVSVDSAHVYGISMGGMIAQRLAITYPERVRSLVLGCTTAGGTT 124

Query: 133 SVLYDSDV----VDWQSLIDS----------------FLLPSIDEVQNPLGKKFRKFADL 172
            +    ++    V   SL  S                F+    + +Q  + K+       
Sbjct: 125 HIQPSPEISTLMVSRASLTGSPRDNAWLAAPIVYSQAFIEKHPELIQEDIQKRIEIIT-- 182

Query: 173 DPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE----LMSFIPSS 228
            P   L  L +CL+        ++L +I++P LI  G  D+L   P E    L   I  S
Sbjct: 183 PPSAYLSQLQACLTH----DTSNELDKINIPTLIIHGDADNLV--PYENGKMLAERIQGS 236

Query: 229 QYLNICRRDHL-LAVGDKQFKQGVVNFYAN 257
           Q+  +    H+ L    K+    V+ F A+
Sbjct: 237 QFHTVSCAGHIYLTEAAKEANDKVIQFLAH 266


>gi|226495369|ref|NP_001147768.1| LOC100281378 [Zea mays]
 gi|195613630|gb|ACG28645.1| epoxide hydrolase 2 [Zea mays]
 gi|223942205|gb|ACN25186.1| unknown [Zea mays]
          Length = 329

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 79/160 (49%), Gaps = 9/160 (5%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  DAP +LLIHG    +  +W     +  L  +GFR +A D  G+G S        Y +
Sbjct: 30  GAADAPAVLLIHGF-PELWLSWRHQ--MAALAARGFRALAPDLRGYGDSSVPTDPAAYSI 86

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
           + +  D V+LL+HL ++KV V+G+  GA +A  + LF P  VR+ ++ G+         +
Sbjct: 87  LHLVGDLVALLDHLQLTKVFVVGHDWGAMVAWHLCLFRPDRVRAAVVLGIPYFPRGPRPM 146

Query: 142 --DWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLK 179
              +  L D F    I++ Q P G+  R FA  D    LK
Sbjct: 147 TDSFAKLGDGFY---INQFQEP-GRAERAFARYDVATVLK 182


>gi|239828128|ref|YP_002950752.1| alpha/beta hydrolase [Geobacillus sp. WCH70]
 gi|239808421|gb|ACS25486.1| alpha/beta hydrolase fold protein [Geobacillus sp. WCH70]
          Length = 270

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 106/263 (40%), Gaps = 37/263 (14%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           D   +LL+HG   SV+T      W   L   + ++++  D +GHG +D       Y +  
Sbjct: 17  DGEPLLLLHGFTGSVET------WKPFLPYWRDYQLVLVDIIGHGLTDSPNDPARYEMEK 70

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW 143
            AAD   +L +  +   HV+GYSMG R+A +  + YP  VR++IL      L        
Sbjct: 71  AAADLDEILRYFHLQDAHVLGYSMGGRLALTFAILYPHRVRTLILESSSPGLKTMQERRE 130

Query: 144 QSLIDSFLLPSIDE-------------------------VQNPLGKKFRKFADLDPGNDL 178
           +   D  L   I++                         VQ  +  +      L   N L
Sbjct: 131 RMKRDEALAEEIEQYGVTAFVEKWENMPLFASQKRLPLSVQQQIRNERLNNNALGLANSL 190

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRD 237
           + + +     R+P   + L +++VP L+  G  D       +E+  ++P+ + + +    
Sbjct: 191 RGMGTG----RQPSFWNRLSKVNVPTLLLCGEWDQKFCRIAEEMKEYLPNCEMIKVPEAG 246

Query: 238 HLLAVGDKQFKQGVVNFYANELR 260
           H + V  ++    +V+ +    R
Sbjct: 247 HAIHVEQREIFAKIVSRFITRRR 269


>gi|47096747|ref|ZP_00234331.1| hydrolase, alpha/beta fold family [Listeria monocytogenes str. 1/2a
           F6854]
 gi|254898159|ref|ZP_05258083.1| hypothetical protein LmonJ_00050 [Listeria monocytogenes J0161]
 gi|254912348|ref|ZP_05262360.1| hydrolase [Listeria monocytogenes J2818]
 gi|254936675|ref|ZP_05268372.1| hydrolase [Listeria monocytogenes F6900]
 gi|47014879|gb|EAL05828.1| hydrolase, alpha/beta fold family [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258609271|gb|EEW21879.1| hydrolase [Listeria monocytogenes F6900]
 gi|293590329|gb|EFF98663.1| hydrolase [Listeria monocytogenes J2818]
          Length = 275

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 101/236 (42%), Gaps = 26/236 (11%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P +L++HG   + +T   F   I  L  + F +IA D LGHG +      + Y +  +
Sbjct: 17  EKPALLMLHGFTGTSET---FQDSISGL-KKRFNIIAPDLLGHGNTASPEEISPYTMENI 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV---- 140
             D   +L  L IS+  V+GYSMG R+A +    +P  VR +IL      L  +D+    
Sbjct: 73  CEDLAGILHQLNISRCFVLGYSMGGRVATAFAATFPKRVRGLILVSSSPGLEQADIRASR 132

Query: 141 -------VDW------QSLIDSF----LLPSIDEVQNPLGKKFRKFADLDPGNDLKALAS 183
                   DW      +S +D +    L  S + +   + K+ R        + L     
Sbjct: 133 VEADNRLADWIEEEDMESFVDYWENLALFASQEVLSAEMKKRIRSERLSQNSHGLAMSLR 192

Query: 184 CLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
            +   ++P   + L     PVL+  G+ D+      QE+   +P+S +++I    H
Sbjct: 193 GMGTGKQPSYWNCLANFTFPVLLITGALDEKFEKIAQEMHQLLPNSTHVSIQEAGH 248


>gi|229153065|ref|ZP_04281246.1| hypothetical protein bcere0011_45960 [Bacillus cereus m1550]
 gi|228630485|gb|EEK87133.1| hypothetical protein bcere0011_45960 [Bacillus cereus m1550]
          Length = 240

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 88/181 (48%), Gaps = 23/181 (12%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I KVH++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVAHYDIRNVALQMKELLDYLHIEKVHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYD--------------SDVVDWQSLIDSFLLPSID---- 156
           M   YP YV S++L    + L D              +D ++ +  I+SF+    D    
Sbjct: 73  MACLYPDYVHSLLLENCTAGLEDEADRKERREKDDRLADKIEREG-IESFVSMWEDIPLF 131

Query: 157 EVQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQD 212
             Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  D
Sbjct: 132 ATQKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEYD 191

Query: 213 D 213
           +
Sbjct: 192 E 192


>gi|291446851|ref|ZP_06586241.1| hydrolase [Streptomyces roseosporus NRRL 15998]
 gi|291349798|gb|EFE76702.1| hydrolase [Streptomyces roseosporus NRRL 15998]
          Length = 314

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 114/258 (44%), Gaps = 28/258 (10%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           DAP +LL+HGL     ++W  +   + L ++  R +  D  GHG+S+K   +  Y     
Sbjct: 49  DAPGVLLLHGLMGRA-SHWAPT--ARWLAER-HRAVGLDQRGHGRSEKP-ADGPYTRDAY 103

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDW 143
            +DA + +E LG+  V V+G++MGA     +    P  VR+V++  +  S L  +   +W
Sbjct: 104 VSDAEAAIEQLGLGPVTVVGHAMGALTGWQLAAKRPDLVRAVVICDMRASALGAASQREW 163

Query: 144 QSLIDSFLLP-----------SIDE--VQNPLGKKFRKFADL--DPGNDLKALASCLSMI 188
               DS+ LP             D+  V+ P   +   +A++  +  +  + + S   M+
Sbjct: 164 SDWFDSWPLPFATLADVRKWFGEDDPWVERPSPARGEFYAEVMAESEDGWRPVFSRRQML 223

Query: 189 RKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLLA 241
           R           ++L ++  P L+  G   +L     QE++  +P  QY  +    HL+ 
Sbjct: 224 RSRATWVFDAHWEELAQVQCPALVLRGLDGELGRAEAQEMVRVLPRGQYAEVADAGHLVH 283

Query: 242 VGDKQFKQGVVNFYANEL 259
               +  +  V  +  +L
Sbjct: 284 YDQPEGWRAAVEPFLEQL 301


>gi|255561848|ref|XP_002521933.1| carboxylesterase np, putative [Ricinus communis]
 gi|223538858|gb|EEF40457.1| carboxylesterase np, putative [Ricinus communis]
          Length = 400

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 46/75 (61%)

Query: 54  DQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIAC 113
           D G +V AFDN G G+S     ++ Y    MA DA++LL+HLG +K HV G+SMGA IAC
Sbjct: 80  DCGIQVCAFDNRGMGRSSVPTKKSQYTTKIMAKDAIALLDHLGWTKAHVFGHSMGAMIAC 139

Query: 114 SMVLFYPSYVRSVIL 128
            +    P  V S+ L
Sbjct: 140 KLAAMVPDRVLSLAL 154


>gi|239943383|ref|ZP_04695320.1| putative hydrolase [Streptomyces roseosporus NRRL 15998]
 gi|239989836|ref|ZP_04710500.1| putative hydrolase [Streptomyces roseosporus NRRL 11379]
          Length = 297

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 114/258 (44%), Gaps = 28/258 (10%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           DAP +LL+HGL     ++W  +   + L ++  R +  D  GHG+S+K   +  Y     
Sbjct: 32  DAPGVLLLHGLMGRA-SHWAPTA--RWLAER-HRAVGLDQRGHGRSEKP-ADGPYTRDAY 86

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDW 143
            +DA + +E LG+  V V+G++MGA     +    P  VR+V++  +  S L  +   +W
Sbjct: 87  VSDAEAAIEQLGLGPVTVVGHAMGALTGWQLAAKRPDLVRAVVICDMRASALGAASQREW 146

Query: 144 QSLIDSFLLP-----------SIDE--VQNPLGKKFRKFADL--DPGNDLKALASCLSMI 188
               DS+ LP             D+  V+ P   +   +A++  +  +  + + S   M+
Sbjct: 147 SDWFDSWPLPFATLADVRKWFGEDDPWVERPSPARGEFYAEVMAESEDGWRPVFSRRQML 206

Query: 189 RKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLLA 241
           R           ++L ++  P L+  G   +L     QE++  +P  QY  +    HL+ 
Sbjct: 207 RSRATWVFDAHWEELAQVQCPALVLRGLDGELGRAEAQEMVRVLPRGQYAEVADAGHLVH 266

Query: 242 VGDKQFKQGVVNFYANEL 259
               +  +  V  +  +L
Sbjct: 267 YDQPEGWRAAVEPFLEQL 284


>gi|302526432|ref|ZP_07278774.1| predicted protein [Streptomyces sp. AA4]
 gi|302435327|gb|EFL07143.1| predicted protein [Streptomyces sp. AA4]
          Length = 251

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 96/209 (45%), Gaps = 11/209 (5%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
           V  FR+    + A+ ++G      ++L+HG  SS +  WL  G    L ++GFRV+  D 
Sbjct: 6   VHRFRARDGLELAYRELGQGT--PVVLLHGFTSSGEA-WLRGGLAAQLAERGFRVLLPDF 62

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
            GHG S +      Y    +  D ++ +E LG++   + GYS+GAR+A  MV+      R
Sbjct: 63  RGHGASPQPDDPGRYPPDVLVDDGLAFVEQLGLTGYALGGYSLGARVALRMVVRGARPSR 122

Query: 125 SVILG-GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALAS 183
            ++ G G+ ++    +      ++ +       E  +     +      DP        +
Sbjct: 123 MLLGGQGLAAMQRGGEGGPLHRVLSALTEGRTVEPADAQTAYWIGRLGADP-------HA 175

Query: 184 CLSMIRKPFCQDDLYRIDVPVLIAVGSQD 212
            + ++R     D+L  + +P L+AVGS+D
Sbjct: 176 LMHVLRSVVPTDNLAALGIPALVAVGSED 204


>gi|325273404|ref|ZP_08139660.1| alpha/beta hydrolase fold family protein [Pseudomonas sp. TJI-51]
 gi|324101464|gb|EGB99054.1| alpha/beta hydrolase fold family protein [Pseudomonas sp. TJI-51]
          Length = 270

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS Q +W     + +L  Q +RVI  D  GHG+SDK   ++ Y +   +AD 
Sbjct: 22  LVLLHGLGSSSQ-DWELQ--VPVL-SQHYRVILMDIRGHGRSDKP--QDGYHIATFSADL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           ++LLEHL    VH +G SMG  +     + +P ++RS+ +      +      DW   + 
Sbjct: 76  LALLEHLHTGPVHFVGLSMGGMVGFQFAVDHPQWLRSLCIVNSAPEVKRRSRSDWLWWLK 135

Query: 149 SFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
            + L    S++ V   L ++           +K A     ND +A       I     Q+
Sbjct: 136 RWGLARVLSVETVGKGLAERLFPKPEQAALRQKMAQRWARNDKRAYLKSFDAIVDWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGS-PQELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN 253
            + +I  P L+     D       Q  ++ IP+++ + +    H   +   + F Q ++ 
Sbjct: 196 RIGQIQCPTLVIAADHDYTPIQLKQRYVALIPNARLVVVDDSRHATPLDQPEVFNQTLLQ 255

Query: 254 FYA 256
           F A
Sbjct: 256 FLA 258


>gi|147904364|ref|NP_001087143.1| epoxide hydrolase 2, cytoplasmic [Xenopus laevis]
 gi|50417776|gb|AAH78066.1| Ephx2-prov protein [Xenopus laevis]
          Length = 560

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 54/102 (52%), Gaps = 3/102 (2%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P I L HG   S  + W F   I  L D GFRVIAFD  G+G S   +   +Y    +
Sbjct: 258 NGPVICLCHGFPESWYS-WRFQ--IPALADAGFRVIAFDMKGYGDSSAPHEIEEYSQEQI 314

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
             D VS L+ LGIS+   +G+  G  +  +M LFYP  VR+V
Sbjct: 315 CKDLVSFLDALGISQASFIGHDWGGAVVWNMALFYPERVRAV 356


>gi|288573255|ref|ZP_06391612.1| alpha/beta hydrolase fold protein [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288568996|gb|EFC90553.1| alpha/beta hydrolase fold protein [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 270

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 112/260 (43%), Gaps = 27/260 (10%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y V  +  P +LLI G   ++   W F     L+  + F+VIAFDN G G+S  S     
Sbjct: 17  YTVAGQGEP-LLLIMGFGGTMDF-WGFPFVSTLM--KKFKVIAFDNRGVGES--SIGTEP 70

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
             +   A+DA  LL+HLGI   HV+G+SMG  +A  + L  P  VR ++L G       +
Sbjct: 71  PSIERFASDAAGLLDHLGIESTHVLGWSMGGYVAQELTLARPELVRDLVLYGTCCDHRAA 130

Query: 139 DVVDWQSLIDSFLL--PSIDEVQNPLGKKF-RKFADLDPGNDLKALASCLSMIRK----- 190
            V   ++  D   L    +D  +  L   F R + D  PG +   L+  +++  +     
Sbjct: 131 LVSRPETFGDLMDLSETGMDRTKTTLRMLFPRPWLDFHPGFEKAFLSRPMTVYSRCAEGI 190

Query: 191 ----------PFCQDDLYRIDVPVLIAVGSQDDL--AGSPQELMSFIPSSQYLNICRRDH 238
                       C D +  I VP L+  G  D +  A   +EL+  +P   + +     H
Sbjct: 191 AGQVKAIASWKGCCDRVPSISVPTLVVAGEMDGVIPASLSRELVKALPDGSFRSFSDGGH 250

Query: 239 LLAVG-DKQFKQGVVNFYAN 257
            L     K+  + V NF + 
Sbjct: 251 GLVYQYPKELAEMVTNFLSR 270


>gi|315282631|ref|ZP_07870999.1| shchc synthase [Listeria marthii FSL S4-120]
 gi|313613723|gb|EFR87499.1| shchc synthase [Listeria marthii FSL S4-120]
          Length = 275

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 102/237 (43%), Gaps = 28/237 (11%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D P +L++HG   S +T   F   I  L  + + ++A D LGHGK+        Y +  +
Sbjct: 17  DKPVLLMLHGFTGSSET---FQNSISYL-KEWYNIVAPDLLGHGKTASPEEVARYSIQEI 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ 144
            AD   +L  L I+K  V+GYSMG R+A +    YP  VR ++L      L  +DV   +
Sbjct: 73  CADLAQMLHQLKIAKCFVLGYSMGGRVATAFAAAYPEMVRGLVLVSSSPGLRQADVRASR 132

Query: 145 SLIDSFLLPSI---------DEVQN----------PLGKKFRKFADLDPGNDLKALASCL 185
              D+ L   I         D  +N          P  +K R  ++    N    LA  L
Sbjct: 133 VQADNRLADRIEAEGITSFVDYWENLALFNSQSVLPAEQKKRIRSERLAQNP-HGLAMSL 191

Query: 186 SMI---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
             +   ++P   D L     PVL+  G+ D+      Q++   +P+S ++ +    H
Sbjct: 192 RGMGTGKQPSYWDKLAGFTFPVLLITGALDEKFEKIAQDMQQLLPNSTHVTVQEAGH 248


>gi|228929904|ref|ZP_04092919.1| hypothetical protein bthur0010_45870 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228936165|ref|ZP_04098968.1| hypothetical protein bthur0009_46060 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228948601|ref|ZP_04110880.1| hypothetical protein bthur0007_47260 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229124420|ref|ZP_04253608.1| hypothetical protein bcere0016_47040 [Bacillus cereus 95/8201]
 gi|229187118|ref|ZP_04314266.1| hypothetical protein bcere0004_46560 [Bacillus cereus BGSC 6E1]
 gi|228596359|gb|EEK54031.1| hypothetical protein bcere0004_46560 [Bacillus cereus BGSC 6E1]
 gi|228659072|gb|EEL14724.1| hypothetical protein bcere0016_47040 [Bacillus cereus 95/8201]
 gi|228811100|gb|EEM57442.1| hypothetical protein bthur0007_47260 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228823510|gb|EEM69339.1| hypothetical protein bthur0009_46060 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228829820|gb|EEM75442.1| hypothetical protein bthur0010_45870 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 240

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 81/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   D    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLEREDERKERCEKDERLADKIEREGIESFVTMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+   LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKSLAQNVQEAVRKERLANNSNGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 192


>gi|87199432|ref|YP_496689.1| alpha/beta hydrolase [Novosphingobium aromaticivorans DSM 12444]
 gi|87135113|gb|ABD25855.1| alpha/beta hydrolase [Novosphingobium aromaticivorans DSM 12444]
          Length = 251

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 24/238 (10%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
            +FF  +   Q A + +G +  P +LL HGL SS + NW+  G    L ++GF  +  D 
Sbjct: 6   TEFFPGFGGAQLALHRLG-QGRPVVLL-HGLFSSAEVNWIKFGTAARLSEEGFECLMPDL 63

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL--FYPSY 122
             HGKS   +    Y    +  D  +L+ HLG+    ++G+S+G+R +   V+    P  
Sbjct: 64  RVHGKSAAPHEPEAYPQDVLVRDLEALVAHLGLVDFDLVGFSLGSRTSARAVVAGLKP-- 121

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEV-----QNP--LGKKFRKFADLDPG 175
            R ++LGG+G       +  W    D F +  ID        +P  L ++F K   +D  
Sbjct: 122 -RRLVLGGMGL----EGLAGWARRQD-FFIDVIDRFGTIRPGDPAYLSQQFLKSMGVD-- 173

Query: 176 NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNI 233
              +  A  L          +L  I +P L+  G +DD  GS Q L   +P +  + I
Sbjct: 174 ---REAARLLLGTMADTDPAELGAISMPTLVLCGDKDDDNGSAQRLAEVLPDASLVLI 228


>gi|229112322|ref|ZP_04241861.1| hypothetical protein bcere0018_45630 [Bacillus cereus Rock1-15]
 gi|228671162|gb|EEL26467.1| hypothetical protein bcere0018_45630 [Bacillus cereus Rock1-15]
          Length = 240

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVAYYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDS-----------------DVVDWQSLIDSFLLPSIDE 157
           M   YP YV S++L    + L +                  +  D +S +  +    I E
Sbjct: 73  MACLYPDYVHSLLLENCTAGLENEADRKERREKDDRLADKIEREDIESFVSMWENIPIFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 133 TQKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEYDE 192


>gi|115334882|gb|ABI94047.1| esterase [uncultured prokaryote]
          Length = 267

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 10/114 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSDKSYI 75
           +   G  DAP +LLI GL+   +      GW+  +    + F VI FDN G GKS +S  
Sbjct: 13  YETAGSPDAPPLLLIQGLSGYTE------GWLMQVPALKEDFYVIYFDNRGAGKSTQS-- 64

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           E  Y +V MA D  +LL+ L I + +V+G SMG  IA ++ + +P  V  + LG
Sbjct: 65  EPGYMMVDMADDTAALLDTLEIPQAYVLGVSMGGMIALNLAMQHPQKVNKLALG 118


>gi|313902677|ref|ZP_07836075.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid
            synthase/2-oxoglutarate decarboxylase [Thermaerobacter
            subterraneus DSM 13965]
 gi|313466974|gb|EFR62490.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid
            synthase/2-oxoglutarate decarboxylase [Thermaerobacter
            subterraneus DSM 13965]
          Length = 1283

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 54/155 (34%), Positives = 74/155 (47%), Gaps = 17/155 (10%)

Query: 30   LLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAV 89
            LL+HG   S  T W+   W QL       ++A D LGHG+S      + YR+    AD V
Sbjct: 1034 LLLHGFTGSTAT-WV-GVWSQLAA--AGPLLAVDLLGHGRSAAPAGPDRYRMEEQVADLV 1089

Query: 90   SLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDS 149
            +LL+ LGI +VH++GYSMG R+A S+    P  V S++L      L D    + +   D 
Sbjct: 1090 ALLDRLGIGRVHLVGYSMGGRVALSLAAAAPERVASLVLESSSPGLADPAEREARRRSDE 1149

Query: 150  FLLPSIDE----------VQNPLGKKFRKFADLDP 174
             L   I+E           + PL   F    DLDP
Sbjct: 1150 ALARRIEEEGVGAFTRAWEELPL---FAGLKDLDP 1181


>gi|296117383|ref|ZP_06835973.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295976149|gb|EFG82937.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 378

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +    +D+G  DA  ++LIHG    ++ NW+ +         G RVIAFD  GHG S K 
Sbjct: 124 HTLRVHDLGTGDATPLVLIHGFGGDLK-NWMLN---HAALAHGRRVIAFDLPGHGGSSKD 179

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
                  L F A     +L+H  +S+VHVMG+S+G  IA ++    P  V S+ L
Sbjct: 180 V--GPGTLEFFADVTAQMLDHFNLSRVHVMGHSLGGGIALTLARIAPGRVASLSL 232


>gi|186686563|ref|YP_001869759.1| alpha/beta hydrolase fold protein [Nostoc punctiforme PCC 73102]
 gi|186469015|gb|ACC84816.1| alpha/beta hydrolase fold protein [Nostoc punctiforme PCC 73102]
          Length = 270

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 105/237 (44%), Gaps = 39/237 (16%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           FYD+     P +L+   L      + +    I       ++VI  DN G G+S  S  E 
Sbjct: 12  FYDIKGTGEPLLLIAGFLCDHAYWSLIMPSLIS-----QYQVIRLDNRGMGRS--SAPET 64

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GGVGSV 134
            Y L  MA D  +LL HL I KVH++G+SMG +IA  +VL +P  V+S++L      G  
Sbjct: 65  PYSLKQMANDVAALLNHLAIDKVHLVGHSMGGQIAQELVLAHPEKVQSLMLLSSLAKGDG 124

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF-- 192
           L++S +  W  L  +  L   ++V  P    F       PG  ++ L      IR PF  
Sbjct: 125 LFNSIIETWGELCANVDLKLYEKVVLPW--IFTDSFYAIPGT-IEGLIEF--AIRYPFPP 179

Query: 193 ----------------CQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQ 229
                             D L +I  P L+ VG QD L  +P    Q+L   IP+++
Sbjct: 180 ATHSLHHHSQAMLDFDTTDRLQKIHCPTLVLVGKQDIL--TPLKFSQQLAQGIPNAE 234


>gi|229130137|ref|ZP_04259098.1| hypothetical protein bcere0015_45740 [Bacillus cereus BDRD-Cer4]
 gi|228653352|gb|EEL09229.1| hypothetical protein bcere0015_45740 [Bacillus cereus BDRD-Cer4]
          Length = 240

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 84/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPENVVHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDS-----------------DVVDWQSLIDSFLLPSIDE 157
           M   YP YV S++L    + L +                  +  D +S +  +    + E
Sbjct: 73  MACLYPDYVHSLLLENCTAGLENEADRKERREKDDRLADKIEREDIESFVSMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 133 TQKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEYDE 192


>gi|33596075|ref|NP_883718.1| putative hydrolase [Bordetella parapertussis 12822]
 gi|33573078|emb|CAE36720.1| putative hydrolase [Bordetella parapertussis]
          Length = 272

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 12/191 (6%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           APT+LL+HG  ++ Q    F  W+  L  + +RV+  D  GHG SD    +    L  + 
Sbjct: 27  APTLLLLHGAMANAQR---FYSWVPGL-SRDYRVVRADLRGHGLSDVPPADKPLDLQVLT 82

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW-- 143
            D ++LL+HLG  +VH+ G S G  +   + + +   + ++ L G    L +S    W  
Sbjct: 83  EDILALLDHLGCERVHLAGNSAGGYVGQHLAMQHLQRIETLALFGSAPGLRNSQASTWLE 142

Query: 144 ---QSLIDSFLLPSIDEVQNPL---GKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDL 197
              +  +  FL  +ID+   P      +  +F D    +D+  +   +  + +    D L
Sbjct: 143 RVAEKGLRQFLADTIDDRFPPELVGTPRCEQFLDALSDHDMAYIGRFVGYMAQQEWGDQL 202

Query: 198 YRIDVPVLIAV 208
           +RI  P L+ +
Sbjct: 203 HRITCPTLVVI 213


>gi|77457656|ref|YP_347161.1| Alpha/beta hydrolase fold [Pseudomonas fluorescens Pf0-1]
 gi|77381659|gb|ABA73172.1| putative esterase [Pseudomonas fluorescens Pf0-1]
          Length = 267

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 106/244 (43%), Gaps = 21/244 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HGL SS   +W     I  L    +RVI  D  GHG+SDK      Y +   +AD 
Sbjct: 22  LLLVHGLGSST-LDWEMQ--IPALAAH-YRVIVPDVRGHGRSDKP--RERYSIAGFSADI 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDS--DVVDWQS 145
           V+L+EHL +  VH +G SMG  I     + +P  ++S+ I+     V   S  D   W  
Sbjct: 76  VALIEHLKLGPVHYVGLSMGGMIGFQFAVDHPRMLKSLTIVNSAPEVKVRSRDDYWQWFK 135

Query: 146 LIDSFLLPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
                 L S+  +   LG K           +K A+    ND +A  +    I     Q+
Sbjct: 136 RWSLMRLLSLATIGKALGAKLFPKPEQADLRQKMAERWAKNDKRAYLASFDAIVGWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLLAVGD-KQFKQGVVN 253
            L R+  P L+    +D    S +E  +  +P ++ + I    H   +   ++F Q ++ 
Sbjct: 196 RLSRVTCPTLVVSADRDYTPVSLKETYVRLLPDARLVVIADSRHATPLDQPERFNQTLLE 255

Query: 254 FYAN 257
           F A 
Sbjct: 256 FLAT 259


>gi|217964177|ref|YP_002349855.1| prolyl aminopeptidase [Listeria monocytogenes HCC23]
 gi|217333447|gb|ACK39241.1| prolyl aminopeptidase [Listeria monocytogenes HCC23]
 gi|307571256|emb|CAR84435.1| hydrolase, alpha/beta fold family [Listeria monocytogenes L99]
          Length = 275

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 106/249 (42%), Gaps = 26/249 (10%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R  Q+ F +V   + P +L++HG   + +T   F   I  L ++ F +IA D LGHG + 
Sbjct: 4   RGKQYQFTNVISGEKPFLLMLHGFTGTSRT---FQASISRLKER-FNIIAPDLLGHGNTA 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG- 130
                  Y +  +  D   +L+ L +++  V+GYSMG R+A +    YP  VR +IL   
Sbjct: 60  SPEEIAPYAMESICEDLAGILQQLNVTRCFVLGYSMGGRVATAFAATYPEMVRGLILVSS 119

Query: 131 ----------VGSVLYDSDVVD------WQSLIDSF----LLPSIDEVQNPLGKKFRKFA 170
                     V  V  D+ + D       +S +D +    L  S   + + + ++ R   
Sbjct: 120 SPGLVEVDLRVNRVQADNRLADKLEAEGIESFVDYWEDLALFASQKVLPDEVNERIRAER 179

Query: 171 DLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQ 229
                + L      +   ++P   D L     PVL+  G+ D       +E+   +P+S 
Sbjct: 180 LSQNSHGLAMSLRGMGTGKQPSYWDHLVNFTFPVLLITGALDGKFENIAREMQQLLPNST 239

Query: 230 YLNICRRDH 238
           ++ +    H
Sbjct: 240 HVIVPAAGH 248


>gi|115373806|ref|ZP_01461099.1| hydrolase, alpha/beta fold family protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|310817561|ref|YP_003949919.1| alpha/beta fold family hydrolase [Stigmatella aurantiaca DW4/3-1]
 gi|115369205|gb|EAU68147.1| hydrolase, alpha/beta fold family protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|309390633|gb|ADO68092.1| Hydrolase, alpha/beta fold family [Stigmatella aurantiaca DW4/3-1]
          Length = 342

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 105/227 (46%), Gaps = 29/227 (12%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q A+ ++  + A T++ IHGL S ++  W +   +     QG+RV+A D  G+GKSDK  
Sbjct: 66  QVAYVELNPQGARTLVFIHGLGSYLKF-WRYQ--LDAFAQQGYRVVAVDLPGYGKSDKP- 121

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG-VGS 133
               Y +  MA     +++ LG+ +  ++G+SMGA+ A S  + YP    +++L    G 
Sbjct: 122 ATFPYTMEAMADAVREVVQALGVERPLLVGHSMGAQTALSYAIRYPEEPGALVLTSPAGF 181

Query: 134 VLYDSDVVDW--QSLIDSFLLPSID-----------------EVQNPLGKKFRKFADLDP 174
             +      W  +SL  +F+  S +                 E++  + ++ R      P
Sbjct: 182 EKFSDKEKRWFRRSLTTTFIKSSPEYNIWGSVRQANFSRWRPELEWLIEERVRVVG--TP 239

Query: 175 GNDLKALASCLS---MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP 218
             D  A A+  +   +    F +D+L R+  P LI  G +D L  +P
Sbjct: 240 AFDAYAYANVRTVDGLAHNDFVRDNLGRVQAPALIVFGEEDRLIPNP 286


>gi|91217117|ref|ZP_01254079.1| 3-oxoadipate enol-lactonase [Psychroflexus torquis ATCC 700755]
 gi|91184717|gb|EAS71098.1| 3-oxoadipate enol-lactonase [Psychroflexus torquis ATCC 700755]
          Length = 264

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 65/114 (57%), Gaps = 6/114 (5%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  F D G+ +   ILL+HGL S+ + +W F   + +L  + FRVIA D  GHG S K  
Sbjct: 12  QLEFLDKGEGE--IILLLHGLGST-KADWDFQ--VDILSKK-FRVIAPDLRGHGNSSKPE 65

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             ++Y +   A D V LL+ L I K  ++G+SMG  +A  MV+ +P  +  +I+
Sbjct: 66  TRDEYGIPQCAEDIVLLLQKLKIVKCSIVGFSMGGAVAFEMVVKHPELISKLII 119


>gi|317126266|ref|YP_004100378.1| alpha/beta hydrolase [Intrasporangium calvum DSM 43043]
 gi|315590354|gb|ADU49651.1| alpha/beta hydrolase fold protein [Intrasporangium calvum DSM
           43043]
          Length = 283

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 127/289 (43%), Gaps = 43/289 (14%)

Query: 4   EVKFFRSWRKYQFA-----FYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGF 57
           E+ F  + R  + A     + + GD  +P ++L+HG      T W  F   I +L D  F
Sbjct: 2   ELTFEETSRTVRTASWTIHYNEAGDPSSPALVLLHGSGPGA-TGWSNFKSNIGVLADH-F 59

Query: 58  RVIAFDNLGHGKSDK-SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           RVIA D  G G+SD     E D+     A  A+ LL+ LGI +   +G SMG   +  +V
Sbjct: 60  RVIAPDMPGWGRSDAVGRSEMDH-----AKAAIELLDALGIDQAAFVGNSMGGITSLRLV 114

Query: 117 LFYPSYVRSVILGGVGS----VLYDSD---VVDWQSLIDSFLLPSIDEVQN--------- 160
             YP  V  +I  G GS     L+ +        ++L+ ++  PS++ +           
Sbjct: 115 TEYPERVSHLITMGPGSGPQPKLFSAAGGLSEGMKTLVAAYRDPSVESMTRLTEVMTYDS 174

Query: 161 ------PLGKKFRKFADLDP---GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQ 211
                  L  +    A  +P    N L+A A     I K F  DDL R++VP L+  G  
Sbjct: 175 ARFATPELAGERAANAQANPTHLANYLEAFAQG-GPIAKWFQLDDLTRVEVPALLIHGRD 233

Query: 212 DDLAGSPQE--LMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYAN 257
           D +        L++ IP+S+ + + R  H   V    +F + V++F  N
Sbjct: 234 DRVVHYENTLLLLAHIPNSRAVLLNRCGHWAQVEHADEFNRLVIDFVTN 282


>gi|297789490|ref|XP_002862707.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297308385|gb|EFH38965.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 393

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 46/75 (61%)

Query: 54  DQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIAC 113
           D G  V AFDN G G+S     +++Y    MA D+++LL+HLG  + H++G+SMGA IAC
Sbjct: 73  DSGIEVCAFDNRGMGRSSIPTHKSEYSTTIMANDSINLLDHLGWKRAHIIGHSMGAMIAC 132

Query: 114 SMVLFYPSYVRSVIL 128
            +    P  V S+ L
Sbjct: 133 KLAAMVPERVLSLAL 147


>gi|110740736|dbj|BAE98467.1| hypothetical protein [Arabidopsis thaliana]
          Length = 396

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V AFDN G G+S     +++Y    MA D++SLL+HLG  K H++G+SMGA IAC +
Sbjct: 78  GIEVCAFDNRGMGRSSVPTHKSEYTTTIMANDSISLLDHLGWKKAHIIGHSMGAMIACKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  V S+ L
Sbjct: 138 AAMAPERVLSLAL 150


>gi|42573668|ref|NP_974930.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gi|79330737|ref|NP_001032065.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gi|222423531|dbj|BAH19735.1| AT5G53050 [Arabidopsis thaliana]
 gi|332008913|gb|AED96296.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gi|332008914|gb|AED96297.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
          Length = 396

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V AFDN G G+S     +++Y    MA D++SLL+HLG  K H++G+SMGA IAC +
Sbjct: 78  GIEVCAFDNRGMGRSSVPTHKSEYTTTIMANDSISLLDHLGWKKAHIIGHSMGAMIACKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  V S+ L
Sbjct: 138 AAMAPERVLSLAL 150


>gi|33593128|ref|NP_880772.1| putative hydrolase [Bordetella pertussis Tohama I]
 gi|33563503|emb|CAE42392.1| putative hydrolase [Bordetella pertussis Tohama I]
          Length = 273

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 89/192 (46%), Gaps = 13/192 (6%)

Query: 26  APTILLI-HGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           APT+LL+ HG  ++ Q    F  W+  L  + +RV+  D  GHG SD    +    L  +
Sbjct: 27  APTLLLLLHGAMANAQR---FYSWVPGL-SRDYRVVRADLRGHGLSDVPPADKPLDLQVL 82

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW- 143
             D ++LL+HLG  +VH+ G S G  +   + + +P  + ++ L G    L +S    W 
Sbjct: 83  TEDILALLDHLGCERVHLAGNSAGGYVGQHLAMQHPQRIETLALFGSAPGLRNSQASTWL 142

Query: 144 ----QSLIDSFLLPSIDEVQNPL---GKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD 196
               +  +  FL  +ID+   P      +  +F D    +D+  +   +  + +    D 
Sbjct: 143 ERVAEKGLRQFLADTIDDRFPPELVGTPRCEQFLDALSDHDMAYIGRFVGYMAQQEWGDQ 202

Query: 197 LYRIDVPVLIAV 208
           L+RI  P L+ +
Sbjct: 203 LHRITCPTLVVI 214


>gi|103487703|ref|YP_617264.1| alpha/beta hydrolase fold [Sphingopyxis alaskensis RB2256]
 gi|98977780|gb|ABF53931.1| alpha/beta hydrolase fold [Sphingopyxis alaskensis RB2256]
          Length = 301

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 64/130 (49%), Gaps = 21/130 (16%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS---DK 72
             + D G KDAP ILL+ GL   + T W    ++  L D+GFR I +DN   G S   D 
Sbjct: 13  ITYEDRGPKDAPAILLVMGLGGQL-TLWPDE-FVAALNDRGFRTIRYDNRDVGLSTRFDA 70

Query: 73  SYIEN----------------DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           + + N                 Y L  MAAD + LL+HLGI + H++G SMG  I+  + 
Sbjct: 71  AGVPNLKWMFVKAAIGLPVRPAYTLADMAADGLGLLDHLGIGRAHIVGVSMGGMISQHIA 130

Query: 117 LFYPSYVRSV 126
             YP  V S+
Sbjct: 131 ARYPDRVLSL 140


>gi|258651636|ref|YP_003200792.1| alpha/beta hydrolase fold protein [Nakamurella multipartita DSM
           44233]
 gi|258554861|gb|ACV77803.1| alpha/beta hydrolase fold protein [Nakamurella multipartita DSM
           44233]
          Length = 298

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 69/134 (51%), Gaps = 11/134 (8%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIA 61
           M E   F     ++ A  DVG    P+ILL+HG+ S+ +T W    W +L  D   RV+A
Sbjct: 1   MPEQTRFLELHGHRMALTDVGS--GPSILLVHGMMSA-RTTW-ADQWDRLAADH--RVLA 54

Query: 62  FDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS 121
            D  GHG+SDK     DY L   AA    LL+ L +    V+G+S+G  IA  +   +P 
Sbjct: 55  PDLFGHGESDKPL--GDYSLGAHAASLRDLLDALDVPSATVVGHSLGGGIAMQLAYLFPE 112

Query: 122 YVRSVIL---GGVG 132
            V  ++L   GG+G
Sbjct: 113 RVDRLVLVSSGGLG 126


>gi|229147429|ref|ZP_04275778.1| hypothetical protein bcere0012_45590 [Bacillus cereus BDRD-ST24]
 gi|228636111|gb|EEK92592.1| hypothetical protein bcere0012_45590 [Bacillus cereus BDRD-ST24]
          Length = 240

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 90/182 (49%), Gaps = 25/182 (13%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVAYYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYD--------------SDVVDWQSLIDSFL-----LPSI 155
           M   YP YV S++L    + L +              +D ++ +  I+SF+     +P I
Sbjct: 73  MACLYPDYVHSLLLENCTAGLENEADRKERREKDDRLADKIERED-IESFVSMWGNIP-I 130

Query: 156 DEVQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQ 211
            E Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  
Sbjct: 131 FETQKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEY 190

Query: 212 DD 213
           D+
Sbjct: 191 DE 192


>gi|254489618|ref|ZP_05102820.1| putative hydrolase [Roseobacter sp. GAI101]
 gi|214041788|gb|EEB82429.1| putative hydrolase [Roseobacter sp. GAI101]
          Length = 224

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 100/232 (43%), Gaps = 14/232 (6%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           + LIHG   S +  W   GW   L + GF  I  D  GHG    S+   +Y    +A+DA
Sbjct: 4   VALIHGWGGSYRATWQADGWDIALRNAGFEPIGVDIPGHGPEGGSHEPAEY--ADLASDA 61

Query: 89  VSLLEHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLI 147
            + L       +H V+G+S+G ++   +    P     ++LGG+G  ++  +     +++
Sbjct: 62  AAKLP----GGLHGVIGFSLGTKLLLELEARTPGAYGRLVLGGIGDNIFAPEAAG-PAIV 116

Query: 148 DSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD-LYRIDVPVLI 206
            +    + D    P  K    +A     +D   LA+ L     P   D+ L    VP+LI
Sbjct: 117 AALRGEAAD--APPQVKALLAYAAKS-KSDPACLAAVLERPANPVLSDERLGHARVPILI 173

Query: 207 AVGSQDDLAGSP-QELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYAN 257
              S+DD    P   L + +P + +  I    H+    D +F+   + F AN
Sbjct: 174 -FNSRDDAVAQPDHRLRAALPHAAHQLIDGPSHVALTSDARFRDAAIAFLAN 224


>gi|229048568|ref|ZP_04194128.1| hypothetical protein bcere0027_45290 [Bacillus cereus AH676]
 gi|228722770|gb|EEL74155.1| hypothetical protein bcere0027_45290 [Bacillus cereus AH676]
          Length = 240

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 84/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPENVVHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDS-----------------DVVDWQSLIDSFLLPSIDE 157
           M   YP YV S++L    + L +                  +  D +S +  +    + E
Sbjct: 73  MACLYPDYVHSLLLENCTAGLENEADRKERREKDDRLADKIEREDIESFVSMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 133 TQKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEYDE 192


>gi|26991224|ref|NP_746649.1| alpha/beta fold family hydrolase [Pseudomonas putida KT2440]
 gi|24986275|gb|AAN70113.1|AE016651_3 hydrolase, alpha/beta fold family [Pseudomonas putida KT2440]
          Length = 270

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 107/243 (44%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS Q +W        L  + +RVI  D  GHG+SDK    + Y++   +AD 
Sbjct: 22  LVLLHGLGSSCQ-DWELQ---VPLFSRHYRVILMDIRGHGRSDKP--ADGYQIATFSADL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           ++LLEHL    VH +G SMG  +     + +P ++RS+ +      +      DW   + 
Sbjct: 76  LALLEHLHTGPVHFVGLSMGGMVGFQFAVDHPQWLRSLCIVNSAPEVKRRTRSDWAWWLK 135

Query: 149 SFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
            + L    S++ V   L ++           +K A     ND +A       I     Q+
Sbjct: 136 RWSLARILSVETVGKGLAERLFPKPQQADLRQKMAQRWARNDKRAYLKSFDAIVDWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQE-LMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN 253
            + +I  P L+     D      +E  ++ IP+++ + +    H   +   + F Q ++ 
Sbjct: 196 RIGQIHCPTLVIAADHDYTPIQLKERYVALIPNARLVVVDDSRHATPLDQPEVFNQTLLQ 255

Query: 254 FYA 256
           F A
Sbjct: 256 FLA 258


>gi|8809594|dbj|BAA97145.1| unnamed protein product [Arabidopsis thaliana]
          Length = 438

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V AFDN G G+S     +++Y    MA D++SLL+HLG  K H++G+SMGA IAC +
Sbjct: 78  GIEVCAFDNRGMGRSSVPTHKSEYTTTIMANDSISLLDHLGWKKAHIIGHSMGAMIACKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  V S+ L
Sbjct: 138 AAMAPERVLSLAL 150


>gi|319951630|ref|YP_004162897.1| alpha/beta hydrolase fold protein [Cellulophaga algicola DSM 14237]
 gi|319420290|gb|ADV47399.1| alpha/beta hydrolase fold protein [Cellulophaga algicola DSM 14237]
          Length = 261

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 120/257 (46%), Gaps = 20/257 (7%)

Query: 4   EVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           +V+FF S+   + A+ D G  +A  ++L+HG  +S  ++W ++   + L  +G+RVI  D
Sbjct: 19  QVEFFTSFDGVKIAYTDEGKGNA--VILVHGFITS-GSSWDYTVLKKGLLQKGYRVIIPD 75

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
             G G SDK      Y+      D   L  +L I K  V+GYS G+ I  +  L     +
Sbjct: 76  LRGSGLSDKPNEAKFYQNNAEIKDLQGLASYLNIKKFDVVGYSRGS-IVTAKWLTCDKRI 134

Query: 124 RSVILGGVGSVLYDSDVVDWQSLI---DSFLLPSI--DEVQNPLGKKFRKFADLDPGNDL 178
           +  +LGG+G    D    +W   I   ++F   ++  +EV+  +      +A     N  
Sbjct: 135 KKAVLGGMG---LDFTNREWGRRILFANAFAEGAVLTEEVKGAVA-----YAKSIHAN-F 185

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDH 238
           KAL   L + +      +L  I   VLI  G +D   G+P EL   IP S++  I +  H
Sbjct: 186 KAL-HYLQVYQPVTTVAELKEIKTKVLIIAGDKDLENGNPSELHEVIPRSKFA-IIKGVH 243

Query: 239 LLAVGDKQFKQGVVNFY 255
             A     F + +++F+
Sbjct: 244 NEAYKTASFSKEIISFF 260


>gi|229093973|ref|ZP_04225064.1| hypothetical protein bcere0021_46930 [Bacillus cereus Rock3-42]
 gi|228689455|gb|EEL43269.1| hypothetical protein bcere0021_46930 [Bacillus cereus Rock3-42]
          Length = 240

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 81/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I + H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIERAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YVRS++L    + L   D    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVRSLLLENCTAGLEREDERKERCEKDERLADKIEREGIESFVTMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+   LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 TQKSLAQNVQEAVRKERLANNSNGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDE 192


>gi|237798851|ref|ZP_04587312.1| alpha/beta fold family hydrolase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021705|gb|EGI01762.1| alpha/beta fold family hydrolase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 262

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 88/197 (44%), Gaps = 19/197 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HGL SS + +W F   +  L    +RVI  D  GHG+SDK +    Y +  M+ D 
Sbjct: 22  VLLLHGLGSSGE-DWEFQ--VPALARH-YRVIVMDMRGHGRSDKPH--GRYSIQAMSNDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDS--DVVDWQS 145
            +L+EHL +  VH++G SMG  I   + +  P  ++S+ I+     V   S  D+  W  
Sbjct: 76  EALIEHLRLQPVHLVGLSMGGMIGFQLAVDKPHLLKSLSIVNSAPQVKIRSLADLCQWAR 135

Query: 146 LIDSFLLPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
                 L S+  +   LGK             K A+    ND +A  +    I     +D
Sbjct: 136 RWTLSRLVSMKTLGKALGKLLFPRPEQAELRHKMAERWSRNDKRAYLASFDAIVGWGVED 195

Query: 196 DLYRIDVPVLIAVGSQD 212
            L RI  P LI     D
Sbjct: 196 RLQRITCPTLIVAAGHD 212


>gi|328886826|emb|CCA60065.1| Alpha or beta hydrolase [Streptomyces venezuelae ATCC 10712]
          Length = 311

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 65/124 (52%), Gaps = 16/124 (12%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD------ 71
           F D GDKD P +LLI GL   + T W  S ++  L  +GFRV+A DN   G+S       
Sbjct: 24  FRDHGDKDDPAMLLIAGLGEDL-TFWTDS-FVDSLVARGFRVVAIDNRDVGQSTFVAAPP 81

Query: 72  -------KSYIEND-YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
                   +    D Y L  MA DAV +L+HLGI++VH++G SMG  IA ++    P   
Sbjct: 82  PGTWRQIAARPRGDAYALADMAQDAVGVLDHLGIARVHLVGRSMGGMIAQTIAATEPERA 141

Query: 124 RSVI 127
            S+ 
Sbjct: 142 LSLT 145


>gi|42568501|ref|NP_200117.2| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gi|332008912|gb|AED96295.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
          Length = 312

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V AFDN G G+S     +++Y    MA D++SLL+HLG  K H++G+SMGA IAC +
Sbjct: 78  GIEVCAFDNRGMGRSSVPTHKSEYTTTIMANDSISLLDHLGWKKAHIIGHSMGAMIACKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  V S+ L
Sbjct: 138 AAMAPERVLSLAL 150


>gi|325673902|ref|ZP_08153592.1| alpha/beta hydrolase [Rhodococcus equi ATCC 33707]
 gi|325555167|gb|EGD24839.1| alpha/beta hydrolase [Rhodococcus equi ATCC 33707]
          Length = 238

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 106/237 (44%), Gaps = 33/237 (13%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HG + ++     F+  + +  ++ +RV+A D   HG+S +   E       ++ D 
Sbjct: 22  LVLLHGNSENL---GYFAAQVPVFAER-YRVLALDTRAHGESTRG--EGPLDFARLSDDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
            ++L+ LGI   H++GYS G   A ++ L  P  VRS+I+ G          +D   L  
Sbjct: 76  EAVLDALGIGSAHILGYSDGGNTALTLALRDPRRVRSLIVNGAN--------LDPHGLGA 127

Query: 149 SFLLPSI-----DEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ-DDLYRIDV 202
            F +P+           PL  K R+  +L              M+R P    D L  I V
Sbjct: 128 RFRIPATLAWLAAGAIAPLSAKVRRHREL-----------LELMVRHPHIPVDALSTIGV 176

Query: 203 PVLIAVGSQDDLAGSPQELMS-FIPSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYAN 257
           P L+ VG +D +     EL++  IP ++ + +    H  A    + F   V++F A+
Sbjct: 177 PTLVIVGERDAIPRRHTELIARSIPDAELMYVPDAGHACAEQRPEVFNAAVLDFLAH 233


>gi|148555578|ref|YP_001263160.1| alpha/beta hydrolase fold protein [Sphingomonas wittichii RW1]
 gi|148500768|gb|ABQ69022.1| alpha/beta hydrolase fold [Sphingomonas wittichii RW1]
          Length = 257

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 115/250 (46%), Gaps = 21/250 (8%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A++ +G +D   ++LIHGL S+  TNW+  G    L  +G RVI  D   HG S K +
Sbjct: 20  RMAWHGMGPEDGRPVILIHGLFSNAFTNWVRYGHAAKLAAKGRRVIMPDLRAHGDSAKPH 79

Query: 75  IENDYRLVFMAADAVSLLEHLGISK--VHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
             + Y    +A D ++L+E LG++     + GYS+G R    M+      VR    G   
Sbjct: 80  DPSGYSEDILADDNLALIEQLGLAPGGYDLGGYSLGGRTTARML------VRGAKPGKAL 133

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEV-QNP------LGKKFRKFADLDPGNDLKALASCL 185
                 + +       +F    ++ V  +P      + + F K      G D +AL   L
Sbjct: 134 LAGMGLEGLLDLGGRVAFFRKVLEGVGTHPKFSPEWMAEGFLKTT----GGDARALLLLL 189

Query: 186 SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDK 245
               K   +  L  + +P+L+  GS+D+  GS + L + +P++ ++ +   +H+ AV   
Sbjct: 190 DNFPK-IARASLADLAMPILVLTGSEDNDNGSARALAAALPNAGFVEVP-GNHMSAVTLP 247

Query: 246 QFKQGVVNFY 255
           Q    + +++
Sbjct: 248 QLGDAIADWF 257


>gi|224499255|ref|ZP_03667604.1| hypothetical protein LmonF1_06002 [Listeria monocytogenes Finland
           1988]
 gi|284802066|ref|YP_003413931.1| hypothetical protein LM5578_1821 [Listeria monocytogenes 08-5578]
 gi|284995208|ref|YP_003416976.1| hypothetical protein LM5923_1773 [Listeria monocytogenes 08-5923]
 gi|284057628|gb|ADB68569.1| hypothetical protein LM5578_1821 [Listeria monocytogenes 08-5578]
 gi|284060675|gb|ADB71614.1| hypothetical protein LM5923_1773 [Listeria monocytogenes 08-5923]
          Length = 275

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 100/238 (42%), Gaps = 30/238 (12%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P +L++HG   + +T   F   I  L +  F +IA D LGHG +      + Y +  +
Sbjct: 17  EKPALLMLHGFTGTSET---FQDSISGLKEH-FNIIAPDLLGHGNTAIPEEISSYTMENI 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV---- 140
             D   +L  L IS+  V+GYSMG R+A +    +P  VR +IL      L   D+    
Sbjct: 73  CEDIAGILHQLNISRCFVLGYSMGGRVATAFAATFPKRVRGLILVSSSPGLEQEDIRASR 132

Query: 141 -------VDWQSLIDSFLLPSIDEVQN------------PLGKKFRKFADLDPGNDLKAL 181
                   DW  + +  L+P +D  +N             + ++ R        + L   
Sbjct: 133 VEADNRLADW--IEEEGLVPFVDYWENLALFASQKVLSPEMKRRIRSERLSQNSHGLAMS 190

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
              +   ++P   + L     PVL+  G+ D+      QE+   +P+S +++I    H
Sbjct: 191 LRGMGTGKQPSYWNCLANFTFPVLLITGALDEKFEKIAQEMHQLLPNSTHVSIQEAGH 248


>gi|228961128|ref|ZP_04122754.1| hypothetical protein bthur0005_45790 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228798571|gb|EEM45558.1| hypothetical protein bthur0005_45790 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 240

 Score = 69.3 bits (168), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 89/179 (49%), Gaps = 25/179 (13%)

Query: 58  RVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
           +VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +M  
Sbjct: 16  QVIVVDLVGHGKTESPEDVAHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAITMAC 75

Query: 118 FYPSYVRSVILGGVGSVLYD--------------SDVVDWQSLIDSFL-----LPSIDEV 158
            YP+YV S++L    + L +              +D ++ +  I+SF+     +P + E 
Sbjct: 76  LYPNYVHSLLLENCTAGLENEADRKERREKDDRLADKIEREG-IESFVSMWENIP-LFET 133

Query: 159 QNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           Q  L K  ++    +   N+ K LA+ L  +    +P   D+L  + +PVL+  G  D+
Sbjct: 134 QKRLAKNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWDELKNLKIPVLLMNGEHDE 192


>gi|229543436|ref|ZP_04432496.1| alpha/beta hydrolase fold protein [Bacillus coagulans 36D1]
 gi|229327856|gb|EEN93531.1| alpha/beta hydrolase fold protein [Bacillus coagulans 36D1]
          Length = 267

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 114/265 (43%), Gaps = 45/265 (16%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D   +LL+HG   +  T   +   + LL D+ FR I  D +GHGK++K    + Y +   
Sbjct: 15  DGEPLLLLHGFTGNGNT---WDDTVALLRDE-FRCIVVDIIGHGKTEKPDDSDRYDITKA 70

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL--------- 135
           AAD  ++L  LGI +  ++GYSMG R+A +  + YP  V  ++L      L         
Sbjct: 71  AADLRAVLLALGIRRASILGYSMGGRLALTFAVQYPQMVDKLVLESASPGLKTEAERLAR 130

Query: 136 ---------------YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180
                           ++ V  W++L    L  S  ++   +  K RK   L+  ND   
Sbjct: 131 RERDEQLAERILTGGMEAFVSHWENLP---LFASQKQLPAEVRGKIRK-QRLE--NDPAG 184

Query: 181 LASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQD----DLAGSPQELMSFIPSSQYLNI 233
           LA+ L  +    +P     L  +  PVL+A G  D     +AG   E+   +P ++ +  
Sbjct: 185 LANSLRGMGTGAQPSWWGRLSELHFPVLLAAGEWDAKFCRIAG---EMEERLPHAKKIIF 241

Query: 234 CRRDHLLAVGD-KQFKQGVVNFYAN 257
               H + V D K+F   V  F  N
Sbjct: 242 SHAGHAIHVEDPKKFGTMVKGFLKN 266


>gi|16080133|ref|NP_390959.1| esterase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221311021|ref|ZP_03592868.1| hypothetical protein Bsubs1_16761 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315347|ref|ZP_03597152.1| hypothetical protein BsubsN3_16672 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320264|ref|ZP_03601558.1| hypothetical protein BsubsJ_16593 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324547|ref|ZP_03605841.1| hypothetical protein BsubsS_16737 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|20141879|sp|P23974|YTXM_BACSU RecName: Full=Putative esterase ytxM
 gi|2293147|gb|AAC00225.1| YtxM [Bacillus subtilis]
 gi|2635565|emb|CAB15059.1| putative esterase [Bacillus subtilis subsp. subtilis str. 168]
          Length = 274

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 112/251 (44%), Gaps = 29/251 (11%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           ++A  D G   +  ++ +HG   S Q+ W F    ++L D   R+I  D LGHG++D   
Sbjct: 13  RYAVADEGPNASEAVVCLHGFTGSKQS-WTFLD--EMLPDS--RLIKIDCLGHGETDAPL 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG-- 132
               Y      +D   + + L + KV ++GYSMG R+A S  + YP  V +++L      
Sbjct: 68  NGKRYSTTRQVSDLAEIFDQLKLHKVKLIGYSMGGRLAYSFAMTYPERVSALVLESTTPG 127

Query: 133 ---------SVLYDSDVVDW--QSLIDSFL-----LPSIDEVQNPLGKKFR-KFADLDPG 175
                     ++ D  + D+  +  +++F+     +P     Q  L +  R +       
Sbjct: 128 LKTLGERRERIMRDRKLADFILRDGLEAFVAYWENIPLFSS-QQRLAEDIRYRIRSGRLR 186

Query: 176 NDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYL 231
           N+   LA+ L+ +    +P     +  IDVPVL+  G  D+      QE+   +PSS+  
Sbjct: 187 NNKIGLANSLTGMGTGSQPSLWSRVEEIDVPVLLICGEWDEKFCAINQEVHKMLPSSRIE 246

Query: 232 NICRRDHLLAV 242
            + +  H + V
Sbjct: 247 IVPKAGHTVHV 257


>gi|297796137|ref|XP_002865953.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297311788|gb|EFH42212.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 396

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V AFDN G G+S     +++Y    MA D++SLL+HLG  + H++G+SMGA IAC +
Sbjct: 78  GIEVCAFDNRGMGRSSVPTHKSEYTTTIMANDSISLLDHLGWKRAHIIGHSMGAMIACKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  V S+ L
Sbjct: 138 AAMVPERVLSLAL 150


>gi|229087385|ref|ZP_04219525.1| hypothetical protein bcere0022_39540 [Bacillus cereus Rock3-44]
 gi|228695953|gb|EEL48798.1| hypothetical protein bcere0022_39540 [Bacillus cereus Rock3-44]
          Length = 257

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 105/242 (43%), Gaps = 30/242 (12%)

Query: 29  ILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           +LL+HG   S++T W      W      + F+VI  D +GHGK++       Y +  +A 
Sbjct: 8   LLLLHGFTGSMET-WRPFIPSW-----SKQFQVIIVDLVGHGKTESPEELTHYDIQNVAL 61

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSL 146
              +LL+ L I K H++GYSMG R+A +M   YP  V+S++L    + L        + +
Sbjct: 62  QMTALLDLLHIEKAHILGYSMGGRLAITMACLYPGRVQSLLLENCTAGLEMESDRQERCM 121

Query: 147 IDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKALASCLSMI 188
            D  L   I+                   Q  L +  ++    +   ND + LA+ L  +
Sbjct: 122 KDGQLAERIELEGIEAFVNMWEHIPLFTTQKNLREDVKEAVRKERLANDPRGLANSLRGM 181

Query: 189 ---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDHLLAVGD 244
               +P   + L ++ +PVL+  G  D       + +   IP ++++ I    H + V  
Sbjct: 182 GTGAQPSWWNQLEKLKMPVLLMNGEHDQKFFHILKNIQKRIPHAKFVKIDGAGHAIHVEQ 241

Query: 245 KQ 246
            Q
Sbjct: 242 PQ 243


>gi|291485520|dbj|BAI86595.1| hypothetical protein BSNT_04483 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 274

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 113/252 (44%), Gaps = 31/252 (12%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           ++A  D G   +  ++ +HG   S Q+ W F    ++L D   R+I  D LGHG++D   
Sbjct: 13  RYAVADEGPNASEAVVCLHGFTGSKQS-WTFLD--EMLSDS--RLIKIDCLGHGETDAPL 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG-- 132
               Y      +D   +L  L + KV ++GYSMG R+A S  + YP  V +++L      
Sbjct: 68  NGKRYSTSRQVSDLAEILNQLKLHKVKLIGYSMGGRLAYSFAMTYPERVSALVLESTTPG 127

Query: 133 ---------SVLYDSDVVDWQSLIDSFLLPSIDEVQN-PLGKKFRKFAD-----LDPG-- 175
                     ++ D  + D+  ++   L   +   +N PL    ++ A+     +  G  
Sbjct: 128 LKTLGERRERIMRDRKLADF--ILRDGLKAFVAYWENIPLFSSQQRLAEDIRHRIRSGRL 185

Query: 176 -NDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQY 230
            N+   LA+ L+ +    +P     +  IDVPVL+  G  D+      QE+   +PSS+ 
Sbjct: 186 RNNKIGLANSLTGMGTGSQPSFWSRVEEIDVPVLLICGEWDEKFCAINQEVHKMLPSSRI 245

Query: 231 LNICRRDHLLAV 242
             + +  H + V
Sbjct: 246 EIVPKAGHTVHV 257


>gi|297528964|ref|YP_003670239.1| alpha/beta hydrolase [Geobacillus sp. C56-T3]
 gi|297252216|gb|ADI25662.1| alpha/beta hydrolase fold protein [Geobacillus sp. C56-T3]
          Length = 270

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 59/106 (55%), Gaps = 9/106 (8%)

Query: 25  DAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           +   +LL+HG   S  T W  L   W        FRV+A D LGHG+++       YR+ 
Sbjct: 17  EGEPLLLLHGFTGSADT-WRPLAPFWPD------FRVMAVDLLGHGRTEAPKDARRYRIE 69

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
              AD  +LL+  G+ +V+V+GYSMG R+A +  +++P  VR ++L
Sbjct: 70  HAVADLAALLDEWGVEQVNVLGYSMGGRLALAFAVWHPHRVRRLVL 115


>gi|254515408|ref|ZP_05127469.1| hypothetical protein NOR53_1496 [gamma proteobacterium NOR5-3]
 gi|219677651|gb|EED34016.1| hypothetical protein NOR53_1496 [gamma proteobacterium NOR5-3]
          Length = 314

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 64/111 (57%), Gaps = 9/111 (8%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS--DKSYIEN 77
           + GD DAP ++++HG  +S+ T   + GW   L D  FRVI FD  G G S  D +   +
Sbjct: 56  EAGDTDAPAVIMLHGFGASLHT---WDGWAAEL-DDAFRVIRFDLPGSGLSYPDPTGDYS 111

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D R V + A   +L++ LG+++  ++G S+G RIA  M   YP  V +++L
Sbjct: 112 DERAVQLLA---ALMDELGLARAALVGNSIGGRIAWRMAAMYPQRVSALVL 159


>gi|16803714|ref|NP_465199.1| hypothetical protein lmo1674 [Listeria monocytogenes EGD-e]
 gi|224503660|ref|ZP_03671967.1| hypothetical protein LmonFR_14340 [Listeria monocytogenes FSL
           R2-561]
 gi|16411110|emb|CAC99752.1| lmo1674 [Listeria monocytogenes EGD-e]
          Length = 275

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 100/238 (42%), Gaps = 30/238 (12%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P +L++HG   + +T   F   I  L  + F +IA D LGHG +      + Y +  +
Sbjct: 17  EKPALLMLHGFTGTSET---FQDSISGL-KKRFNIIAPDLLGHGNTASPEEISSYTMENI 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV---- 140
             D   +L  L +S+  V+GYSMG R+A +    +P  VR +IL      L   D+    
Sbjct: 73  CEDLAGILHQLNVSRCFVLGYSMGGRVATAFAATFPKRVRGLILVSSSPGLEQEDIRASR 132

Query: 141 -------VDWQSLIDSFLLPSIDEVQN------------PLGKKFRKFADLDPGNDLKAL 181
                   DW  + +  L+P +D  +N             + ++ R        + L   
Sbjct: 133 VEADNRLADW--IEEEGLVPFVDYWENLALFASQKVLSPEMKRRIRSERLSQNSHGLAMS 190

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
              +   ++P   + L     PVL+  G+ D+      QE+   +P+S +++I    H
Sbjct: 191 LRGMGTGKQPSYWNCLANFTFPVLLITGALDEKFEKIAQEMHQLLPNSTHVSIQEAGH 248


>gi|239981514|ref|ZP_04704038.1| hydrolase [Streptomyces albus J1074]
          Length = 290

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 102/243 (41%), Gaps = 38/243 (15%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           AP +LL+HGL     ++W  +   + L ++  R +A D  GHG+S K   +  Y      
Sbjct: 36  APGVLLLHGLMGRA-SHWAAT--ARWLAER-HRAVALDQRGHGRSAKP-TDAPYTRETYV 90

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQ 144
           ADAV+ +E LG+    ++G++MGA  A  +    P  VR +++  +  S L  +   +W+
Sbjct: 91  ADAVAAIEQLGLGPAVLVGHAMGALTAWQLAAARPDLVRGLVICDMRASALGAASQREWE 150

Query: 145 SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA--------------------SC 184
              D++  P        LG   + F + DP  +  + A                    S 
Sbjct: 151 QWFDAWPTPFAT-----LGDVRKWFGEDDPWAERPSAARGEFYAEVMTEHEDGWRPVFSP 205

Query: 185 LSMIRKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRD 237
             M+R           D+L ++  P L+  G    L     QE++  +P  QY  +    
Sbjct: 206 AQMLRTRETWVHDAHWDELAQVTCPTLVVRGLDGALGRAEAQEMVRVLPQGQYAEVTDAG 265

Query: 238 HLL 240
           HL+
Sbjct: 266 HLV 268


>gi|91780031|ref|YP_555239.1| putative alpha/beta hydrolase [Burkholderia xenovorans LB400]
 gi|91692691|gb|ABE35889.1| putative alpha/beta hydrolase [Burkholderia xenovorans LB400]
          Length = 276

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 79/147 (53%), Gaps = 9/147 (6%)

Query: 2   MNEVKFFRSW-RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           MNE+K   +  R    ++ ++GD    T+LL+HG+ S   +NWL +  +  L  +G+RVI
Sbjct: 1   MNEIKRLETTVRGQTISYLELGDGPR-TLLLLHGITSDA-SNWLST--MPALAQRGWRVI 56

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVS-LLEHLGISKVHVMGYSMGARIACSMVLFY 119
           A D LG G+S K  +    R +   +D V+ LL+ LG+  V ++G SMG  +A      Y
Sbjct: 57  APDQLGFGQSSKPSVPVRPRTL---SDMVAPLLDALGLEMVSIVGQSMGGHVAGLFAAQY 113

Query: 120 PSYVRSVILGGVGSVLYDSDVVDWQSL 146
           P  V +++L   G  L   +V D + L
Sbjct: 114 PERVEALVLVNAGYGLALPEVKDPRDL 140


>gi|291453366|ref|ZP_06592756.1| hydrolase [Streptomyces albus J1074]
 gi|291356315|gb|EFE83217.1| hydrolase [Streptomyces albus J1074]
          Length = 309

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 102/243 (41%), Gaps = 38/243 (15%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           AP +LL+HGL     ++W  +   + L ++  R +A D  GHG+S K   +  Y      
Sbjct: 55  APGVLLLHGLMGRA-SHWAAT--ARWLAER-HRAVALDQRGHGRSAKP-TDAPYTRETYV 109

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQ 144
           ADAV+ +E LG+    ++G++MGA  A  +    P  VR +++  +  S L  +   +W+
Sbjct: 110 ADAVAAIEQLGLGPAVLVGHAMGALTAWQLAAARPDLVRGLVICDMRASALGAASQREWE 169

Query: 145 SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALA--------------------SC 184
              D++  P        LG   + F + DP  +  + A                    S 
Sbjct: 170 QWFDAWPTPFAT-----LGDVRKWFGEDDPWAERPSAARGEFYAEVMTEHEDGWRPVFSP 224

Query: 185 LSMIRKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRD 237
             M+R           D+L ++  P L+  G    L     QE++  +P  QY  +    
Sbjct: 225 AQMLRTRETWVHDAHWDELAQVTCPTLVVRGLDGALGRAEAQEMVRVLPQGQYAEVTDAG 284

Query: 238 HLL 240
           HL+
Sbjct: 285 HLV 287


>gi|257069342|ref|YP_003155597.1| putative hydrolase or acyltransferase of alpha/beta superfamily
           [Brachybacterium faecium DSM 4810]
 gi|256560160|gb|ACU86007.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Brachybacterium faecium DSM 4810]
          Length = 262

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 103/240 (42%), Gaps = 31/240 (12%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           YDV     P ++L+HG   S +  W   G++  L  +   VI  D  GHG+S   +  + 
Sbjct: 15  YDV-SGSGPALVLLHGSVLS-RAIWRGLGYLAPLTAE-HTVIRVDLRGHGRSGTPHETSA 71

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILGGVGSVLYD 137
           Y      AD +++L+  G+ +  +MGYS+GAR+A S  L +P  V R V LGG  +  + 
Sbjct: 72  YTQEVFVADLLAVLDAEGVGRASLMGYSLGARVALSATLAHPGRVHRLVSLGGSAAAQHG 131

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLG-KKFRKFADLDPG---------------NDLKAL 181
           +        +DS   P + E     G + F     L PG                D  A+
Sbjct: 132 A--------VDSVFFPGVIEAVRRGGMEAFSSGQGLGPGVEERRARATRTAFLAADPLAI 183

Query: 182 ASCLSMIRKPFC--QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDH 238
           A+ L          ++ L    VP L   G++D       +   S +P ++++ +  RDH
Sbjct: 184 AALLEATEATGAVPEEQLAGCTVPALWMAGTEDHPRFEESRRAASAMPDAEFVPLPGRDH 243


>gi|154149697|ref|YP_001403315.1| alpha/beta hydrolase fold [Candidatus Methanoregula boonei 6A8]
 gi|153998249|gb|ABS54672.1| alpha/beta hydrolase fold [Methanoregula boonei 6A8]
          Length = 266

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 75/140 (53%), Gaps = 20/140 (14%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           ++LI+GLAS++ T      W   + D   + FRVI FD+ G G S  S     + +   +
Sbjct: 27  LVLINGLASAMDT------WNPPVLDALARHFRVIVFDHRGTGYSGAS--AESFSIPLFS 78

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-----GGVGSVLYDSDV 140
            D   L+EHLGI++ HV+G+SMG  IA  + L +P  V  ++L     GG  +V  D DV
Sbjct: 79  RDTAGLMEHLGITRAHVLGFSMGTCIAQELELAFPEKVDRLVLVSGDCGGTEAVRTDPDV 138

Query: 141 VDWQSLIDSFLLPSIDEVQN 160
             +  LID     +ID+V N
Sbjct: 139 --FARLIDRS--GTIDDVVN 154


>gi|319651963|ref|ZP_08006085.1| hypothetical protein HMPREF1013_02697 [Bacillus sp. 2_A_57_CT2]
 gi|317396362|gb|EFV77078.1| hypothetical protein HMPREF1013_02697 [Bacillus sp. 2_A_57_CT2]
          Length = 279

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 100/238 (42%), Gaps = 30/238 (12%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQL--LCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           +LL+HG   + +      GW +         + IA D +GHGKS        Y++   AA
Sbjct: 21  LLLLHGFTGNSE------GWKEFAPFWKDHSKTIALDIIGHGKSGSPPDIGQYQIEESAA 74

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSL 146
              SLLE +GI K+ V+GYSMG R+A +  + YP  VR +IL      L        + +
Sbjct: 75  VINSLLEKMGIGKIDVLGYSMGGRLALTFAVNYPEKVRKLILESATPGLRTEAERHERRI 134

Query: 147 IDSFLLPSID-----------------EVQNPLGKKFRKFADLDP-GNDLKALASCLSMI 188
            D  L   I                  + Q  L +K R         N +  LA+ L+ +
Sbjct: 135 QDKKLSEKIRQEGIKNFIDYWENIPLFQSQKSLPEKIRTRIRCQRLANSIDGLANSLNGM 194

Query: 189 R---KPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDHLLAV 242
               +P   D+L  +++PVL+  G+ D       +E+   +P+ ++       H + V
Sbjct: 195 GTGVQPSWWDELAHLEMPVLLITGNLDQKFCRIAEEMSKILPNVKWKTAEDAGHAIHV 252


>gi|225455348|ref|XP_002276809.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302143917|emb|CBI23022.3| unnamed protein product [Vitis vinifera]
          Length = 403

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (60%)

Query: 53  CDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
           C+ G  V AFDN G G+S     +++Y    MA DA++L++HLG  K H+ G+SMGA IA
Sbjct: 82  CNGGIEVCAFDNRGMGQSFVPTKKSEYTTKIMAKDAIALMDHLGWRKAHIFGHSMGAMIA 141

Query: 113 CSMVLFYPSYVRSVIL 128
           C +    P  V S+ L
Sbjct: 142 CKLAATVPDRVLSLAL 157


>gi|55742049|ref|NP_001006912.1| epoxide hydrolase 2, cytoplasmic [Xenopus (Silurana) tropicalis]
 gi|49522999|gb|AAH75370.1| epoxide hydrolase 2, cytoplasmic [Xenopus (Silurana) tropicalis]
          Length = 560

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  + ++G+   P I L HG   S  + W F   I  L D GFRVIAFD  G+G S    
Sbjct: 250 QLHYVEMGN--GPVICLCHGFPESWYS-WRFQ--IPALADAGFRVIAFDMKGYGDSSAPQ 304

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
              +Y    +  D VS L+ +GIS+   +G+  G  +  +M LFYP  VR+V
Sbjct: 305 EIEEYSQEQICKDLVSFLDVMGISQASFIGHDWGGAVVWNMALFYPERVRAV 356


>gi|226359655|ref|YP_002777433.1| hydrolase [Rhodococcus opacus B4]
 gi|226238140|dbj|BAH48488.1| putative hydrolase [Rhodococcus opacus B4]
          Length = 345

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 66/133 (49%), Gaps = 12/133 (9%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDN 64
            FR+   Y+ AF  +G+   P +LL+HG+  +  T      W +++    + + VIA D 
Sbjct: 20  MFRTIHGYRRAFRMIGE--GPALLLLHGIGDNSTT------WTEIIPHLAENYTVIAPDL 71

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
           LGHG+SDK     DY +   A     LL  LGI  V V+G+S+G  +A      YP  V 
Sbjct: 72  LGHGRSDKP--RADYSIAAYANGMRDLLSTLGIDHVTVIGHSLGGGVAMQFAYQYPQMVD 129

Query: 125 SVILGGVGSVLYD 137
            ++L   G V  D
Sbjct: 130 RLVLVSPGGVTKD 142


>gi|269928926|ref|YP_003321247.1| alpha/beta hydrolase fold protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269788283|gb|ACZ40425.1| alpha/beta hydrolase fold protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 277

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 57/117 (48%), Gaps = 8/117 (6%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D P +LL+HG   S  T      W  LL      F  +A D +GHG+SD       Y + 
Sbjct: 18  DGPPLLLLHGFTGSAAT------WEPLLPALQAHFHTVAPDLIGHGRSDVPADPARYAMD 71

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
              AD V+LL+ L I +  V+GYSMG R A  + L  P  V +++L G    + D D
Sbjct: 72  RCVADLVALLDALDIDRAAVLGYSMGGRTALHLALAAPERVSALVLEGASPGIADPD 128


>gi|229032518|ref|ZP_04188485.1| hypothetical protein bcere0028_45570 [Bacillus cereus AH1271]
 gi|228728809|gb|EEL79818.1| hypothetical protein bcere0028_45570 [Bacillus cereus AH1271]
          Length = 240

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 81/180 (45%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPKDVMHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YV S++L    + L   +    +   D  L   I+                 E
Sbjct: 73  MACLYPEYVHSLLLENCTAGLKSEEDRKERREKDERLAHKIEREGINSFVSMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   ND K LA+ L  +    +P   D+L  + VP L+  G  D+
Sbjct: 133 TQKRLAQNAQEAVRNERLANDPKGLANSLRGMGTGAQPSWWDELPNLKVPALLMNGEYDE 192


>gi|299823082|ref|ZP_07054968.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylante synthase
           [Listeria grayi DSM 20601]
 gi|299816611|gb|EFI83849.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylante synthase
           [Listeria grayi DSM 20601]
          Length = 277

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 106/257 (41%), Gaps = 34/257 (13%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + PT++ +HG   S +T   ++ W+    +  +  ++FD +GHGK+D     + Y +  +
Sbjct: 19  NKPTLVFLHGFTGSSKT---YAAWMSAWSE-AYHCLSFDMIGHGKTDSPATSSRYHMENV 74

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL--------- 135
            AD   +L+   I +V ++GYSMG R+A S    +P  V  ++L G    L         
Sbjct: 75  IADIWQILQEKAIRQVVLIGYSMGGRVAISFASRFPEMVNGLVLMGSSPGLPTAEEREQR 134

Query: 136 --YDSDVVDW--QSLIDSFL-----LPSID-------EVQNPLGKKFRKFADLDPGNDLK 179
              D  +  W   + I+ F+     LP  D       E Q  +  +  K   L   N L 
Sbjct: 135 RASDEKLAAWIKTAGIEEFVDYWQELPLFDSQKQLTVEKQKAVRSERLKQQPLGLANSLI 194

Query: 180 ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
            + +      +    + L+R   PVL+  G  D         + + +P S+   I R  H
Sbjct: 195 GMGTGA----QESYWEKLHRFTFPVLLITGEYDQKFQQIAANMHTLLPISEIAIIERAGH 250

Query: 239 LLAVGDKQFKQGVVNFY 255
              +   +  Q  +N +
Sbjct: 251 AAYLEQPEVVQWTINNW 267


>gi|307310250|ref|ZP_07589899.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
 gi|306899802|gb|EFN30427.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
          Length = 273

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 6/132 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ ++GD +   ILL+HG   S ++  L + ++      GFRV+A D  GHG SD+  
Sbjct: 24  RLAYIEMGDPNGVPILLLHGFTDSARSWSLAAPYLA----PGFRVVAADLRGHGNSDQP- 78

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E  Y +  +A D   L+  L ++  HV+G+S+G R+  ++   +P  VR ++L    + 
Sbjct: 79  -EGCYTIPELANDVRFLIVALNLAPCHVVGHSLGGRLVQALAERWPHLVRKIVLMSTSAA 137

Query: 135 LYDSDVVDWQSL 146
           L +     W+++
Sbjct: 138 LRERQGWLWENI 149


>gi|293602137|ref|ZP_06684589.1| 3-oxoadipate enol-lactonase [Achromobacter piechaudii ATCC 43553]
 gi|292819473|gb|EFF78502.1| 3-oxoadipate enol-lactonase [Achromobacter piechaudii ATCC 43553]
          Length = 259

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 115/257 (44%), Gaps = 32/257 (12%)

Query: 18  FYDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSY 74
           FY + G  DAP ++L + L +          W + + +  + FRV+ +D  GHGKS  S 
Sbjct: 12  FYVIDGPADAPVLVLSNSLGTCSDM------WARQIPELTRHFRVLRYDTRGHGKS--SI 63

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            + +Y    +A D   LL HL I + H  G SMG     ++ L +P  V  +IL    + 
Sbjct: 64  PDGEYTFAQLAGDVAELLAHLNIERAHFCGLSMGGPTGIALALSHPERVGKLILCNTAAR 123

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRK--FADLDPG------------NDLKA 180
           +  ++   W + I +    S++++   L +++    +   +PG             D   
Sbjct: 124 IGSAE--GWSTRIAAVAEQSLEKMAPTLVERWLTDGYRAAEPGLTQVLIDMLRRTPDAGY 181

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRD 237
            A+C + +R    ++ +  I  P L+ + S  DLA +P   +EL + I  ++Y+ +    
Sbjct: 182 SANC-AALRDADYREQVAAITAPTLV-ISSTHDLAATPAQGRELAAAIAGARYVELNTSH 239

Query: 238 HLLAVGDKQFKQGVVNF 254
                  + F + VV+F
Sbjct: 240 ISNWEQPEAFTRAVVDF 256


>gi|258591632|emb|CBE67933.1| Alpha/beta hydrolase fold [NC10 bacterium 'Dutch sediment']
          Length = 262

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 100/239 (41%), Gaps = 26/239 (10%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y + D + P + + H L  ++    L+    + L  + +RV+ +D  GHG++  S    
Sbjct: 11  YYTI-DGEGPVVTMSHALGCNLA---LWDEQAKALSTR-YRVLRYDTRGHGRT--SAPPE 63

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y L  MA D   LL  LG+++ H +G SMG  I     L YPS VRS+IL    S    
Sbjct: 64  PYSLEQMADDVYGLLNVLGVAQTHFVGISMGGMIGQIFALKYPSMVRSLILSSTTSRYPT 123

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKF-------RKFADLDP------GNDLKALASC 184
           +    W+  I +     ++ +  P  +++       R+   +D           +    C
Sbjct: 124 AARSAWEERIRAVEAKGMEPLVEPALERWFTAPFRERRQGVMDTVRAMIRSTPPQGYIGC 183

Query: 185 LSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRDHL 239
              I      D L  I  P L+  G  D   G+P     E+ + +PSS+   +    HL
Sbjct: 184 CYAIPTIDVTDRLGEIRCPALVIAGENDP--GTPVTMAHEICAALPSSELATLPSASHL 240


>gi|119962973|ref|YP_949151.1| hydrolase, alpha/beta fold family protein [Arthrobacter aurescens
           TC1]
 gi|119949832|gb|ABM08743.1| hydrolase, alpha/beta fold family protein [Arthrobacter aurescens
           TC1]
          Length = 242

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 105/242 (43%), Gaps = 19/242 (7%)

Query: 29  ILLIHGLASSVQTNWLFSGW--IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           +LLI G A+S+       GW     L  + +RVI FD+ G G+S K   E  Y    +A 
Sbjct: 1   MLLIAGQATSMD------GWGPTAELLSRSYRVIRFDHRGIGRSGKGDAER-YTTRLLAQ 53

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQS 145
           DAV++L+  G+   HV G+SMG RIA  + + +P  VR+++L    G    D+  +  ++
Sbjct: 54  DAVAVLDAAGVDLAHVYGHSMGGRIAQWLAIDHPQKVRTLVLAATSGGKWPDAGTLPDRA 113

Query: 146 LID-------SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLY 198
            ++       S L P   + +  +          +      A A   +  R+      L 
Sbjct: 114 ALEALTSGDMSRLEPLFFDAEWVMNNPAATHTFFNSHASAWAKARHFTASREHDAWSRLS 173

Query: 199 RIDVPVLIAVGSQDDLAGSPQELM--SFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYA 256
            I  P LI  G++D L   P  L+    IP S  + +    H L +   +  + +  F A
Sbjct: 174 EIQAPTLILHGTEDALTPLPNALLLREHIPRSVLVRVPGAGHGLHLDHPETVEWIRQFIA 233

Query: 257 NE 258
            +
Sbjct: 234 RK 235


>gi|118466290|ref|YP_883697.1| dihydrolipoyllysine-residue acetyltransferase component of
           acetoincleaving system [Mycobacterium avium 104]
 gi|254776998|ref|ZP_05218514.1| dihydrolipoyllysine-residue acetyltransferase component of
           acetoincleaving system [Mycobacterium avium subsp. avium
           ATCC 25291]
 gi|118167577|gb|ABK68474.1| dihydrolipoyllysine-residue acetyltransferase component of
           acetoincleaving system [Mycobacterium avium 104]
          Length = 289

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 73/136 (53%), Gaps = 16/136 (11%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRV 59
           M+E+KF       + AF D G+ +   +LLIHG+A S +T      W  ++    + FRV
Sbjct: 1   MSELKFL-ELHGDRVAFRDQGEGE--VLLLIHGMAGSSET------WRSVIPPLAKKFRV 51

Query: 60  IAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
           IA D LGHG+S K     DY L   A      L+ LG+S+  V+G+S+G  +A   V  +
Sbjct: 52  IAPDLLGHGESAKP--RTDYSLGAFAVWLRDFLDELGVSRATVVGHSLGGGVAMQFVYQH 109

Query: 120 PSYVRSVIL---GGVG 132
           P Y + +IL   GG+G
Sbjct: 110 PDYAQRLILISSGGLG 125


>gi|302552237|ref|ZP_07304579.1| hydrolase [Streptomyces viridochromogenes DSM 40736]
 gi|302469855|gb|EFL32948.1| hydrolase [Streptomyces viridochromogenes DSM 40736]
          Length = 336

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 104/239 (43%), Gaps = 30/239 (12%)

Query: 26  APTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           +P +LL+HGL     ++W  +  W+       +R +A D  GHG+SDK    +  R  ++
Sbjct: 82  SPGVLLLHGLMGRA-SHWACTARWLSGR----YRAVALDQRGHGRSDKPPRASFTRDAYV 136

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDW 143
             DA S LE LG+S V ++G++MGA  A  +    P  VR +I+  +  S L  +   +W
Sbjct: 137 D-DAESALEQLGLSPVVLIGHAMGALTAWQLAARRPDLVRGLIICDMRASALGAASQREW 195

Query: 144 QSLIDSFLLP--SIDEVQNPLGKKFRKFADLDPGND---LKALASCLSMIRKPFCQDDLY 198
               +S+ LP  ++ +V+   G+        +P       + +A      R  F  D + 
Sbjct: 196 AQWFESWPLPFATLADVRKWFGEDDPWVERPNPARGEFYAEVMAESPDGWRPVFDPDQML 255

Query: 199 R----------------IDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLL 240
           R                +  P L+  G   +L     QE++  +P  QY  +    HL+
Sbjct: 256 RSRETWVYDAHWEELAQVRCPALVVRGLDGELGRAEAQEMVRVLPRGQYAEVADAGHLV 314


>gi|311113877|ref|YP_003985099.1| alpha/beta hydrolase fold protein [Rothia dentocariosa ATCC 17931]
 gi|310945371|gb|ADP41665.1| alpha/beta hydrolase fold protein [Rothia dentocariosa ATCC 17931]
          Length = 311

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 118/292 (40%), Gaps = 70/292 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK------------ 69
            +K    +L +HG A+     W  +GWI+     G  V+  D   HG+            
Sbjct: 19  AEKGTTPVLFLHGFATRSDQLWGGTGWIRQYIRAGIPVLTVDLPFHGRKYLKDSNFTVHA 78

Query: 70  --------------------SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGA 109
                               S+    +N   +V  A    +LL+ L I +VH +G+S G+
Sbjct: 79  KLPVGTIEEHGIFPVVQTTVSEDGSPQNG--MVLFADTLSALLDELAIQQVHGVGFSFGS 136

Query: 110 RIACSMVLFYPSYVRSVILGGVG-------------------SVLYDSDVVD-WQSLIDS 149
           R+   + L +PS V S+ILGG+                    ++  D    + + S+I+S
Sbjct: 137 RVGWELALRHPSRVASLILGGMPLHNHLEALRSMLSASCADDAIAQDPATAEAFTSIIES 196

Query: 150 FLLPS---IDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLI 206
             L +   +D V  P G+ F   + L     +  + +       PF         VP+LI
Sbjct: 197 SPLRTDALLDFVHIPFGEFFSLPSALADSTRIPVIHAA----NPPFPYP-----HVPLLI 247

Query: 207 AVGSQDDLAGSPQELMSFI----PSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           A+GS+D +A   + L   +    P  ++L+I  RDH+ A+    F++  + F
Sbjct: 248 AIGSEDSIAADGRRLYPLLQRVHPYLKFLDIPGRDHVSALTSGVFRRNALAF 299


>gi|284928596|ref|YP_003422328.1| hypothetical protein Dshi_5003 [Dinoroseobacter shibae DFL 12]
 gi|251736501|gb|ACT10201.1| hypothetical protein Dshi_5003 [Dinoroseobacter shibae DFL 12]
          Length = 305

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           S R +   +  +GD   P ++LIHGL  ++   W F    QL   + FRV A D  GHG 
Sbjct: 5   SLRGHTIHYQQIGD--GPDVVLIHGLFCNI-AFWWFRVAPQLA--ERFRVTALDLRGHGF 59

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           S  S  +  YR V +A D V+L++HLGI K HV+G+S G  +A ++       VR + L
Sbjct: 60  SAMS--DEGYRTVDLAGDVVALMDHLGIEKAHVIGHSFGGAVALAVATIGSDKVRRLSL 116


>gi|221635666|ref|YP_002523542.1| alpha/beta hydrolase fold protein [Thermomicrobium roseum DSM 5159]
 gi|221157286|gb|ACM06404.1| alpha/beta hydrolase fold protein [Thermomicrobium roseum DSM 5159]
          Length = 278

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 97/243 (39%), Gaps = 43/243 (17%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQL---LCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           P + L+HG A S       + W  L   L  +G+RVIA D LGHG++D       Y    
Sbjct: 24  PPLALLHGFAGSS------AHWAPLAPELVARGWRVIAPDLLGHGRTDAPSAPTRYAAAE 77

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW 143
             AD  SLL  L    V ++GYSMG R+A  + L +P  + +++L      L D      
Sbjct: 78  QVADLASLLGELVSGPVRLLGYSMGGRLALHLALAHPERIAALVLESASPGLDDPAERAA 137

Query: 144 QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRK------------- 190
           +   D  L  +I++      +    FAD      L A    LS  R+             
Sbjct: 138 RQRADEELATAIEQ------RGMDWFADYWERLPLFASRQRLSAERRAALRAEWLAQRPH 191

Query: 191 --------------PFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICR 235
                         P   D L  + +PVL+  G+ D   A   Q + + IP+SQ + +  
Sbjct: 192 GLGASLRGFGTGSMPAVWDRLSELRMPVLVIAGALDTRYAALSQAMAARIPASQLVIVPA 251

Query: 236 RDH 238
             H
Sbjct: 252 AGH 254


>gi|148546592|ref|YP_001266694.1| alpha/beta hydrolase fold family protein [Pseudomonas putida F1]
 gi|148510650|gb|ABQ77510.1| alpha/beta hydrolase fold [Pseudomonas putida F1]
          Length = 270

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 105/243 (43%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS Q +W        L  + +RVI  D  GHG+SDK    + Y++   +AD 
Sbjct: 22  LVLLHGLGSSCQ-DWELQ---VPLFSRHYRVILMDIRGHGRSDKP--ADGYQIATFSADL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           ++LLEHL    VH +G SMG  +     + +P ++RS+ +      +      DW     
Sbjct: 76  LALLEHLHTGPVHFVGLSMGGMVGFQFAVDHPQWLRSLCIVNSAPEVKRRTRSDWLWWFK 135

Query: 149 SFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
            + L    S++ V   L ++           +K A     ND +A       I     Q+
Sbjct: 136 RWSLARVLSVEAVGKGLAERLFPKPQQADLRQKMAQRWARNDKRAYLKSFDAIVDWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGS-PQELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN 253
            + +I  P L+     D       Q  ++ IP+++ + +    H   +   + F Q ++ 
Sbjct: 196 RIGQIHCPTLVIAADHDYTPIQLKQRYVALIPNARLVVVDDSRHATPLDQPEVFNQTLLQ 255

Query: 254 FYA 256
           F A
Sbjct: 256 FLA 258


>gi|312962380|ref|ZP_07776871.1| hydrolase, alpha/beta fold family [Pseudomonas fluorescens WH6]
 gi|311283307|gb|EFQ61897.1| hydrolase, alpha/beta fold family [Pseudomonas fluorescens WH6]
          Length = 267

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 99/219 (45%), Gaps = 20/219 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHGL SS Q +W     + LL  + +R++  D  GHG+SDK      Y +    AD 
Sbjct: 22  LVLIHGLGSSSQ-DWELQ--VPLLA-RHYRLVVVDVRGHGRSDKP--RERYSIPGFTADL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDS--DVVDWQS 145
           ++L EHL +   HV+G SMG  IA  + +  P+ VRS+ I+     V   S  D   W  
Sbjct: 76  LALFEHLNLPAAHVVGLSMGGMIAFQLAVDEPALVRSLCIVNSAPEVKVRSADDYWQWAK 135

Query: 146 LIDSFLLPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
                 + S+  +   LG++           RK A+    ND +A  +    I      +
Sbjct: 136 RWTLARVLSLSTIGKALGERLFPKPHQADLRRKMAERWAKNDKRAYLASFDAIVGWGVLE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNI 233
            L RI  P L+     D    + +E+ +  +P ++ + I
Sbjct: 196 RLSRITCPTLVISADHDYTPVAHKEIYVKLLPDARLVVI 234


>gi|196038114|ref|ZP_03105424.1| alpha/beta hydrolase family protein [Bacillus cereus NVH0597-99]
 gi|196031384|gb|EDX69981.1| alpha/beta hydrolase family protein [Bacillus cereus NVH0597-99]
          Length = 294

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +YQ +  + GDK  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYQASVCEWGDKSNPQIICFHGLGS---TKLSFIEIAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY   ++ +  V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTSNFEKDEDYSASYLTSWIVALLEHIGKETFHIVAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           IL
Sbjct: 120 IL 121


>gi|116873108|ref|YP_849889.1| hydrolase protein [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116741986|emb|CAK21110.1| hydrolase protein [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 275

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 100/239 (41%), Gaps = 32/239 (13%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           +   +L++HG   S +T   F   I  L ++ F ++A D LGHGK+D       Y +  +
Sbjct: 17  EKAVLLMLHGFTGSNKT---FQESITHL-EEHFSIVAPDLLGHGKTDSPDEIARYSIERI 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD-- 142
             D V++L+ L I +  V+GYSMG R+A +    +P  VR +IL      L   D+ +  
Sbjct: 73  VDDLVTILQELKIMQCFVLGYSMGGRVATAFASAHPEMVRGLILVSSSPGLAQKDLQESR 132

Query: 143 ----------------------WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180
                                 W+ L    L  S + + + L K+ R        N L  
Sbjct: 133 VQADNRLADMLESEGIRSFVDYWEKLA---LFASQEVLSDELKKRIRLERLAQNPNGLAM 189

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
               +   ++P   + L     PVL+  GS D+      QE+   IP++ ++ +    H
Sbjct: 190 SLRGMGTGKQPSYWNHLADFTFPVLLMTGSLDEKFEKIAQEMQQLIPNNTHVTVQNAGH 248


>gi|312796164|ref|YP_004029086.1| 3-oxoadipate enol-lactonase [Burkholderia rhizoxinica HKI 454]
 gi|312167939|emb|CBW74942.1| 3-oxoadipate enol-lactonase (EC 3.1.1.24) [Burkholderia rhizoxinica
           HKI 454]
          Length = 263

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 105/226 (46%), Gaps = 25/226 (11%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
            DAP ++L + L + +    ++   +  L +  FRV+ +D  GHG+SD       Y +  
Sbjct: 21  TDAPWVVLSNSLGTQLA---MWDAQVPAL-NAHFRVLRYDTRGHGQSDTP--PGPYTIGR 74

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDW 143
           +A D V+LL+ LGI + H  G SMG +I  ++   +   +  ++L      +    V  W
Sbjct: 75  LADDVVALLDALGIERAHFCGLSMGGQIGIALGARHGDRLIRLVLSNTAPKIGSPPV--W 132

Query: 144 QSLIDSFLLPSIDEVQNPL-------GKKFRKFADLDP------GNDLKALASCLSMIRK 190
              I       + ++ N         G + R+ A ++P        D +  A+    +R 
Sbjct: 133 NPRIAKARGEGMADLANAAIERWFTPGFRERQAAQVEPLRAQLMATDPEGYAANCEAVRD 192

Query: 191 PFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNI 233
              +D+L RI +P L+ VG+  D+A SP++   + + I  +QYL +
Sbjct: 193 ADLRDELGRITLPTLVIVGTH-DVATSPEQGRAMAAAIWGAQYLEL 237


>gi|186680636|ref|YP_001863832.1| alpha/beta hydrolase fold protein [Nostoc punctiforme PCC 73102]
 gi|186463088|gb|ACC78889.1| alpha/beta hydrolase fold protein [Nostoc punctiforme PCC 73102]
          Length = 272

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 4/117 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           +KY+F ++  G+ + P I+ +HG   ++     F+  I+LL +  F  +  D  GHGK++
Sbjct: 4   KKYKFNYFLNGNTNKPLIIFLHGFIGNIHE---FNEAIKLLSED-FCYLTLDLPGHGKTE 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
               +  Y++  +A   ++LL+ L I K H++GYSMG R+A  + L +P     V+L
Sbjct: 60  VLGGDEYYQMESIAQAIINLLDELRIDKCHLIGYSMGGRLALYLTLHFPQRFIKVVL 116


>gi|295705757|ref|YP_003598832.1| alpha/beta fold family hydrolase [Bacillus megaterium DSM 319]
 gi|294803416|gb|ADF40482.1| hydrolase, alpha/beta fold family [Bacillus megaterium DSM 319]
          Length = 278

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 94/214 (43%), Gaps = 37/214 (17%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHG   S ++ W +   +  L + G+RVI +D  G GKS + +   DY     AAD 
Sbjct: 27  VVLIHGWPLSGRS-WEYQ--VPALVEAGYRVITYDRRGFGKSSQPWDGYDYET--FAADL 81

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPS--YVRSVILGGVGSVLYDSDVVDWQSL 146
             LLEHL ++ V ++G+SMG       V  Y +    ++V  G V   LY S+     +L
Sbjct: 82  HQLLEHLDLTNVTLVGFSMGGGEVARYVGTYGTDRVEKAVFAGAVPPFLYKSEDHPEGAL 141

Query: 147 IDSFLLPSIDEVQNPLGKKFRKFAD--------LDPGNDL------------------KA 180
            D+     I E +N +      F D        ++ GNDL                  K 
Sbjct: 142 DDA----GIQEFENGVKNDRLAFLDDFTKIFFGVEDGNDLVSEPFRLYNRDIAAAASPKG 197

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL 214
              C++   K   +DDL +  +P LI  G  D++
Sbjct: 198 TLDCIAAFSKTDFRDDLAKFTIPTLIIHGDADEI 231


>gi|226303975|ref|YP_002763933.1| hydrolase [Rhodococcus erythropolis PR4]
 gi|226183090|dbj|BAH31194.1| putative hydrolase [Rhodococcus erythropolis PR4]
          Length = 311

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 73/159 (45%), Gaps = 7/159 (4%)

Query: 15  QFAFYDVGD--KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           +F   +VGD   DAP ++L+HG A      W +   +  L +QGFRV+A D  G+G SDK
Sbjct: 26  RFHVVEVGDAEPDAPLVVLLHGFADFW---WSWRHQLTALSEQGFRVVAMDLRGYGDSDK 82

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                 Y    +A D   L+  +G  K  ++G++ G  +  +  L +P  VRS+ L    
Sbjct: 83  P--PRGYDGWTLAGDVAGLIRAMGYGKATLIGHADGGLVCWATALLHPRLVRSIALISSP 140

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFAD 171
             +     V         LLPS    Q PL  + R  AD
Sbjct: 141 HPMALKKAVVRDPYQRRALLPSFLAYQVPLRPERRLTAD 179


>gi|146300381|ref|YP_001194972.1| alpha/beta hydrolase fold [Flavobacterium johnsoniae UW101]
 gi|146154799|gb|ABQ05653.1| Peptidase family S33-like protein [Flavobacterium johnsoniae UW101]
          Length = 330

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 103/232 (44%), Gaps = 45/232 (19%)

Query: 49  IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF--MAADAVSLLEHLGISKVHVMGYS 106
           I+ L  +GFRVI  D +G GKS K    ++++  F   A +   LL+HLGI+K  ++G+S
Sbjct: 84  IKALTKEGFRVIVPDQIGFGKSSKP---DNFQYTFQQFAENTKKLLDHLGIAKTTILGHS 140

Query: 107 MGARIACSMVLFYPSYVRSVIL-GGVG----SVLYDSDVVDW---QSLIDSFLLPSIDEV 158
           MG  +A    L YP     ++L   +G     ++     VDW     L  ++      ++
Sbjct: 141 MGGMLAARFTLMYPETAEKLVLENPIGLEDWKLVVPYKPVDWWYESELKQNYEGIKKYQM 200

Query: 159 QNPLGKK----FRKFADL------DPGNDLKALASCLSMIRKPFCQDDLYR---IDVPVL 205
           +N    K    ++K+A+L      DP  +  A  S L M    F Q  LY    I  P L
Sbjct: 201 ENYYDGKWNADYQKWAELGAGWTTDPDYNKVAWNSAL-MYDMIFTQPVLYEFKNIKSPTL 259

Query: 206 IAVGSQDDLA-GSP-----------------QELMSFIPSSQYLNICRRDHL 239
           + +G++D  A G P                 ++    IP+S+ + I    HL
Sbjct: 260 LIIGTRDKTAIGKPLVSEEVRKTMGNYAELGKKTQKAIPNSKLVKIPNTGHL 311


>gi|313497670|gb|ADR59036.1| Alpha/beta hydrolase fold project [Pseudomonas putida BIRD-1]
          Length = 270

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 106/243 (43%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS Q +W     + +L    +RVI  D  GHG+SDK    + Y++   +AD 
Sbjct: 22  LVLLHGLGSSCQ-DWELQ--VPVLSGH-YRVILMDIRGHGRSDKP--ADGYQIATFSADL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           ++LLEHL    VH +G SMG  +     + +P ++RS+ +      +      DW     
Sbjct: 76  LALLEHLHTGPVHFVGLSMGGMVGFQFAVDHPQWLRSLCIVNSAPEVKRRTRSDWLWWFK 135

Query: 149 SFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
            + L    S++ V   L ++           +K A     ND +A       I     Q+
Sbjct: 136 RWSLARVLSVETVGKGLAERLFPKPQQADLRQKMAQRWARNDKRAYLKSFDAIVDWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGS-PQELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN 253
            + +I  P L+     D       Q  ++ IP+++ + +    H   +   + F Q ++ 
Sbjct: 196 RIGQIHCPTLVIAADHDYTPIQLKQRYVALIPNARLVVVDDSRHATPLDQPEVFNQTLLQ 255

Query: 254 FYA 256
           F A
Sbjct: 256 FLA 258


>gi|187476819|ref|YP_784843.1| 3-oxoadipate enol-lactone hydrolase [Bordetella avium 197N]
 gi|115421405|emb|CAJ47910.1| 3-oxoadipate enol-lactone hydrolase [Bordetella avium 197N]
          Length = 271

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 112/234 (47%), Gaps = 37/234 (15%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  DAP ++L + L ++     +++  +  L    FRV+ +D  GHG+S  S  + +Y  
Sbjct: 29  GPADAPALVLSNSLGTNAD---MWARQVPALAHH-FRVVRYDTRGHGRS--SVPDGEYCF 82

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL----GGVGSVLYD 137
             +A D V LL+HLG+++ H  G SMG     ++ L +P  +  ++L      +GS    
Sbjct: 83  EQLAGDVVELLDHLGVARAHFCGLSMGGPTGLTLALNHPERIDRLVLCNTAARIGSAQGW 142

Query: 138 SD---VVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG------------NDLKALA 182
           SD    V+ Q+L  + + P++  V+  L + +R+    +PG             D    A
Sbjct: 143 SDRIAAVEKQTL--AAMAPAV--VERWLTEGYRQR---EPGLAQVLVDMLRRTPDAGYQA 195

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNI 233
           +C + +R    +  L  I    L+ + S  DLA +P   Q L + IP ++Y+ +
Sbjct: 196 NC-AALRDADLRPRLAEIHTRTLV-IASTHDLAATPADGQYLAAHIPGARYVEL 247


>gi|262372568|ref|ZP_06065847.1| 3-oxoadipate enol-lactonase [Acinetobacter junii SH205]
 gi|262312593|gb|EEY93678.1| 3-oxoadipate enol-lactonase [Acinetobacter junii SH205]
          Length = 257

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 97/233 (41%), Gaps = 27/233 (11%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFRVIAFDNLGHGKSDKSYI 75
           +   GD +AP ++     ++S+ TN  F  W Q        F VI +D  GHG S  S  
Sbjct: 13  YQTFGDANAPALVF----SNSLGTN--FGMWQQQFNFFKDRFFVICYDTRGHGSS--STP 64

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              Y L  +  D ++LL+HL I K    G SMG     S+ + YPS    VI+    + +
Sbjct: 65  TGPYTLQQLGEDVIALLDHLKIEKAAFCGISMGGLTGQSLAIHYPSRFSHVIIANTAAKI 124

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPG------NDLKA-----LA 182
                  WQ   +      ++ +      ++    F    P       NDL A      A
Sbjct: 125 GQEQA--WQDRAELVRKQGLEPIAATAASRWFTDPFIQSHPSVVSHLCNDLSAGSALGYA 182

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA--GSPQELMSFIPSSQYLNI 233
           +C   + K   +D+L +I +PVLI  G  D +      + ++  IP +Q + I
Sbjct: 183 NCCEALAKADLRDELKQITIPVLIIAGIHDPVTTVTDAEWMLQHIPKAQLVEI 235


>gi|229494795|ref|ZP_04388551.1| hydrolase, alpha/beta fold family protein [Rhodococcus erythropolis
           SK121]
 gi|229318291|gb|EEN84156.1| hydrolase, alpha/beta fold family protein [Rhodococcus erythropolis
           SK121]
          Length = 311

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 73/159 (45%), Gaps = 7/159 (4%)

Query: 15  QFAFYDVGD--KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           +F   +VGD   DAP ++L+HG A      W +   +  L +QGFRV+A D  G+G SDK
Sbjct: 26  RFHVVEVGDAEPDAPLVVLLHGFADFW---WSWRHQLTALSEQGFRVVAMDLRGYGDSDK 82

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                 Y    +A D   L+  +G  K  ++G++ G  +  +  L +P  VRS+ L    
Sbjct: 83  P--PRGYDGWTLAGDVAGLIRAMGYGKATLIGHADGGLVCWATALLHPRLVRSIALISSP 140

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFAD 171
             +     V         LLPS    Q PL  + R  AD
Sbjct: 141 HPMALKKAVVRDPYQRRALLPSFLAYQVPLRPERRLTAD 179


>gi|226366198|ref|YP_002783981.1| hydrolase [Rhodococcus opacus B4]
 gi|226244688|dbj|BAH55036.1| putative hydrolase [Rhodococcus opacus B4]
          Length = 345

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 66/133 (49%), Gaps = 12/133 (9%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDN 64
            FR+   Y+ AF   G+   P +LLIHG+  +  T      W +++    + + VIA D 
Sbjct: 20  MFRTIHGYRRAFRMAGE--GPALLLIHGIGDNSST------WTEIIPHLAKNYTVIAPDL 71

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
           LGHG+SDK     DY +   A     LL  LGI KV V+G+S+G  +A      +P  V 
Sbjct: 72  LGHGRSDKP--RADYSVAAYANGMRDLLSTLGIDKVTVVGHSLGGGVAMQFSYQFPQMVD 129

Query: 125 SVILGGVGSVLYD 137
            ++L   G V  D
Sbjct: 130 RLVLVSAGGVTKD 142


>gi|89094128|ref|ZP_01167071.1| alpha/beta superfamily hydrolase [Oceanospirillum sp. MED92]
 gi|89081603|gb|EAR60832.1| alpha/beta superfamily hydrolase [Oceanospirillum sp. MED92]
          Length = 251

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 101/204 (49%), Gaps = 22/204 (10%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y V  +  P I+L HGL  + + NW     I+ L +Q F+VIA D   HG+S  +  E  
Sbjct: 5   YQVHGEGEPLIIL-HGLFGTSE-NW--GSQIKSLAEQ-FQVIAVDMRDHGRSPHT-DEIS 58

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y L  MA D ++L+EHL +   H++G+SMG + A  + L +P  ++ +I+  +  V Y  
Sbjct: 59  YEL--MAKDIINLMEHLQLEAAHIIGHSMGGKAAMQLALLHPDRIKKLIIVDIAPVQYTP 116

Query: 139 DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDD-- 196
              D    + S  LPS+         K R  AD    N +  L     +++  +  ++  
Sbjct: 117 HHDDVFKGLFSVELPSL---------KSRGDADKQLANSIPELGVRAFLLKNLYKNENGE 167

Query: 197 -LYRIDVPVLIAVGSQDDLAGSPQ 219
             +R+++P+L    S  +++ +PQ
Sbjct: 168 FSWRMNLPLLHKQYS--NISAAPQ 189


>gi|188587327|ref|YP_001918872.1| alpha/beta hydrolase fold [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179352014|gb|ACB86284.1| alpha/beta hydrolase fold [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 271

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 16/152 (10%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V  +  P +LLI GL  +    W++  + Q    Q F++I FDN G G SDK   ++
Sbjct: 18  YYEVKGEGTP-LLLIEGLGYAT---WMW--YRQEKLQQNFQLIKFDNRGVGGSDKP--QD 69

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-----GGVG 132
            Y +  MA DA  L+E L I K +V+G S+G  IA  +   YP  V  +IL     GG  
Sbjct: 70  PYSVELMAQDAAQLMEALEIDKANVLGVSLGGFIAQELAYSYPDKVEKLILCSTSFGGPN 129

Query: 133 SVLYDSDVVD-WQSLIDSFLLPSIDEVQNPLG 163
           S+    + ++  Q     +   S+DE++N +G
Sbjct: 130 SIPIPQETLEVMQKGGGEY--SSLDELRNAVG 159


>gi|111023762|ref|YP_706734.1| hydrolase [Rhodococcus jostii RHA1]
 gi|110823292|gb|ABG98576.1| possible hydrolase [Rhodococcus jostii RHA1]
          Length = 345

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 66/133 (49%), Gaps = 12/133 (9%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDN 64
            FR+   Y+ AF   G+   P +LLIHG+  +  T      W +++    + + VIA D 
Sbjct: 20  MFRTIHGYRRAFRMAGE--GPALLLIHGIGDNSST------WTEIIPHLAKNYTVIAPDL 71

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
           LGHG+SDK     DY +   A     LL  LGI KV V+G+S+G  +A      +P  V 
Sbjct: 72  LGHGRSDKP--RADYSVAAYANGMRDLLSTLGIDKVTVVGHSLGGGVAMQFSYQFPQMVD 129

Query: 125 SVILGGVGSVLYD 137
            ++L   G V  D
Sbjct: 130 RLVLVSAGGVTKD 142


>gi|254819494|ref|ZP_05224495.1| dihydrolipoyllysine-residue acetyltransferase component of
           acetoincleaving system [Mycobacterium intracellulare
           ATCC 13950]
          Length = 287

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 68/123 (55%), Gaps = 15/123 (12%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSDK 72
           + A+ D GD +A  +LLIHG+A S +T      W  ++    + FR++A D LGHG+S K
Sbjct: 10  RIAYRDEGDGEA--LLLIHGMAGSSET------WRSVIPQLSKKFRIVAPDLLGHGQSAK 61

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---G 129
                DY L   A      L+ LG+S+  V+G+S+G  +A   V  +P Y + +IL   G
Sbjct: 62  P--RTDYSLGAFAVWLRDFLDELGVSQATVVGHSLGGGVAMQFVYQHPDYAKRLILISSG 119

Query: 130 GVG 132
           G+G
Sbjct: 120 GLG 122


>gi|321312618|ref|YP_004204905.1| putative esterase [Bacillus subtilis BSn5]
 gi|320018892|gb|ADV93878.1| putative esterase [Bacillus subtilis BSn5]
          Length = 274

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 113/252 (44%), Gaps = 31/252 (12%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           ++A  D G   +  ++ +HG   S Q+ W F    ++L D   R+I  D LGHG++D   
Sbjct: 13  RYAVADEGPNASEAVVCLHGFTGSKQS-WTFLD--EMLPDS--RLIKIDCLGHGETDAPL 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG-- 132
               Y      +D   + + L + KV ++GYSMG R+A S  + YP  V +++L      
Sbjct: 68  NGKRYSTSRQVSDLAEIFDQLKLHKVKLIGYSMGGRLAYSFAMTYPERVSALVLESTTPG 127

Query: 133 ---------SVLYDSDVVDWQSLIDSFLLPSIDEVQN-PLGKKFRKFAD-----LDPG-- 175
                     ++ D  + D+  ++   L   +   +N PL    ++ A+     +  G  
Sbjct: 128 LKTLGERRERIMRDRKLADF--ILRDGLKAFVAYWENIPLFSSQQRLAEDIRHRIRSGRL 185

Query: 176 -NDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQY 230
            N+   LA+ L+ +    +P     +  IDVPVL+  G  D+      QE+   +PSS+ 
Sbjct: 186 RNNKIGLANSLTGMGTGSQPSLWSRVEEIDVPVLLICGEWDEKFCAINQEVHKMLPSSRI 245

Query: 231 LNICRRDHLLAV 242
             + +  H + V
Sbjct: 246 EIVPKAGHTVHV 257


>gi|15609852|ref|NP_217231.1| hydrolase [Mycobacterium tuberculosis H37Rv]
 gi|15842253|ref|NP_337290.1| alpha/beta fold family hydrolase [Mycobacterium tuberculosis
           CDC1551]
 gi|31793887|ref|NP_856380.1| hydrolase [Mycobacterium bovis AF2122/97]
 gi|121638590|ref|YP_978814.1| putative hydrolase [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148662556|ref|YP_001284079.1| putative hydrolase [Mycobacterium tuberculosis H37Ra]
 gi|148823904|ref|YP_001288658.1| hydrolase [Mycobacterium tuberculosis F11]
 gi|167970062|ref|ZP_02552339.1| hypothetical hydrolase [Mycobacterium tuberculosis H37Ra]
 gi|215404680|ref|ZP_03416861.1| hydrolase [Mycobacterium tuberculosis 02_1987]
 gi|215412521|ref|ZP_03421255.1| hydrolase [Mycobacterium tuberculosis 94_M4241A]
 gi|215428143|ref|ZP_03426062.1| hydrolase [Mycobacterium tuberculosis T92]
 gi|215431654|ref|ZP_03429573.1| hydrolase [Mycobacterium tuberculosis EAS054]
 gi|219558724|ref|ZP_03537800.1| hydrolase [Mycobacterium tuberculosis T17]
 gi|224991082|ref|YP_002645771.1| putative hydrolase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253798203|ref|YP_003031204.1| hydrolase [Mycobacterium tuberculosis KZN 1435]
 gi|254365372|ref|ZP_04981417.1| hypothetical hydrolase [Mycobacterium tuberculosis str. Haarlem]
 gi|260187732|ref|ZP_05765206.1| hydrolase [Mycobacterium tuberculosis CPHL_A]
 gi|260201840|ref|ZP_05769331.1| hydrolase [Mycobacterium tuberculosis T46]
 gi|260206024|ref|ZP_05773515.1| hydrolase [Mycobacterium tuberculosis K85]
 gi|289444257|ref|ZP_06434001.1| hydrolase [Mycobacterium tuberculosis T46]
 gi|289448370|ref|ZP_06438114.1| hydrolase [Mycobacterium tuberculosis CPHL_A]
 gi|289553500|ref|ZP_06442710.1| hydrolase [Mycobacterium tuberculosis KZN 605]
 gi|289570891|ref|ZP_06451118.1| hydrolase [Mycobacterium tuberculosis T17]
 gi|289575413|ref|ZP_06455640.1| hydrolase [Mycobacterium tuberculosis K85]
 gi|289746517|ref|ZP_06505895.1| hydrolase [Mycobacterium tuberculosis 02_1987]
 gi|289751368|ref|ZP_06510746.1| hydrolase [Mycobacterium tuberculosis T92]
 gi|289754817|ref|ZP_06514195.1| hydrolase [Mycobacterium tuberculosis EAS054]
 gi|294994193|ref|ZP_06799884.1| hydrolase [Mycobacterium tuberculosis 210]
 gi|297635323|ref|ZP_06953103.1| hydrolase [Mycobacterium tuberculosis KZN 4207]
 gi|297732319|ref|ZP_06961437.1| hydrolase [Mycobacterium tuberculosis KZN R506]
 gi|298526185|ref|ZP_07013594.1| hypothetical hydrolase [Mycobacterium tuberculosis 94_M4241A]
 gi|313659652|ref|ZP_07816532.1| hydrolase [Mycobacterium tuberculosis KZN V2475]
 gi|61250834|sp|P0A572|Y2715_MYCTU RecName: Full=Uncharacterized protein Rv2715/MT2788
 gi|61250835|sp|P0A573|Y2734_MYCBO RecName: Full=Uncharacterized protein Mb2734
 gi|2182006|emb|CAB09475.1| POSSIBLE HYDROLASE [Mycobacterium tuberculosis H37Rv]
 gi|13882544|gb|AAK47104.1| hydrolase, alpha/beta hydrolase fold family [Mycobacterium
           tuberculosis CDC1551]
 gi|31619481|emb|CAD94919.1| POSSIBLE HYDROLASE [Mycobacterium bovis AF2122/97]
 gi|121494238|emb|CAL72716.1| Possible hydrolase [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|134150885|gb|EBA42930.1| hypothetical hydrolase [Mycobacterium tuberculosis str. Haarlem]
 gi|148506708|gb|ABQ74517.1| putative hydrolase [Mycobacterium tuberculosis H37Ra]
 gi|148722431|gb|ABR07056.1| hypothetical hydrolase [Mycobacterium tuberculosis F11]
 gi|224774197|dbj|BAH27003.1| putative hydrolase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319706|gb|ACT24309.1| hydrolase [Mycobacterium tuberculosis KZN 1435]
 gi|289417176|gb|EFD14416.1| hydrolase [Mycobacterium tuberculosis T46]
 gi|289421328|gb|EFD18529.1| hydrolase [Mycobacterium tuberculosis CPHL_A]
 gi|289438132|gb|EFD20625.1| hydrolase [Mycobacterium tuberculosis KZN 605]
 gi|289539844|gb|EFD44422.1| hydrolase [Mycobacterium tuberculosis K85]
 gi|289544645|gb|EFD48293.1| hydrolase [Mycobacterium tuberculosis T17]
 gi|289687045|gb|EFD54533.1| hydrolase [Mycobacterium tuberculosis 02_1987]
 gi|289691955|gb|EFD59384.1| hydrolase [Mycobacterium tuberculosis T92]
 gi|289695404|gb|EFD62833.1| hydrolase [Mycobacterium tuberculosis EAS054]
 gi|298495979|gb|EFI31273.1| hypothetical hydrolase [Mycobacterium tuberculosis 94_M4241A]
 gi|326904331|gb|EGE51264.1| hydrolase [Mycobacterium tuberculosis W-148]
 gi|328457976|gb|AEB03399.1| hydrolase [Mycobacterium tuberculosis KZN 4207]
          Length = 341

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ AF   G    P ILLIHG+  +  T W     +     Q F VIA D LGH
Sbjct: 21  FRTVHGYRRAFRIAGS--GPAILLIHGIGDN-STTW---NGVHAKLAQRFTVIAPDLLGH 74

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 75  GQSDKP--RADYSVAAYANGMRDLLSVLDIERVTIVGHSLGGGVAMQFAYQFPQLVDRLI 132

Query: 128 LGGVGSVLYDSDVV 141
           L   G V  D ++V
Sbjct: 133 LVSAGGVTKDVNIV 146


>gi|170690672|ref|ZP_02881838.1| alpha/beta hydrolase fold [Burkholderia graminis C4D1M]
 gi|170143921|gb|EDT12083.1| alpha/beta hydrolase fold [Burkholderia graminis C4D1M]
          Length = 272

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 100/228 (43%), Gaps = 27/228 (11%)

Query: 11  WRKYQFA--FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           W ++Q A  +Y    K AP ILL  GL  S   NW +   +  L D G RVI  D+ GHG
Sbjct: 31  WIEHQGARIWYASHGKGAPVILLHGGLGHS--GNWGYQ--VPALLDAGHRVIVIDSRGHG 86

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +S +      Y+   MA+D +++++ L + +  ++G+S GA +A  + +  P  V  V  
Sbjct: 87  RSTRD--ARPYKYELMASDVLAVMDALSVERAAIVGWSDGACVAMVLGMAAPERVAGVFF 144

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLD--PGNDLKALASCLS 186
            G          +D     +    P ID       +  + +A L   P N    +A+   
Sbjct: 145 FGCN--------MDPSGTKEFVATPVIDRC---FSRHRQDYARLSATPDNFDAFVAAVSE 193

Query: 187 MIRKP--FCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQ 229
           M+R        DL RI VPVLI     D+    P+    L   IP +Q
Sbjct: 194 MMRTEPNHAAPDLARIRVPVLIVQSEHDEFI-KPEHAEYLARSIPGAQ 240


>gi|312141265|ref|YP_004008601.1| alpha/beta hydrolase [Rhodococcus equi 103S]
 gi|311890604|emb|CBH49922.1| putative alpha/beta hydrolase [Rhodococcus equi 103S]
          Length = 237

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 107/237 (45%), Gaps = 33/237 (13%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HG + ++     F+  + +  ++ +RV+A D   HG+S +     D+    ++ D 
Sbjct: 22  LVLLHGNSENL---GYFAAQVPVFAER-YRVLALDTRAHGESTRGDGPLDF--ARLSDDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
            ++L+ LGI   H++GYS G   A ++ L  P  VRS+I+ G          +D   L  
Sbjct: 76  EAVLDALGIESAHILGYSDGGNTALTLALRDPRRVRSLIVNGAN--------LDPHGLGA 127

Query: 149 SFLLPSI-----DEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQ-DDLYRIDV 202
            F +P+           PL  K R+  +L              M+R P    D L  I V
Sbjct: 128 RFRVPATLAWLAAGAIAPLSAKVRRHREL-----------LELMVRHPHIPVDALSTIGV 176

Query: 203 PVLIAVGSQDDLAGSPQELMS-FIPSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYAN 257
           P L+ VG +D +     EL++  IP ++ + +    H  A    + F   V++F A+
Sbjct: 177 PTLVIVGERDAIPRRHTELIARSIPDAELMYVPDAGHACAEQRPEVFNAAVLDFLAH 233


>gi|226974012|gb|ACO95125.1| epoxide hydrolase [uncultured organism]
          Length = 339

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 74/160 (46%), Gaps = 8/160 (5%)

Query: 15  QFAFYDVGDK-DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +  FY+ G K D P ++L HG    +  +W     I+ L + G RVIA D  G+G +D+ 
Sbjct: 20  RMGFYEAGPKTDTPPLVLCHGW-PEIAFSWRHQ--IKALSETGLRVIAPDQRGYGATDRP 76

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
                Y +  + AD V LL+HL I K   +G+  G  I   M L +PS V  VI  GV +
Sbjct: 77  EPVEAYDIENLTADLVGLLDHLNIDKAIFVGHDWGGFIVWQMPLRHPSRVAGVI--GVNT 134

Query: 134 VLYDSDVVDWQSLIDSFLLPS--IDEVQNPLGKKFRKFAD 171
                   D   L+         I + Q+P  +  R FAD
Sbjct: 135 PHTPRTATDPIELLRQRYGDHLYIAQFQHPSREPDRIFAD 174


>gi|297561237|ref|YP_003680211.1| 3-oxoadipate enol-lactonase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296845685|gb|ADH67705.1| 3-oxoadipate enol-lactonase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 263

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 106/242 (43%), Gaps = 32/242 (13%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G  DAP +LL   L ++ +   ++   ++ L    FRVI FD+ GHG  D    E  Y
Sbjct: 9   ESGPADAPPLLLGGSLGTTTR---MWDPQVEALSTV-FRVIRFDHRGHG--DSPVPEGPY 62

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +  +  D ++L++ LGI + H  G S+G  +   + + +P  +  + L  + +  +   
Sbjct: 63  SMADLGGDVIALMDRLGIERAHYAGLSIGGMVGQWLAVHHPGRIDRLAL--LATSPHMGP 120

Query: 140 VVDWQ----------------SLIDSFLLPSIDEVQNPLGKKFR-KFADLDPGNDLKALA 182
             +W+                S+++ +  P+  E +       R + A   P    +  A
Sbjct: 121 ARNWRDRAALVRAEGTGAVADSVVERWFTPAFAEDRPAEVAVLRDQVAATAP----EGYA 176

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQD---DLAGSPQELMSFIPSSQYLNICRRDHL 239
            C   I     ++DL+RI  P L+  G+ D     AG+ + +   +P ++ + +    HL
Sbjct: 177 GCCEAIETHDVREDLHRISAPTLVVAGADDPSTPPAGNAELIAERVPGARLVVLEEAAHL 236

Query: 240 LA 241
           L+
Sbjct: 237 LS 238


>gi|148272252|ref|YP_001221813.1| putative hydrolase/acyltransferase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830182|emb|CAN01115.1| putative hydrolase/acyltransferase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 272

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HG A S Q  W   GW++ L      VI  D  GHG+SD  +    Y +  M AD 
Sbjct: 35  VVLVHGTALS-QAIWRGFGWVRALSPT-RPVITLDLRGHGRSDTPHEPAAYAMDLMVADV 92

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYP-SYVRSVILGG 130
           V++L+ +G S VH +GYS+G R+  S+   +P   V +  LGG
Sbjct: 93  VAVLDAIGASVVHHLGYSLGGRVGFSLAAAHPDRLVSTSSLGG 135


>gi|290893266|ref|ZP_06556253.1| hydrolase [Listeria monocytogenes FSL J2-071]
 gi|290557248|gb|EFD90775.1| hydrolase [Listeria monocytogenes FSL J2-071]
          Length = 275

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 105/249 (42%), Gaps = 26/249 (10%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R   +   +V   + P +L++HG   + +T   F   I  L ++ F +IA D LGHG + 
Sbjct: 4   RGKHYQLTNVISGEKPFLLMLHGFTGTSRT---FQASISRLKER-FNIIAPDLLGHGNTA 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL--- 128
                  Y +  +  D   +L+ L +++  V+GYSMG R+A +    YP  VR +IL   
Sbjct: 60  SPEEIAPYAMESICEDLAGILQQLNVTRCFVLGYSMGGRVATAFAAMYPEMVRGLILVSS 119

Query: 129 -GGVGSVLYDSDVVDWQSL---------IDSF--------LLPSIDEVQNPLGKKFRKFA 170
             G+  V + ++ V   +          I+SF        L  S   + + + ++ R   
Sbjct: 120 SPGLAEVDFRANRVQADNRLADKLEAEGIESFVDYWEDLALFASQKVLPDEVNERIRTER 179

Query: 171 DLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQ 229
                + L      +    +P   D L     PVL+  G+ D+      +E+   +P+S 
Sbjct: 180 LSQNSHGLAMSLRGMGTGVQPSYWDHLANFTFPVLLMTGALDEKFENIAREMQQLLPNST 239

Query: 230 YLNICRRDH 238
           ++ +    H
Sbjct: 240 HVTVPAAGH 248


>gi|319949041|ref|ZP_08023137.1| alpha/beta hydrolase fold protein [Dietzia cinnamea P4]
 gi|319437260|gb|EFV92284.1| alpha/beta hydrolase fold protein [Dietzia cinnamea P4]
          Length = 269

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 100/235 (42%), Gaps = 27/235 (11%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G +DAP +L  HGL  S    W+F   I  L D+ +R +  D  G G S ++     Y +
Sbjct: 21  GREDAPVVLFAHGLLFS---GWMFHPQIARLRDR-YRCVTIDFRGQGNSPRAL--GGYDM 74

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD-SDV 140
             +  D   LL HL I  V+ +G SMG  +   +    P  V ++ L    +   + ++ 
Sbjct: 75  DTLTVDVAELLRHLRIPVVNFVGLSMGGFVGIRLAARNPETVHTLTLMDTAATAEEPANR 134

Query: 141 VDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG-----------NDLKALASCLSMI- 188
             +++L   + +  I  V++ +        +LD              D   L   +  + 
Sbjct: 135 RKYRTLSAVYRVAGIRPVRSRVAPIMLAEGNLDAPWIDEWMAMLERTDRAGLVKAIESVA 194

Query: 189 -RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE----LMSFIPSSQYLNICRRDH 238
            R P C+D+  RI  P L+ VG++D  A +P E    L+  I  S+Y  I    H
Sbjct: 195 DRDP-CEDEAIRIIAPTLVMVGAED--AATPPEKSRRLVELIADSRYREIPGAGH 246


>gi|256396970|ref|YP_003118534.1| alpha/beta hydrolase fold protein [Catenulispora acidiphila DSM
           44928]
 gi|256363196|gb|ACU76693.1| alpha/beta hydrolase fold protein [Catenulispora acidiphila DSM
           44928]
          Length = 250

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 63/111 (56%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y++   + P ++ I GL   +    +F+    LL  + FRV+ FDN G G++DK   + 
Sbjct: 12  YYEI-HGEGPPLVFIGGLGVDLT---VFAPLTDLLA-RSFRVLTFDNRGAGRTDKP--DA 64

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            Y +  MA D V L++ LG+ + H++G SMG RIA  +   +PS V  ++L
Sbjct: 65  PYSIPMMAGDTVGLMDALGLPRAHMVGISMGGRIAMELAAEHPSRVDRLVL 115


>gi|261328221|emb|CBH11198.1| hydrolase, alpha/beta fold family, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 312

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 114/249 (45%), Gaps = 66/249 (26%)

Query: 19  YDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           YD  G+   P +LL+ GLA  V   W    + +++  +GF V+ +DN   G S  ++++N
Sbjct: 25  YDTFGNSKDPCLLLVVGLAG-VGRVWR-DAFCEMIAKKGFYVVRYDNRDVGLS--THLDN 80

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MAAD ++LL  LGI + HV+G SMG  IA  M 
Sbjct: 81  QPTPNVMQCLLPQFLSFLRKVPYTLEDMAADGMNLLTALGIERAHVVGSSMGGMIAQIMA 140

Query: 117 LFYPSYVRS--VILGGVGS-----------VLYD--------SDVVDWQ-SLIDSFLLP- 153
           + YPS VRS  +I    GS           +L+          DVVD++ +L   F  P 
Sbjct: 141 IKYPSRVRSLGIIYSHTGSSKRVPETFSTKLLFMKKPKSSALEDVVDFKCALAHHFRGPG 200

Query: 154 -SIDEVQNPLGKKFRKFA--DLDPGND-----LKALASCLSMIRKPFCQDDLYRIDVPVL 205
            ++DE      ++FRK A   L+  ND     L+ LA+ LS   +  C   L  I +P L
Sbjct: 201 YNVDE------EEFRKLAKEQLERANDYPQGMLRQLAAILSAKSREEC---LKTITIPTL 251

Query: 206 IAVGSQDDL 214
           I  G  D++
Sbjct: 252 IIHGMLDEV 260


>gi|329941348|ref|ZP_08290627.1| hydrolase [Streptomyces griseoaurantiacus M045]
 gi|329299879|gb|EGG43778.1| hydrolase [Streptomyces griseoaurantiacus M045]
          Length = 291

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 114/256 (44%), Gaps = 28/256 (10%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           P +LL+HGL     ++W  +   + L ++ +R +A D  GHG+S+K       R  ++  
Sbjct: 35  PGVLLLHGLMGRA-SHWTATA--RWLAER-YRPVALDQRGHGQSEKPPAAAHTREAYVE- 89

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQS 145
           DA + LE LG++ V V+G++MGA  A  +    P  VR +++  +  S L  +   +W+ 
Sbjct: 90  DAAAALEQLGLAPVVVIGHAMGALTAWQLAAARPDLVRGLVICDMRASALGAASQREWED 149

Query: 146 LIDSFLLP-----------SIDE--VQNPLGKKFRKFADL--DPGNDLKALASCLSMIRK 190
              ++ LP             D+  V+ P   +   +A++  +  +  + + +   M+R 
Sbjct: 150 WFRTWPLPFATLADVRKWFGEDDPWVERPSPARGEFYAEVMHESPDGWRPVFTPAQMLRS 209

Query: 191 PFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLLAVG 243
                     ++L ++  P L+  G    L     QE++  +P  +Y  +    HL+   
Sbjct: 210 RETWVYDAHWEELAQVRCPALVVRGLDGQLGRAESQEMVRVLPRGRYAEVADAGHLVHYD 269

Query: 244 DKQFKQGVVNFYANEL 259
             +  +  V  +  E+
Sbjct: 270 QPEAWRAAVEPFLEEV 285


>gi|37526116|ref|NP_929460.1| hypothetical protein plu2202 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785546|emb|CAE14495.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 299

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 102/237 (43%), Gaps = 44/237 (18%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQG--FRVIAFDNLGHGKSDKSYIENDYRLV 82
           + PT++ +HG+A  ++       +++ +      FRV+A D LGHG +DK      Y ++
Sbjct: 47  NGPTLIFLHGIAGHLE------AYMRNILPHAAHFRVLAIDMLGHGFTDKPV--RSYEII 98

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD 142
                   L+E L + K+H+ G S+G  +A      YP Y+  ++L   G ++ D +V++
Sbjct: 99  DYVEHLRDLIETLNLKKIHLSGESLGGWVAARFAAKYPQYIHRLVLNTAGGMIADPNVME 158

Query: 143 WQSLIDSFLLPSIDEVQNPLGKKFRK---FADLDPGNDLKALAS---------------- 183
               +      S++ V+NP  +  RK   F   DP    + L                  
Sbjct: 159 RLRTL------SLNAVKNPDREATRKRLEFLMEDPAMVTEDLVETRFAIYRQPGMLSAME 212

Query: 184 ---CL----SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYL 231
              CL    + +R    +D+L +I    L+   + D  A     Q L   I +S+++
Sbjct: 213 NIMCLQDMDTRLRNLLTKDELAKIQAETLVLWTTHDPTAAVSVGQRLAGLIKNSRFV 269


>gi|297564246|ref|YP_003683219.1| protein of unknown function DUF309 [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296848695|gb|ADH70713.1| protein of unknown function DUF309 [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 494

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F+     D P +LL+HG     Q  W +   +  L D G+R +A D  G+G SDK+    
Sbjct: 25  FHVAEAGDGPLVLLLHGFP---QFWWAWRAQLTALADAGYRAVAADLRGYGASDKT--PR 79

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            Y LV +A DA  L+  LG     V+G+ +G  +A +M  ++P  VR++
Sbjct: 80  GYDLVTLAQDAAGLVRALGSRDAAVVGHGLGGLVAWTMTAYHPGTVRAL 128


>gi|224132738|ref|XP_002321397.1| predicted protein [Populus trichocarpa]
 gi|222868393|gb|EEF05524.1| predicted protein [Populus trichocarpa]
          Length = 407

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G +V AFDN G G+S      ++Y    MA DA++L++HLG  K HV G+SMGA IAC +
Sbjct: 95  GVQVCAFDNRGMGRSSVPTKNSEYSTKIMAKDAIALMDHLGWRKAHVFGHSMGAMIACKL 154

Query: 116 VLFYPSYVRSVIL 128
               P  V S+ L
Sbjct: 155 AAMVPDRVLSLAL 167


>gi|83649270|ref|YP_437705.1| alpha/beta fold superfamily hydrolase [Hahella chejuensis KCTC
           2396]
 gi|83637313|gb|ABC33280.1| predicted Hydrolase or acyltransferase (alpha/beta hydrolase
           superfamily) [Hahella chejuensis KCTC 2396]
          Length = 266

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + GDK    ++LIHGL  S++      G  +LL D  F + + D   HG+S  + +  DY
Sbjct: 15  NAGDKT--PLVLIHGLFGSMEN---LGGIARLLADN-FVIHSLDMRNHGRSPHAQMM-DY 67

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY--- 136
            L  MAAD +  +++ GI+K H++G+SMG + A  + L YP  V  +I+  +  V Y   
Sbjct: 68  SL--MAADVIRYMDNAGIAKAHLLGHSMGGKTAMQIALEYPQRVEKLIVADIAPVAYPPH 125

Query: 137 DSDVVDWQSLIDSFLLPSIDEV 158
             D++   + +D   L S  E 
Sbjct: 126 HKDILKGLTALDPASLSSRQEA 147


>gi|218754451|ref|ZP_03533247.1| hydrolase [Mycobacterium tuberculosis GM 1503]
 gi|254232817|ref|ZP_04926144.1| hypothetical protein TBCG_02653 [Mycobacterium tuberculosis C]
 gi|254551771|ref|ZP_05142218.1| hydrolase [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|289762886|ref|ZP_06522264.1| hydrolase [Mycobacterium tuberculosis GM 1503]
 gi|308232222|ref|ZP_07415331.2| hydrolase [Mycobacterium tuberculosis SUMu001]
 gi|308369837|ref|ZP_07419234.2| hydrolase [Mycobacterium tuberculosis SUMu002]
 gi|308371109|ref|ZP_07423844.2| hydrolase [Mycobacterium tuberculosis SUMu003]
 gi|308372377|ref|ZP_07428440.2| hydrolase [Mycobacterium tuberculosis SUMu004]
 gi|308373488|ref|ZP_07432504.2| hydrolase [Mycobacterium tuberculosis SUMu005]
 gi|308374671|ref|ZP_07436922.2| hydrolase [Mycobacterium tuberculosis SUMu006]
 gi|308375501|ref|ZP_07444152.2| hydrolase [Mycobacterium tuberculosis SUMu007]
 gi|308377107|ref|ZP_07441147.2| hydrolase [Mycobacterium tuberculosis SUMu008]
 gi|308378075|ref|ZP_07481435.2| hydrolase [Mycobacterium tuberculosis SUMu009]
 gi|308379293|ref|ZP_07485770.2| hydrolase [Mycobacterium tuberculosis SUMu010]
 gi|308380452|ref|ZP_07489988.2| hydrolase [Mycobacterium tuberculosis SUMu011]
 gi|308405949|ref|ZP_07494523.2| hydrolase [Mycobacterium tuberculosis SUMu012]
 gi|124601876|gb|EAY60886.1| hypothetical protein TBCG_02653 [Mycobacterium tuberculosis C]
 gi|289710392|gb|EFD74408.1| hydrolase [Mycobacterium tuberculosis GM 1503]
 gi|308214651|gb|EFO74050.1| hydrolase [Mycobacterium tuberculosis SUMu001]
 gi|308326298|gb|EFP15149.1| hydrolase [Mycobacterium tuberculosis SUMu002]
 gi|308329826|gb|EFP18677.1| hydrolase [Mycobacterium tuberculosis SUMu003]
 gi|308333469|gb|EFP22320.1| hydrolase [Mycobacterium tuberculosis SUMu004]
 gi|308337464|gb|EFP26315.1| hydrolase [Mycobacterium tuberculosis SUMu005]
 gi|308341137|gb|EFP29988.1| hydrolase [Mycobacterium tuberculosis SUMu006]
 gi|308346078|gb|EFP34929.1| hydrolase [Mycobacterium tuberculosis SUMu007]
 gi|308348963|gb|EFP37814.1| hydrolase [Mycobacterium tuberculosis SUMu008]
 gi|308353661|gb|EFP42512.1| hydrolase [Mycobacterium tuberculosis SUMu009]
 gi|308357508|gb|EFP46359.1| hydrolase [Mycobacterium tuberculosis SUMu010]
 gi|308361462|gb|EFP50313.1| hydrolase [Mycobacterium tuberculosis SUMu011]
 gi|308365056|gb|EFP53907.1| hydrolase [Mycobacterium tuberculosis SUMu012]
 gi|323718709|gb|EGB27871.1| hydrolase [Mycobacterium tuberculosis CDC1551A]
          Length = 331

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ AF   G    P ILLIHG+  +  T W     +     Q F VIA D LGH
Sbjct: 11  FRTVHGYRRAFRIAGS--GPAILLIHGIGDN-STTW---NGVHAKLAQRFTVIAPDLLGH 64

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 65  GQSDKP--RADYSVAAYANGMRDLLSVLDIERVTIVGHSLGGGVAMQFAYQFPQLVDRLI 122

Query: 128 LGGVGSVLYDSDVV 141
           L   G V  D ++V
Sbjct: 123 LVSAGGVTKDVNIV 136


>gi|326388990|ref|ZP_08210572.1| alpha/beta hydrolase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206590|gb|EGD57425.1| alpha/beta hydrolase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 254

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 106/237 (44%), Gaps = 27/237 (11%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS   NW+  G    L + GF  +  D   HG S   +    Y    +A DA
Sbjct: 30  VVLLHGLFSSATVNWIKYGTAAQLAEAGFACLMPDLRAHGGSAAPHDAEAYPSDVLARDA 89

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVL--FYPSYVRSVILGGVGSVLYDSDVVDW--- 143
            +L+ HLG+S   ++G+S+GAR +   V+    P   R ++L G+G       +  W   
Sbjct: 90  EALVAHLGLSDFDLVGFSLGARTSARSVIRGMAP---RRLVLAGMGL----EGLAGWAKR 142

Query: 144 ----QSLIDSFLLPSIDEVQNP--LGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDL 197
               + +ID F         +P  + ++F K   +D     +  A  L    +    + L
Sbjct: 143 QDFFRDVIDRF---GTIRPGDPSYMAQQFLKSTGVD-----RVAARLLLGTMEDTPPEAL 194

Query: 198 YRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
             I +P L+  G+ D+  GS   L   +P+++ + I    H+ +V   +  + +V F
Sbjct: 195 KAITMPTLVLCGADDNDNGSADRLAEALPNAERVTIP-GTHMSSVTMPELGRELVAF 250


>gi|148530006|gb|ABQ82209.1| dihydrolipoamide acetyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 350

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           D+G  DA  I+L+HG    +  NWLF+         G RVIAFD  GHG S K       
Sbjct: 126 DLGHGDATPIVLVHGFGGDIG-NWLFN---HAALAAGRRVIAFDLPGHGGSTKDV--GAG 179

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            L F A   V LL+ LGI + H++G+S+G  +A ++    P+ V S+ L
Sbjct: 180 SLDFFAGIVVGLLDTLGIPQAHLVGHSLGGGVALTVARTAPARVASLAL 228


>gi|149611694|ref|XP_001521600.1| PREDICTED: similar to epoxide hydrolase 2, cytoplasmic, partial
           [Ornithorhynchus anatinus]
          Length = 530

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  F + G    P + L HG   S   +W +   I  L D GFRVIA D  G+G S    
Sbjct: 190 QLHFVEAGT--GPAVCLCHGFPES-WFSWRYQ--IPALADAGFRVIALDMKGYGDSSAPQ 244

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
              +Y    M  +AV+ L+ LGIS+   +G+  G     +M LFYP  VR+V
Sbjct: 245 AIEEYSQEEMCKEAVTFLDKLGISQAVFIGHDWGGMFVWNMALFYPERVRAV 296


>gi|72389234|ref|XP_844912.1| hydrolase, alpha/beta fold family [Trypanosoma brucei TREU927]
 gi|62360019|gb|AAX80442.1| hydrolase, alpha/beta fold family, putative [Trypanosoma brucei]
 gi|70801446|gb|AAZ11353.1| hydrolase, alpha/beta fold family, putative [Trypanosoma brucei
           brucei strain 927/4 GUTat10.1]
          Length = 312

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 114/249 (45%), Gaps = 66/249 (26%)

Query: 19  YDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           YD  G+   P +LL+ GLA  V   W    + +++  +GF V+ +DN   G S  ++++N
Sbjct: 25  YDTFGNSKDPCLLLVVGLAG-VGRVWR-DAFCEMIAKKGFYVVRYDNRDVGLS--THLDN 80

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MAAD ++LL  LGI + HV+G SMG  IA  M 
Sbjct: 81  QPTPNVMQCLLPQFLSFLRKVPYTLEDMAADGMNLLTALGIERAHVVGSSMGGMIAQIMA 140

Query: 117 LFYPSYVRS--VILGGVGS-----------VLYD--------SDVVDWQ-SLIDSFLLP- 153
           + YPS VRS  +I    GS           +L+          DVVD++ +L   F  P 
Sbjct: 141 IKYPSRVRSLGIIYSHTGSSKRVPETFSTKLLFMKKPKSSALEDVVDFKCALARHFRGPG 200

Query: 154 -SIDEVQNPLGKKFRKFA--DLDPGND-----LKALASCLSMIRKPFCQDDLYRIDVPVL 205
            ++DE      ++FRK A   L+  ND     L+ LA+ LS   +  C   L  I +P L
Sbjct: 201 YNVDE------EEFRKLAKEQLERANDYPQGMLRQLAAILSAKSREEC---LKTITIPTL 251

Query: 206 IAVGSQDDL 214
           I  G  D++
Sbjct: 252 IIHGMLDEV 260


>gi|228923611|ref|ZP_04086891.1| hypothetical protein bthur0011_45870 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228836080|gb|EEM81441.1| hypothetical protein bthur0011_45870 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 240

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +  +A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVILVDIVGHGKTESPEDVTHYDIRNVALQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSID-----------------E 157
           M   YP YV S++L    + L   D  + +   D  L   I+                 E
Sbjct: 73  MACLYPEYVHSLLLENCTAGLEREDEREERCEKDERLAHKIEREGIESFVTMWENIPLFE 132

Query: 158 VQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
            Q  L +  ++    +   N+ K LA+ L  +    +P   ++L  + +PVL+  G  D+
Sbjct: 133 RQKSLEQNVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEHDE 192


>gi|120403435|ref|YP_953264.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119956253|gb|ABM13258.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
          Length = 340

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 64/133 (48%), Gaps = 8/133 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F +   Y+ AF   G    P ILLIHG+  +  T W     +Q    Q F VIA D LGH
Sbjct: 20  FCTIHGYRRAFRVAGS--GPAILLIHGIGDN-STTW---STVQTQLAQRFTVIAPDLLGH 73

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I  V V+G+S+G  +A      +P  V  +I
Sbjct: 74  GRSDKP--RADYSVAAYANGMRDLLSVLDIDDVTVIGHSLGGGVAMQFAYQFPQLVNRLI 131

Query: 128 LGGVGSVLYDSDV 140
           L G G V  D ++
Sbjct: 132 LVGAGGVTKDVNI 144


>gi|15599347|ref|NP_252841.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas aeruginosa PAO1]
 gi|9950358|gb|AAG07539.1|AE004831_11 probable hydrolase [Pseudomonas aeruginosa PAO1]
          Length = 370

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++D G+ D P +LLIHG    +  NWLF+   + L  +  RVIA D  GHG+S K+ +  
Sbjct: 125 YFDRGEGD-PALLLIHGFGGDL-NNWLFNH--EALAAE-RRVIALDLPGHGESGKALVRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D  L  ++   ++LL+HL + +VH+ G+SMG  +A +     P  V S+ L G
Sbjct: 180 D--LDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQRVLSLSLIG 230


>gi|17230245|ref|NP_486793.1| hypothetical protein all2753 [Nostoc sp. PCC 7120]
 gi|17131846|dbj|BAB74452.1| all2753 [Nostoc sp. PCC 7120]
          Length = 273

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 60/119 (50%), Gaps = 4/119 (3%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           +   YQF +   G+ D P ILL+HG   ++     F   I+LL D  F  +  D  GHGK
Sbjct: 2   TIENYQFNYSLTGNTDKPVILLLHGFMGNIDE---FDAAIELLGDD-FSYLKLDLPGHGK 57

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +     +  Y +   A   ++LL+ L I+K  ++GYSMG R+   + L +P     V+L
Sbjct: 58  TQVLGGDEYYSMANTAQGLINLLDKLEITKCFLVGYSMGGRLGLYLTLHFPQRFYQVVL 116


>gi|162147504|ref|YP_001601965.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786081|emb|CAP55663.1| putative pyruvate dehydrogenase E2 component [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 374

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           D+G  DA  I+L+HG    +  NWLF+         G RVIAFD  GHG S K       
Sbjct: 129 DLGHGDATPIVLVHGFGGDIG-NWLFN---HAALAAGRRVIAFDLPGHGGSTKDV--GAG 182

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            L F A   V LL+ LGI + H++G+S+G  +A ++    P+ V S+ L
Sbjct: 183 SLDFFAGIVVGLLDTLGIPQAHLVGHSLGGGVALTVARTAPARVASLAL 231


>gi|107103669|ref|ZP_01367587.1| hypothetical protein PaerPA_01004739 [Pseudomonas aeruginosa PACS2]
          Length = 370

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++D G+ D P +LLIHG    +  NWLF+   + L  +  RVIA D  GHG+S K+ +  
Sbjct: 125 YFDRGEGD-PALLLIHGFGGDL-NNWLFNH--EALAAE-RRVIALDLPGHGESGKALVRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D  L  ++   ++LL+HL + +VH+ G+SMG  +A +     P  V S+ L G
Sbjct: 180 D--LDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQRVLSLSLIG 230


>gi|116052188|ref|YP_788968.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115587409|gb|ABJ13424.1| putative hydrolase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 370

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++D G+ D P +LLIHG    +  NWLF+   + L  +  RVIA D  GHG+S K+ +  
Sbjct: 125 YFDRGEGD-PALLLIHGFGGDL-NNWLFNH--EALAAE-RRVIALDLPGHGESGKALVRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D  L  ++   ++LL+HL + +VH+ G+SMG  +A +     P  V S+ L G
Sbjct: 180 D--LDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQRVLSLSLIG 230


>gi|209545611|ref|YP_002277840.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533288|gb|ACI53225.1| alpha/beta hydrolase fold [Gluconacetobacter diazotrophicus PAl 5]
          Length = 374

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           D+G  DA  I+L+HG    +  NWLF+         G RVIAFD  GHG S K       
Sbjct: 129 DLGHGDATPIVLVHGFGGDIG-NWLFN---HAALAAGRRVIAFDLPGHGGSTKDV--GAG 182

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            L F A   V LL+ LGI + H++G+S+G  +A ++    P+ V S+ L
Sbjct: 183 SLDFFAGIVVGLLDTLGIPQAHLVGHSLGGGVALTVARTAPARVASLAL 231


>gi|218889519|ref|YP_002438383.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas aeruginosa LESB58]
 gi|254237036|ref|ZP_04930359.1| hypothetical protein PACG_03065 [Pseudomonas aeruginosa C3719]
 gi|254242836|ref|ZP_04936158.1| hypothetical protein PA2G_03603 [Pseudomonas aeruginosa 2192]
 gi|296387290|ref|ZP_06876789.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas aeruginosa PAb1]
 gi|313109600|ref|ZP_07795549.1| putative hydrolase [Pseudomonas aeruginosa 39016]
 gi|126168967|gb|EAZ54478.1| hypothetical protein PACG_03065 [Pseudomonas aeruginosa C3719]
 gi|126196214|gb|EAZ60277.1| hypothetical protein PA2G_03603 [Pseudomonas aeruginosa 2192]
 gi|218769742|emb|CAW25502.1| probable hydrolase [Pseudomonas aeruginosa LESB58]
 gi|310882051|gb|EFQ40645.1| putative hydrolase [Pseudomonas aeruginosa 39016]
          Length = 370

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++D G+ D P +LLIHG    +  NWLF+   + L  +  RVIA D  GHG+S K+ +  
Sbjct: 125 YFDRGEGD-PALLLIHGFGGDL-NNWLFNH--EALAAE-RRVIALDLPGHGESGKALVRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D  L  ++   ++LL+HL + +VH+ G+SMG  +A +     P  V S+ L G
Sbjct: 180 D--LDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQRVLSLSLIG 230


>gi|253989839|ref|YP_003041195.1| hypothetical protein PAU_02359 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781289|emb|CAQ84451.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 299

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 116/267 (43%), Gaps = 51/267 (19%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQG--FRVIAFDNLGHGKSDK---SYIENDY 79
           + PT++ +HG+A  ++       +++ +      FRV+A D LGHG +DK   +Y  +DY
Sbjct: 47  NGPTLIFLHGIAGHLE------AYMRNILPHATHFRVLAIDMLGHGFTDKPARAYEIDDY 100

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
                      L+E L + K+H+ G S+G  IA      YP Y+  ++L   G ++ D +
Sbjct: 101 -----IEHLRDLIETLNLKKIHLSGESLGGWIAARFAAKYPQYIHRLVLNTAGGMIADPN 155

Query: 140 VVDWQSLIDSFLLPSIDEVQNPLGKKFRK--------------------FADLDPGNDLK 179
           V++    +      S++ V+NP  +  RK                    FA     + L 
Sbjct: 156 VMERLRTL------SLNAVKNPDREATRKRLEFLMEDPDIVTEDLVESRFAIYRQPDMLS 209

Query: 180 ALAS--CL----SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYL 231
           A+ S  CL    + +R    +++L +I    L+   + D  A     Q L   I +S+++
Sbjct: 210 AMESIMCLQDMDTRLRNLLTENELMQIQAETLVLWTTHDPTASVSVGQRLARLIKNSRFV 269

Query: 232 NICRRDHLLAVGDK-QFKQGVVNFYAN 257
            + +  H     D   F Q  +NF  N
Sbjct: 270 VMEQCGHWPQYEDPDTFNQIHINFLLN 296


>gi|217978233|ref|YP_002362380.1| alpha/beta hydrolase fold protein [Methylocella silvestris BL2]
 gi|217503609|gb|ACK51018.1| alpha/beta hydrolase fold protein [Methylocella silvestris BL2]
          Length = 360

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 102/221 (46%), Gaps = 27/221 (12%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSDKSYIENDY 79
           GD DAP ++L H L  ++Q       W +L     + FRV+ +D+ GHG S  +     Y
Sbjct: 17  GDADAPVLILAHQLGGALQV------WDRLAPALSERFRVLRYDSRGHGSSVAN--PGPY 68

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +  +A DA+ LL+ L I K H +G SMGA +  + +L  P+ +   +L    + L   D
Sbjct: 69  SIAGLARDAIGLLDALQIEKAHWIGLSMGAIVGQAAMLLAPARIGRAVLANTAAQLGTPD 128

Query: 140 VVDWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPG------NDLKAL-----ASCLS 186
           +  W + I +        + +   +++   +F + +P       +D +A      AS   
Sbjct: 129 L--WNARISAMRADGGAGIASATQERWFTPEFCEAEPAAVKAVMDDFRATPVEGYASACG 186

Query: 187 MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPS 227
            +R    ++ +  I    L+ VG++D  A  P  L +++ S
Sbjct: 187 ALRDVDLREAIRSISHETLVIVGARDPSA--PPALGAYVAS 225


>gi|150396886|ref|YP_001327353.1| alpha/beta hydrolase fold [Sinorhizobium medicae WSM419]
 gi|150028401|gb|ABR60518.1| alpha/beta hydrolase fold [Sinorhizobium medicae WSM419]
          Length = 273

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 71/132 (53%), Gaps = 6/132 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ ++GD +   ILL+HG   S ++  L + ++      GFRV+A D  GHG SD+  
Sbjct: 24  RLAYIEMGDPNGVPILLLHGFTDSARSWSLAAPYLA----PGFRVVAADLRGHGNSDQP- 78

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E  Y +  +A D   L+  L ++  H++G+S+G R+  ++   +P  VR ++L    + 
Sbjct: 79  -EGCYTIPELANDVRLLMVALDLAPCHLVGHSLGGRLVQALAERWPHLVRKIVLMSTSAA 137

Query: 135 LYDSDVVDWQSL 146
           L +     W+++
Sbjct: 138 LRERQGWLWENI 149


>gi|145595953|ref|YP_001160250.1| alpha/beta hydrolase fold [Salinispora tropica CNB-440]
 gi|145305290|gb|ABP55872.1| alpha/beta hydrolase fold [Salinispora tropica CNB-440]
          Length = 309

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R + F  +  G    P +LL+HG     Q + +++  + LL   G R  A D  G+    
Sbjct: 39  RGFAFDLHVGGPAAGPPVLLLHGFP---QHSGVWADVVPLLHAAGLRTYALDQRGYSPGA 95

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           +    + YRL  +  DAV++LE LGI+  HV+G+  GA +  ++   +P+ VRS+
Sbjct: 96  RPAAVSAYRLGELVGDAVAVLERLGIATAHVVGHDWGAAVGWAIAAEHPARVRSL 150


>gi|290958708|ref|YP_003489890.1| hydrolase [Streptomyces scabiei 87.22]
 gi|260648234|emb|CBG71342.1| putative hydrolase [Streptomyces scabiei 87.22]
          Length = 289

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 109/246 (44%), Gaps = 46/246 (18%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSDK 72
           FA+ D+G +    ++ I  LA+      +   W   + D      RVI FDN G G +  
Sbjct: 30  FAYRDLGPRTGVPVVFITHLAA------VLDNWDPRVVDGIAAKHRVITFDNRGVGATTG 83

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
           S  +    +  MA DAV+ ++ LG+ +V ++ +SMGA IA  +V   P  VR +IL G G
Sbjct: 84  STPKT---IQEMAKDAVTFIQALGLDRVDILSFSMGAMIAQVIVQTDPQLVRRLILAGTG 140

Query: 133 SVLYDS-DVVDWQSLIDSFLLPSIDEVQNP--------------LGKKF-RKFADLDPGN 176
               +    V   S +D+  L ++  +Q+P               GK+F  +  +   G 
Sbjct: 141 PAGGEGIKNVTRVSHLDT--LRALFTLQDPKQFLFFTRTANGRRAGKEFLARLKERTEGR 198

Query: 177 D----LKALASCLSMIRKPFCQ--DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQY 230
           D    L A  + L  I +   +   DL R+  PVL+A G  D +          +P+S  
Sbjct: 199 DKAISLTAYGAQLKAIHRWGLERPHDLSRVHQPVLVANGESDRM----------VPTSNS 248

Query: 231 LNICRR 236
            ++ RR
Sbjct: 249 ADLARR 254


>gi|228910710|ref|ZP_04074521.1| hypothetical protein bthur0013_48540 [Bacillus thuringiensis IBL
           200]
 gi|228848978|gb|EEM93821.1| hypothetical protein bthur0013_48540 [Bacillus thuringiensis IBL
           200]
          Length = 240

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 88/181 (48%), Gaps = 25/181 (13%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + F+VI  D +GHGK++       Y +   A     LL++L I K H++GYSMG R+A +
Sbjct: 13  EQFQVIVVDLVGHGKTESPEDVTHYDIRNAAVQMKELLDYLHIEKAHILGYSMGGRLAIT 72

Query: 115 MVLFYPSYVRSVILGGVGSVLYD--------------SDVVDWQSLIDSFL-----LPSI 155
           +   YP YV S++L    + L +              +D ++ +  I+SF+     +P +
Sbjct: 73  LACLYPEYVHSLLLENCTAGLENEADRKERREKDDRLADKIEREG-IESFVSMWENIP-L 130

Query: 156 DEVQNPLGKKFRKFADLDP-GNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQ 211
            E Q  L +  ++    +   N+ K LA+ L  +    +P    +L+ + +PVL+  G  
Sbjct: 131 FETQKRLAENVQEAVRKERLANNPKGLANSLRGMGTGAQPSWWKELHNLKIPVLLMNGEY 190

Query: 212 D 212
           D
Sbjct: 191 D 191


>gi|67538026|ref|XP_662787.1| hypothetical protein AN5183.2 [Aspergillus nidulans FGSC A4]
 gi|40743174|gb|EAA62364.1| hypothetical protein AN5183.2 [Aspergillus nidulans FGSC A4]
 gi|259484639|tpe|CBF81033.1| TPA: epoxide hydrolase, putative (AFU_orthologue; AFUA_2G14860)
           [Aspergillus nidulans FGSC A4]
          Length = 780

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (52%), Gaps = 3/112 (2%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Y +A+    +   P IL +HG  SS   ++ +   +Q    QGF V+A D LG+G + K 
Sbjct: 472 YSYAYNSPINPSLPIILFLHGFPSS---SYDWRHQVQFFSAQGFGVLAPDLLGYGDTSKP 528

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS 125
           +    Y+   MAA+ + +L+H GI KVH + +  G  +   +  ++PS + S
Sbjct: 529 WTLESYKAKTMAAEIIEILDHEGIHKVHAVAHDTGCTLLSRLANYFPSRLLS 580


>gi|326527739|dbj|BAK08144.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326529279|dbj|BAK01033.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 326

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G    P +LL+HG    +  +W     +  L  +GFR +A D  G+G SD       Y
Sbjct: 25  EQGPAAGPAVLLLHGF-PELWLSWRHQ--MAALAARGFRALAPDLRGYGDSDAPADPAAY 81

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            ++ +  D V+LL+HL + KV V G+  GA++A  + LF P  VR+V+  G+
Sbjct: 82  TMLHVVGDVVALLDHLRLPKVLVAGHDWGAQVAWHLCLFRPDRVRAVVALGI 133


>gi|330957672|gb|EGH57932.1| alpha/beta fold family hydrolase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 262

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 89/197 (45%), Gaps = 19/197 (9%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HGL SS Q +W +   I  L  + +RVI  D  GHG+SDK +    Y +  M+ D 
Sbjct: 22  VLLLHGLGSSCQ-DWEYQ--IPALAAR-YRVIVMDLRGHGRSDKPH--ERYSIQGMSNDV 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGVGSVLYDS--DVVDWQS 145
            +L+EHL +  VHV+G SMG  +   + +  P+ ++S+ I+     V   S  D+  W  
Sbjct: 76  EALIEHLRLGPVHVVGLSMGGMVGFQLAVDQPALLKSLCIVNSAPQVKVRSPGDLWQWAR 135

Query: 146 LIDSFLLPSIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
                 +  +  +   LGK            RK A+    ND +A  +    I     + 
Sbjct: 136 RWTLSRVVGMATLGQALGKLLFPKPEQAELRRKMAERWGRNDKRAYLASFDAIVGWGVEQ 195

Query: 196 DLYRIDVPVLIAVGSQD 212
            L RI  P L+     D
Sbjct: 196 HLARITCPTLVIAAEHD 212


>gi|326496723|dbj|BAJ98388.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 326

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G    P +LL+HG    +  +W     +  L  +GFR +A D  G+G SD       Y
Sbjct: 25  EQGPAAGPAVLLLHGF-PELWLSWRHQ--MAALAARGFRALAPDLRGYGDSDAPADPAAY 81

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            ++ +  D V+LL+HL + KV V G+  GA++A  + LF P  VR+V+  G+
Sbjct: 82  TMLHVVGDVVALLDHLRLPKVLVAGHDWGAQVAWHLCLFRPDRVRAVVALGI 133


>gi|226308776|ref|YP_002768736.1| 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone
           decarboxylase [Rhodococcus erythropolis PR4]
 gi|226187893|dbj|BAH35997.1| 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone
           decarboxylase [Rhodococcus erythropolis PR4]
          Length = 393

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 95/222 (42%), Gaps = 25/222 (11%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F   G+ DAP ++L+  L S +    ++   I  L ++ +RVIA D+ GHGKS       
Sbjct: 7   FQQTGNPDAPAVVLLGSLGSDLS---MWQPQIHALSNR-YRVIAVDHRGHGKS--PVPAG 60

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS---- 133
            Y +  +A D ++LL+ L +  VH++G S+G  ++  +   +P+ V ++ L    S    
Sbjct: 61  PYSIADLAGDVIALLDSLELESVHLVGLSLGGAVSQWIAAHHPTRVETLTLMCTSSQFAP 120

Query: 134 ----------VLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALAS 183
                     V  D       +++  +  P + E    L  +     +  P     A   
Sbjct: 121 TQPWIDRAQAVRADGVASIAAAVVGRWFTPELAENDPELVARHVAMVEATPDEGYAACCE 180

Query: 184 CLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFI 225
            LSM      + DL RI  P L+  G QD    +P   +S I
Sbjct: 181 ALSMWDG---RADLARIVAPTLLVAGEQDP--STPPATLSAI 217


>gi|154252129|ref|YP_001412953.1| alpha/beta hydrolase fold protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154156079|gb|ABS63296.1| alpha/beta hydrolase fold [Parvibaculum lavamentivorans DS-1]
          Length = 356

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 64/131 (48%), Gaps = 21/131 (16%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS---- 70
           +  +   G +D  TILLI GL + + T W      + L  +G+RVI FDN   G S    
Sbjct: 10  ELEYESFGSEDDETILLIMGLGAQL-TQWPVE-LCEALVARGYRVIRFDNRDTGLSSRIE 67

Query: 71  -DKSYIEND--------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
            D++++ +D              Y L  MAADAV LL+ LGI K H+ G SMG  IA  +
Sbjct: 68  RDRAFVWSDALFSLMSGKPAFVAYSLSDMAADAVGLLDALGIEKAHIAGASMGGMIAQHV 127

Query: 116 VLFYPSYVRSV 126
              YP    S+
Sbjct: 128 AAEYPERTHSL 138


>gi|296168351|ref|ZP_06850275.1| alpha/beta hydrolase fold family hydrolase [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295896782|gb|EFG76415.1| alpha/beta hydrolase fold family hydrolase [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 291

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 16/136 (11%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRV 59
           M+E+KF       + A+ D G+ +   +LLIHG+A S +T      W  ++    + FRV
Sbjct: 1   MSELKFL-ELHGDRVAYRDEGEGE--VLLLIHGMAGSSET------WRSVIPPLSKKFRV 51

Query: 60  IAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
           IA D LGHG+S K     DY L   A     LL+ LG+S+  ++G S+G  +A   V  +
Sbjct: 52  IAPDLLGHGESAKP--RTDYSLGAFAVWLRDLLDELGVSQATLVGQSLGGGVAMQFVYQH 109

Query: 120 PSYVRSVIL---GGVG 132
           P Y + +IL   GG+G
Sbjct: 110 PDYAKRLILISSGGLG 125


>gi|111026935|ref|YP_708913.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Rhodococcus
           jostii RHA1]
 gi|110825474|gb|ABH00755.1| probable 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
           [Rhodococcus jostii RHA1]
          Length = 377

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 64/133 (48%), Gaps = 12/133 (9%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDN 64
            FR+   Y+ AF   GD   P +LL+HG+  +  T      W +++    + + VIA D 
Sbjct: 20  LFRTIHGYRRAFRMAGD--GPALLLLHGIGDNSST------WTEIIPHLAENYTVIAPDL 71

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
           LGHG+SDK     DY +   A     LL  LGI    V+G+S+G  IA      +P  V 
Sbjct: 72  LGHGRSDKP--RADYSVAAYANGMRDLLSTLGIDHATVIGHSLGGGIAMQFAYQFPQMVD 129

Query: 125 SVILGGVGSVLYD 137
            +IL   G +  D
Sbjct: 130 RLILVSAGGITKD 142


>gi|229085492|ref|ZP_04217730.1| Hydrolase [Bacillus cereus Rock3-44]
 gi|228697797|gb|EEL50544.1| Hydrolase [Bacillus cereus Rock3-44]
          Length = 268

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 97/215 (45%), Gaps = 19/215 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y V  K  P I+ IH     V T   F   I+ L  Q F+VIAFD  GHG+S+ S    
Sbjct: 16  YYIVKGKGVP-IVFIH---PPVLTCENFEYQIEEL-SQNFKVIAFDIRGHGRSEYSKQPI 70

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y L+  A D   LL+HL I K  V GYS G+ +A   +L +       IL G  S + D
Sbjct: 71  TYPLI--AEDIRCLLDHLKIKKAFVCGYSTGSSVALEFLLAFAEKALGGILIGGMSEVRD 128

Query: 138 SDVVDWQSL--------IDSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALA-SCLSM 187
             + +  SL          SFL  SI    +   K FRK F +   GN        C S+
Sbjct: 129 GYLKNKISLGVKLAKVGAVSFLAWSISWSNSNTHKLFRKMFKEARKGNAKNIWQYYCYSL 188

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM 222
                C + L  I +PVL+  G +D +  S  +L+
Sbjct: 189 HYN--CTNQLRNIQLPVLLVYGEKDKVFYSHAKLL 221


>gi|119478562|ref|ZP_01618505.1| putative epoxide hydrolase [marine gamma proteobacterium HTCC2143]
 gi|119448466|gb|EAW29715.1| putative epoxide hydrolase [marine gamma proteobacterium HTCC2143]
          Length = 343

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 14/120 (11%)

Query: 14  YQF-----AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQL---LCDQGFRVIAFDNL 65
           YQF      F  V   D P ++L+HG   S         W++L   L + G+RV+AFD  
Sbjct: 68  YQFRARVAGFESVPAADKPAVILLHGFPVSSAM------WVRLIGPLVESGYRVVAFDQR 121

Query: 66  GHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS 125
           G+    +     DYR+  +++D V++ + LG+   H++G+  GA +  S V+ YP  + S
Sbjct: 122 GYSPGARPTELRDYRIDELSSDVVAVADALGVETFHLIGHDWGAAVGWSTVMQYPQRIES 181


>gi|307308993|ref|ZP_07588673.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
 gi|306900466|gb|EFN31080.1| alpha/beta hydrolase fold protein [Sinorhizobium meliloti BL225C]
          Length = 273

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 6/132 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + A+ ++GD +   +LL+HG   S ++  L + ++      GFRV+A D  GHG SD+  
Sbjct: 24  RLAYIEMGDPNGVPVLLLHGFTDSARSWSLAAPYLA----AGFRVVAPDLRGHGNSDQP- 78

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            E  Y +  +A D   L+  L I+  HV+G+S+G R+  ++   +P  VR ++L      
Sbjct: 79  -EGCYTIPELANDVRFLIVALEIAPCHVVGHSLGGRLVQAIAERWPHLVRKIVLMSTSVA 137

Query: 135 LYDSDVVDWQSL 146
           L +     W+++
Sbjct: 138 LRERQGWLWENI 149


>gi|260904596|ref|ZP_05912918.1| hydrolase [Brevibacterium linens BL2]
          Length = 266

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 10/110 (9%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSYIENDY 79
           G ++AP +LL+ G ++S +  W    W +L  D    FR + FD  G G S       D 
Sbjct: 23  GPREAPALLLLQGQSNSHR--W----WDELRADFEPQFRTVTFDYRGTGGSRGEL--TDL 74

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
                AADA  +L+HLGI++  V G SMG RIA  + L +P +V +++LG
Sbjct: 75  STASFAADAAEVLDHLGIARAAVYGTSMGGRIAQMLALDFPEHVGALVLG 124


>gi|313608403|gb|EFR84350.1| shchc synthase [Listeria monocytogenes FSL F2-208]
          Length = 275

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 105/250 (42%), Gaps = 28/250 (11%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R   +   +V   + P +L++HG   + +T   F   I  L ++ F +IA D LGHG + 
Sbjct: 4   RGKHYQLTNVISGEKPFLLMLHGFTGTSRT---FQASIARLKER-FNIIAPDLLGHGNTA 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
                  Y +  +  D   +L+ L +++  V+GYSMG R+A +    YP  VR +IL   
Sbjct: 60  SPEEIASYAMESICEDLAGILQQLNVTRCFVLGYSMGGRVATAFAATYPEMVRGLILVSS 119

Query: 132 GSVLYD--------------SDVVDWQSLIDSF--------LLPSIDEVQNPLGKKFRKF 169
              L +              +D ++ +  I+SF        L  S   + + + K+ R  
Sbjct: 120 SPGLVEVNLRANRVQADNRLADKLEAEG-IESFVDYWEDLALFASQKVLPDEVNKRIRTE 178

Query: 170 ADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSS 228
                 + L      +   ++P   + L     PVL+  G+ D+      +E+   +P+S
Sbjct: 179 RLSQNSHGLAMSLRGMGTGKQPSYWNHLVNFTFPVLLITGALDEKFENIAREMQQLLPNS 238

Query: 229 QYLNICRRDH 238
            ++ +    H
Sbjct: 239 THVTVPVAGH 248


>gi|313623460|gb|EFR93664.1| shchc synthase [Listeria innocua FSL J1-023]
          Length = 275

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 99/241 (41%), Gaps = 32/241 (13%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           + + P +L++HG   S +T   F   I LL +  F +IA D LGHGK+        Y + 
Sbjct: 15  NGEKPVLLMLHGFTGSSET---FQDSISLLKEH-FSIIAPDLLGHGKTSCPEEGARYSIE 70

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD----- 137
            +  D  S+L  L I    V+GYSMG R+A +    Y   VR +IL      L D     
Sbjct: 71  NICDDLASILHQLKIDSCFVLGYSMGGRVATAFAAKYKELVRGLILVSSSPGLRDEKARA 130

Query: 138 ---------SDVVD----------WQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL 178
                    +D +D          W++L    L  S   +  PL K+ R        + L
Sbjct: 131 SRISADNRLADTLDADGMEPFVAYWENLA---LFASQKNLPFPLKKRIRLERLAQNPHGL 187

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRD 237
                 +   ++P    +L     PVL+  G+ D+      +E+   +P+S ++ I    
Sbjct: 188 AMSLRGMGTGKQPSYWGNLADFTFPVLLITGNLDEKFEKIAREMKQLLPNSTHVTIQDAG 247

Query: 238 H 238
           H
Sbjct: 248 H 248


>gi|152966387|ref|YP_001362171.1| alpha/beta hydrolase fold [Kineococcus radiotolerans SRS30216]
 gi|151360904|gb|ABS03907.1| alpha/beta hydrolase fold [Kineococcus radiotolerans SRS30216]
          Length = 278

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 114/270 (42%), Gaps = 43/270 (15%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSG--W---IQLLCDQGFRVIAFDNLGHGKSDKSY 74
           D G    P ++LIHG        W  SG  W   +  L   G+RVI +D  G G+SDK+ 
Sbjct: 20  DTGGPGRP-VVLIHG--------WPLSGASWSEQVPALTAAGYRVITYDRRGFGRSDKTR 70

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSM-GARIACSMVLFYPSYVRSVILGGV-- 131
           I  DY    +  D  +LLE L ++ V ++G+SM G  +A     +    +RSV+      
Sbjct: 71  IGYDYDT--LTEDLHALLEALDLTDVTLVGFSMGGGEVARYFTKYSDERLRSVVFAAAVP 128

Query: 132 ------------------GSVLYDSDVVDWQSLIDSFLLP--SIDEVQNPLGKKFRKFAD 171
                              + +  +   D  S  D F+    S+D V      + ++   
Sbjct: 129 PYMAKGKDNPDGPLTKEQAAQMEAALTADEDSFYDGFVTDFFSVDGVLKVTEAQRQEALA 188

Query: 172 LDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD---LAGSPQELMSFIPSS 228
           L    D KA    ++       +DDL ++DVPVL+  G  D     AGS     + IP S
Sbjct: 189 LTKQADKKAALKAMASFGTTDFRDDLPKVDVPVLVVHGDGDGTVPFAGSGARTHAAIPGS 248

Query: 229 QYLNICRRDHLLAVGD-KQFKQGVVNFYAN 257
           +   I    H + V   ++F + +++F A+
Sbjct: 249 RLHVIAGGPHGINVSHAEEFNRVLLDFLAS 278


>gi|300741769|ref|ZP_07071790.1| probable hydrolase protein [Rothia dentocariosa M567]
 gi|300380954|gb|EFJ77516.1| probable hydrolase protein [Rothia dentocariosa M567]
          Length = 311

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 118/292 (40%), Gaps = 70/292 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK------------ 69
            +K    +L +HG A+     W  +GWI+     G  V+  D   HG+            
Sbjct: 19  AEKGTTPVLFLHGFATRSDQLWGGTGWIRQYIRAGIPVLTVDLPFHGRKYLKDSNFTVHA 78

Query: 70  --------------------SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGA 109
                               S+    +N   +V  A    +LL+ L I +VH +G+S G+
Sbjct: 79  KLPVGTIEEHGIFPVVQTTMSEDGSPQNG--MVLFADTLSALLDELAIQQVHGVGFSFGS 136

Query: 110 RIACSMVLFYPSYVRSVILGGVG---------SVLYDSDVVD-----------WQSLIDS 149
           R+   + L  PS V S+ILGG+          S+L  S   D           + S+I+S
Sbjct: 137 RVGWELALRRPSRVASLILGGMPLHNHLEALRSMLSASCADDAITQDPATEEAFTSIIES 196

Query: 150 FLLPS---IDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLI 206
             L +   +D V  P G+ F   + L     +  + +       PF         VP+LI
Sbjct: 197 SPLRANALLDFVHIPFGEFFSLPSALADSTRIPVIHAA----NPPFPYP-----RVPLLI 247

Query: 207 AVGSQDDLAGSPQELMSFI----PSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           A+GS+D +A   + L   +    P  ++L+I  RDH+ A+    F++  + F
Sbjct: 248 AIGSEDSIAADGRRLYPLLQRVHPYLKFLDIPGRDHVSALTSGVFRRNALAF 299


>gi|302535980|ref|ZP_07288322.1| hydrolase [Streptomyces sp. C]
 gi|302444875|gb|EFL16691.1| hydrolase [Streptomyces sp. C]
          Length = 298

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 106/240 (44%), Gaps = 33/240 (13%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY-----RL 81
           P +LL+HGL      +W  +G  + L +   RVIA D  GHG S       D      R 
Sbjct: 40  PAVLLLHGLMGRA-LHW--AGTARWLGEH-RRVIALDQRGHGHSGHPAPGPDRPARLGRE 95

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDV 140
            F+A DA +++E LG+  V ++G+SMGA     +    P  V+++++  +  S L ++  
Sbjct: 96  AFVA-DAEAVIEQLGLGPVILIGHSMGALTGWQLAARRPDLVQALVICDMRASALGEASQ 154

Query: 141 VDWQSLIDSFLL--PSIDEVQNPLGKKFRKFADLDPG-------------NDLKALASCL 185
            +WQ     + L  P+ D  +   G+   +    DPG             +  + L S  
Sbjct: 155 QEWQEWFRRWPLPFPTQDAARRWFGEDDPRVERPDPGRGAFFAEVMHRAPDGWRPLFSRS 214

Query: 186 SM--IRKPFCQD----DLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDH 238
            M  +R+ +  D    +L ++  P L+  G   +L     QE++  +P+ QY  I    H
Sbjct: 215 QMLTVRETWVHDAHWEELAQVRCPTLVVRGLDGELGRAEAQEMVRVLPAGQYAEIPDAGH 274


>gi|330432957|gb|AEC18016.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 262

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           F +    + +A T++ IHGL   +       G I    DQ + ++  D   HG+S   + 
Sbjct: 8   FDYQPSANAEADTLVFIHGLFGDMNN----LGIIAKAFDQQYALLRIDLRNHGRS-FHHD 62

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
           E DY L  MA D + +L+HLG+ KV ++G+SMG + A    L YP YV+S+++  +  V 
Sbjct: 63  EMDYPL--MADDLLRVLQHLGLKKVILIGHSMGGKTAMQFALTYPDYVKSLVVLDIAPVT 120

Query: 136 YDSD 139
           Y  +
Sbjct: 121 YTHN 124


>gi|240849510|ref|NP_001155563.1| esterase ybfF-like [Acyrthosiphon pisum]
 gi|239790074|dbj|BAH71622.1| ACYPI004279 [Acyrthosiphon pisum]
          Length = 296

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 85/164 (51%), Gaps = 15/164 (9%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFR-VIAFDNLGHG 68
           S+  Y+ A     D   P I+++HGL    ++NW  +   + L +   R VI  D   HG
Sbjct: 31  SYTSYESA---ADDGRKPPIIIMHGLFG-CKSNW--NSLSKTLHNMTHRKVITVDARNHG 84

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            S  + +E  Y+L  MA D   L+E LG+ K  ++G+SMG R    + + YP  V S+I 
Sbjct: 85  DSPHT-LEQSYQL--MAEDVKFLMEDLGVKKASLIGHSMGGRTMMYLAVIYPELVESLIP 141

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSID-EVQNPLGKKFRKFAD 171
             + S +   +V D QS+ID  +L  ++ EV  P+  K RK AD
Sbjct: 142 VDI-SPINSKEVSDIQSVID--VLRGVNLEVNGPIS-KVRKLAD 181


>gi|329115243|ref|ZP_08243998.1| Dihydrolipoyllysine-residue acetyltransferase component of acetoin
           cleaving system [Acetobacter pomorum DM001]
 gi|326695686|gb|EGE47372.1| Dihydrolipoyllysine-residue acetyltransferase component of acetoin
           cleaving system [Acetobacter pomorum DM001]
          Length = 388

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 6/116 (5%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           ++     DVG +    I+L+HG    + +NWL +    L  D+  RVIAFD  GHG S K
Sbjct: 122 EHTLNVRDVGTQQGTPIVLVHGFGGDI-SNWLLT-QDALAADR--RVIAFDLPGHGASSK 177

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +       L F+A     LL+ L I K HV+G+S+G  IA +++  +P  V S+ L
Sbjct: 178 NV--GTGTLAFLAGVVSDLLQTLKIEKAHVVGHSLGGGIALTLLRDHPEQVASLNL 231


>gi|84495953|ref|ZP_00994807.1| probable hydrolase [Janibacter sp. HTCC2649]
 gi|84382721|gb|EAP98602.1| probable hydrolase [Janibacter sp. HTCC2649]
          Length = 299

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 59/123 (47%), Gaps = 20/123 (16%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD---------- 71
           G  D   ILLI G+ + +   W    +++LL   GFRVI +DN   G S           
Sbjct: 17  GPDDGEPILLIMGMGAQL-VAW-PPDFVELLVAHGFRVIRYDNRDQGLSSFTDGPPPRRG 74

Query: 72  --------KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
                   + + + DY LV +A DA  LL HLGI   HV+G SMG  IA  + L +P  V
Sbjct: 75  DVAKGLAARRFAKADYTLVDLAGDAAGLLTHLGIDSAHVVGASMGGMIAQELALNHPDRV 134

Query: 124 RSV 126
            S+
Sbjct: 135 LSL 137


>gi|228991501|ref|ZP_04151449.1| Hydrolase [Bacillus pseudomycoides DSM 12442]
 gi|228768225|gb|EEM16840.1| Hydrolase [Bacillus pseudomycoides DSM 12442]
          Length = 264

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 93/215 (43%), Gaps = 19/215 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y V  K  P + +   + + V   +   G       Q F+VIAFD  GHG+S  S    
Sbjct: 12  YYIVKGKGVPIVFIHPPVLTCVNFEYQIEGL-----SQNFKVIAFDIRGHGRSQYSKQPI 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y L+  A D   LL+HL I K  V GYS G+ +A   +L +       IL G  S + D
Sbjct: 67  TYPLI--AEDIRCLLDHLEIKKAFVCGYSTGSSVALEFLLAFAERALGGILIGGMSEVRD 124

Query: 138 SDVVDWQSL--------IDSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALA-SCLSM 187
             + +  SL          SFL  SI    +   K FRK F +   GN        C S+
Sbjct: 125 GYLKNKISLGVKLAKAGAVSFLAWSISWSNSNTHKLFRKMFKEARKGNAKNIWQYYCYSL 184

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM 222
                C + L  I +PVL+  G +D +  S  +L+
Sbjct: 185 HYD--CTNQLRNIQLPVLLVYGKKDKIFYSHAKLL 217


>gi|145222954|ref|YP_001133632.1| alpha/beta hydrolase fold [Mycobacterium gilvum PYR-GCK]
 gi|315443416|ref|YP_004076295.1| hydrolase or acyltransferase of alpha/beta superfamily
           [Mycobacterium sp. Spyr1]
 gi|145215440|gb|ABP44844.1| alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]
 gi|315261719|gb|ADT98460.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Mycobacterium sp. Spyr1]
          Length = 291

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 10/119 (8%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           A+ D GD +  T+LL+HG+A S +T   +   I  L  + +RVIA D LGHG S K    
Sbjct: 15  AYRDEGDGEE-TLLLLHGMAGSSET---WRAVIPHLAKR-YRVIAPDLLGHGSSAKP--R 67

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GGVG 132
            DY L   AA    LL+ LGI  V V+G S+G  +A   V  +P Y R ++L   GG+G
Sbjct: 68  GDYSLGAFAAWLRDLLDELGIRSVTVVGQSLGGGVAMQFVYQHPDYCRRLVLISSGGLG 126


>gi|56550949|ref|YP_161788.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56542523|gb|AAV88677.1| alpha/beta hydrolase fold protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 268

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 117/266 (43%), Gaps = 39/266 (14%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS---D 71
           ++ ++D+G  +   +L +HGL +S +    ++  +  + DQG+RVI  D LGHG S   D
Sbjct: 10  RYYYFDIGTGEP--VLFLHGLCNSGRA---WAPQVADMVDQGYRVIIPDLLGHGASSLLD 64

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
           + +   D     MA      LE+LG+    V+  S+G  +A  +   YP+ V  ++L G 
Sbjct: 65  REFTPKDQAQAMMA-----FLEYLGLKSAIVVALSLGGTVALEIATNYPATVEKLVLAGS 119

Query: 132 GSVLYDSDVVDWQSLIDSFLLPSIDE-------VQNPLGKKFRKFADLDPG--------- 175
              +  SD    Q +++S++     E           LG   +KFA    G         
Sbjct: 120 FLTMATSDR---QQMLNSWIETLRQENGGIACFESGWLGLAGQKFAKTASGIACYQAWQA 176

Query: 176 ----NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA--GSPQELMSFIPSSQ 229
                D ++L      +++   + +L ++    LI  G +D ++     QE+ S I S+ 
Sbjct: 177 QAAIQDSQSLIQWCEGMKRYDIRPNLEKVTAASLILAGEKDSMSPIKESQEIASLIKSAT 236

Query: 230 YLNICRRDHLLAVGD-KQFKQGVVNF 254
           +  +    H+  V    +FK  + +F
Sbjct: 237 FKVVTGEGHVFNVSSASEFKNCLHDF 262


>gi|317506040|ref|ZP_07963870.1| alpha/beta hydrolase [Segniliparus rugosus ATCC BAA-974]
 gi|316255698|gb|EFV14938.1| alpha/beta hydrolase [Segniliparus rugosus ATCC BAA-974]
          Length = 340

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F +   Y+ A+   G    P +LLIHG+  +  T W     +Q      F VIA D LGH
Sbjct: 20  FCTVHGYRRAYRVAGS--GPAVLLIHGIGDNSST-W---DEVQTALASRFTVIAPDLLGH 73

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           GKSDK     DY +   A     LL  LGI +V V+G+S+G  +A      +P  V  ++
Sbjct: 74  GKSDKP--RADYSIAAYANGMRDLLSVLGIDRVTVVGHSLGGGVAMQFAYQFPQLVERLV 131

Query: 128 LGGVGSVLYDSDVV 141
           L   G V  D ++V
Sbjct: 132 LVAAGGVTKDVNIV 145


>gi|218781569|ref|YP_002432887.1| alpha/beta hydrolase fold protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762953|gb|ACL05419.1| alpha/beta hydrolase fold protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 335

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 68/138 (49%), Gaps = 33/138 (23%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKS 70
           + A+   GD  A  +LLI GLA  + T      W + LC    D GF VI FDN   G+S
Sbjct: 19  EIAYDAFGDPQAKPLLLIMGLADQMIT------WHEKLCRVLADSGFFVIRFDNRDIGRS 72

Query: 71  DKSYIEND---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGA 109
             +++E++                     Y L  MA DA+++L+ LG+   HVMG SMG 
Sbjct: 73  --TWLEDEGAPNIPLLVLKRLLGLPVKTPYTLKDMALDALAVLDALGLESAHVMGASMGG 130

Query: 110 RIACSMVLFYPSYVRSVI 127
            I  ++ L YP  VR+++
Sbjct: 131 MIGQALALDYPERVRTLV 148


>gi|289758844|ref|ZP_06518222.1| predicted protein [Mycobacterium tuberculosis T85]
 gi|289714408|gb|EFD78420.1| predicted protein [Mycobacterium tuberculosis T85]
          Length = 295

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ AF   G    P ILLIHG+  +  T W     +     Q F VIA D LGH
Sbjct: 21  FRTVHGYRRAFRIAGS--GPAILLIHGIGDN-STTW---NGVHAKLAQRFTVIAPDLLGH 74

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L I +V ++G+S+G  +A      +P  V  +I
Sbjct: 75  GQSDKP--RADYSVAAYANGMRDLLSVLDIERVTIVGHSLGGGVAMQFAYQFPQLVDRLI 132

Query: 128 LGGVGSVLYDSDVV 141
           L   G V  D ++V
Sbjct: 133 LVSAGGVTKDVNIV 146


>gi|152988094|ref|YP_001346321.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas aeruginosa PA7]
 gi|150963252|gb|ABR85277.1| probable hydrolase [Pseudomonas aeruginosa PA7]
          Length = 370

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++D G+ DAP +LLIHG A  +  NWLF+   + L  +  RVIA D  GHG+S K     
Sbjct: 125 YFDRGEGDAP-LLLIHGFAGDL-NNWLFNH--EALAAE-RRVIALDLPGHGESGKLLARG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D  L  ++A  ++LL+HL +   H+ G+SMG  +A +     P  V S+ L G
Sbjct: 180 D--LDELSASVLALLDHLELEHAHLAGHSMGGAVALNCARLAPQRVLSLSLIG 230


>gi|120405233|ref|YP_955062.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119958051|gb|ABM15056.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
          Length = 290

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 14/123 (11%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDK 72
           + A+ DVG +   T+LL+HG+A S  T      W  +L    + +RVIA D LGHG+S K
Sbjct: 13  RVAYRDVG-RGEETLLLLHGMAGSSDT------WRAVLPQLAKRYRVIAPDLLGHGQSAK 65

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---G 129
               +DY L   A      L+ LGIS+V V+G S+G  +A   V  +P Y + ++L   G
Sbjct: 66  P--RSDYSLGAFAVGLRDFLDELGISRVTVVGQSLGGGVAMQFVYQHPDYCQRLVLISSG 123

Query: 130 GVG 132
           G+G
Sbjct: 124 GLG 126


>gi|319951461|ref|ZP_08025271.1| putative hydrolase [Dietzia cinnamea P4]
 gi|319434898|gb|EFV90208.1| putative hydrolase [Dietzia cinnamea P4]
          Length = 308

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 68/132 (51%), Gaps = 14/132 (10%)

Query: 15  QFAFYDVGDKDA-PTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSD 71
           + A+ + G  +  PTILLIHG+A S  T      W +L+   D  F VIA D  GHG+S 
Sbjct: 10  ELAYREAGAGEGKPTILLIHGMAGSSTT------WRELIPRLDAHFHVIAPDLPGHGESS 63

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
             +  +DY L  MA+    LL   GI +  V+G S+G  +A   V  YP Y   ++L G 
Sbjct: 64  LDF--DDYSLGAMASALRDLLVVKGIKRCTVIGQSLGGGVAMQFVYQYPEYCERIVLIGS 121

Query: 132 GSVLYDSDVVDW 143
           G +  +   V+W
Sbjct: 122 GGLGKE---VNW 130


>gi|119511217|ref|ZP_01630333.1| lipolytic enzyme [Nodularia spumigena CCY9414]
 gi|119464095|gb|EAW45016.1| lipolytic enzyme [Nodularia spumigena CCY9414]
          Length = 280

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 122/268 (45%), Gaps = 33/268 (12%)

Query: 1   MMNEVKFFRSWRKYQFA--------FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL 52
           + ++V FF S+ +            FYD+  +  P +LLI G      + W  S  +  L
Sbjct: 3   LHHQVNFFYSYLRLMPKVQVNGIDLFYDIKGQGEP-LLLIAGFLCD-HSYW--SLIMPSL 58

Query: 53  CDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
             Q ++VI  DN G G+S  S  ++ Y L  MA D  +LL+H+GI++V V+G+SMG +IA
Sbjct: 59  VTQ-YQVIRVDNRGLGRS--SAPDSPYNLQQMANDIAALLDHIGINQVSVVGHSMGGQIA 115

Query: 113 CSMVLFYPSYVRSVIL---GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-------- 161
             +VL  P  V+S+IL      G   ++  +  W  L  S  L    +V  P        
Sbjct: 116 QELVLAQPGRVKSLILLSSLAKGDERFNHVISTWGDLPSSIDLKLYQKVVFPWIFTDEFY 175

Query: 162 ----LGKKFRKFADLDPGND-LKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG 216
               + ++  ++A   P       L      I     QD L++I  P LI VG +D L  
Sbjct: 176 SIPGMVEQLIEWAVNYPFTPATHTLYHHSRAILSSDTQDRLHKIHCPTLILVGKEDILTP 235

Query: 217 S--PQELMSFIPSSQYLNICRRDHLLAV 242
               ++L   IP ++ + + R  H L +
Sbjct: 236 VKFSEQLAQGIPHAELVVLDRGGHGLLI 263


>gi|241207066|ref|YP_002978162.1| alpha/beta hydrolase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860956|gb|ACS58623.1| alpha/beta hydrolase fold protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 283

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 113/249 (45%), Gaps = 32/249 (12%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKS 70
           K  +A Y  GD     IL IHG   + +       W   + D  +  RVI  D+ GHG+S
Sbjct: 51  KMYYAEYGEGDP----ILFIHGGLGNAEV------WGHQVADFAKDHRVIVADSRGHGRS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-- 128
            +S     Y L  M +D V+LL++L I KV ++G+S G  I   M + +P  +  VI   
Sbjct: 101 TRSQQPFGYDL--MTSDYVALLDYLKIDKVTLVGWSDGGIIGIDMAMKHPEKLTRVIAQA 158

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI 188
             V +    +DV+D ++  D           N  G+++RK +     N+  A    +S +
Sbjct: 159 ANVTTDGVKADVMDNKTFNDYI---------NVAGEQYRKLSPTP--NEYDAFVKQISEM 207

Query: 189 ---RKPFCQDDLYRIDVPVLIAVGSQDDLAG-SPQELMSF-IPSSQYLNICRRDHLLAVG 243
              +  +   DL +I VPV +A+G  D+       E+M+  IP ++ + +    H   + 
Sbjct: 208 WATQPAWTAADLGKISVPVTLAIGDHDEAVKLDHTEMMAKQIPGAKLVILKDVSHFAMLQ 267

Query: 244 DKQFKQGVV 252
           D     G+V
Sbjct: 268 DPAAYDGMV 276


>gi|254832077|ref|ZP_05236732.1| hypothetical protein Lmon1_12010 [Listeria monocytogenes 10403S]
          Length = 275

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 100/238 (42%), Gaps = 30/238 (12%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P +L++HG   + +T   F   I  L ++ F +IA D LGHG +      + Y +  +
Sbjct: 17  EKPALLMLHGFTGTSET---FQDIISGLKER-FNIIAPDLLGHGNTASPEEISSYTMENI 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV---- 140
             D   +L  L IS+  V+GYSMG R+A +    +P  VR +IL      L   D+    
Sbjct: 73  CEDLAGILHQLNISRCFVLGYSMGGRVATAFAATFPKRVRGLILVSSSPGLEQEDIRASR 132

Query: 141 -------VDWQSLIDSFLLPSIDEVQN------------PLGKKFRKFADLDPGNDLKAL 181
                   DW  + +  L+P +D  +N             + ++ R        + L   
Sbjct: 133 IEADNRLADW--IEEEGLVPFVDYWENLALFASQKVLSPEMKRRIRSERLSQNSHGLAMS 190

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
              +   ++    + L     PVL+  G+ D+      QE+   +P+S +++I    H
Sbjct: 191 LRGMGTGKQLSYWNCLANFTFPVLLITGALDEKFEKIAQEMHQLLPNSTHVSIQEAGH 248


>gi|257056948|ref|YP_003134780.1| putative hydrolase or acyltransferase of alpha/beta superfamily
           [Saccharomonospora viridis DSM 43017]
 gi|256586820|gb|ACU97953.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Saccharomonospora viridis DSM 43017]
          Length = 293

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
            A+ D G+ D   ++L+HG   S   ++L+   I  L + GFRVIA D  G G+S K   
Sbjct: 19  LAYVDKGEGDP--VVLLHGFPDS---HYLWRHQIDPLVEAGFRVIAPDLRGFGESSKPQE 73

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
              Y +  +  D V L +HLG SKVH++G+  GA IA       P  V  + +  VG
Sbjct: 74  IEAYEMRVLVNDIVGLTQHLGFSKVHLVGHDWGAAIAWMYAFLMPRRVDHLAVFSVG 130


>gi|228997623|ref|ZP_04157233.1| Hydrolase [Bacillus mycoides Rock3-17]
 gi|228762132|gb|EEM11068.1| Hydrolase [Bacillus mycoides Rock3-17]
          Length = 264

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 93/215 (43%), Gaps = 19/215 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y V  K  P + +   + + V   +   G       Q F+VIAFD  GHG+S  S    
Sbjct: 12  YYIVKGKGVPIVFIHPPVLTCVNFEYQIEGL-----SQNFKVIAFDIRGHGRSQYSKQPI 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y L+  A D   LL+HL I K  V GYS G+ +A   +L +       IL G  S + D
Sbjct: 67  TYPLI--AEDIRCLLDHLEIKKAFVCGYSTGSSVALEFLLAFAERALGGILIGGMSEVRD 124

Query: 138 SDVVDWQSL--------IDSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALA-SCLSM 187
             + +  SL          SFL  SI    +   K FRK F +   GN        C S+
Sbjct: 125 GYLKNKISLGVKLAKAGAVSFLAWSISWSNSNTHKLFRKMFKEARKGNAKNIWQYYCYSL 184

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM 222
                C + L  I +PVL+  G +D +  S  +L+
Sbjct: 185 HYD--CTNQLRNIQLPVLLVYGKKDKVFYSHAKLL 217


>gi|157273382|gb|ABV27281.1| homoda-hydrolase [Candidatus Chloracidobacterium thermophilum]
          Length = 310

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+ G  D P +LL+HG   S   ++ F      L  +GFR IAFD  GHG SD +  +ND
Sbjct: 53  YEYGPVDGPAVLLLHGWDCS---SYWFYRLAPALGKRGFRTIAFDFRGHGFSDAA-PDND 108

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVIL 128
           Y L  +A D + L + LG+ + H++ +S+G+ +A  +    P  V R V++
Sbjct: 109 YTLPTLAQDTLCLADCLGVQQFHLVSFSLGSAVALLVGSLAPERVGRQVVM 159


>gi|226306283|ref|YP_002766243.1| hydrolase [Rhodococcus erythropolis PR4]
 gi|226185400|dbj|BAH33504.1| putative hydrolase [Rhodococcus erythropolis PR4]
          Length = 345

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 73/154 (47%), Gaps = 17/154 (11%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDN 64
            FR+   Y+ AF   G+   P +LL+HG+  +  T      W +++    + + VIA D 
Sbjct: 20  MFRTIHGYRRAFRIAGE--GPAVLLLHGIGDNSST------WTEIIPHLAKKYTVIAPDL 71

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
           LGHG+SDK     DY +   A     LL  LGI  V V+G+S+G  +A      +P  V 
Sbjct: 72  LGHGRSDKP--RADYSVAAYANGMRDLLSTLGIEHVTVIGHSLGGGVAMQFSYQFPHMVD 129

Query: 125 SVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEV 158
            ++L   G V  D        L+    +P ++EV
Sbjct: 130 RLVLVSAGGVTKDV-----HPLLRLMSVPVVNEV 158


>gi|313677712|ref|YP_004055708.1| alpha/beta hydrolase fold protein [Marivirga tractuosa DSM 4126]
 gi|312944410|gb|ADR23600.1| alpha/beta hydrolase fold protein [Marivirga tractuosa DSM 4126]
          Length = 323

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 8/112 (7%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           A+ D+GD +   IL IHGLAS     W ++  I  L  + +R IA D +G+GKS K    
Sbjct: 58  AYADLGDGEP--ILFIHGLASYAPA-WKYN--INELS-KSYRCIAVDLMGYGKSSKGKYN 111

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            D  L F A     L+E L I+  H+ G+SMG +IA  M + +P  V+S++L
Sbjct: 112 AD--LSFHAQFLFELMEQLDIASFHIAGHSMGGQIALKMAIKHPEKVKSLML 161


>gi|226307429|ref|YP_002767389.1| epoxide hydrolase [Rhodococcus erythropolis PR4]
 gi|226186546|dbj|BAH34650.1| putative epoxide hydrolase [Rhodococcus erythropolis PR4]
          Length = 281

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 84/183 (45%), Gaps = 12/183 (6%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           F   D G  D P ++L+HG     ++   +     LL  +GFR +A D  G+    +   
Sbjct: 18  FDVRDEGPADGPVVVLLHGFPQDSRS---WDHLAPLLHARGFRTVAPDQRGYSPGARPKA 74

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              YR   +AAD V+L++ LG+ KVH++G+  GA +A  +    P  + +V    V   L
Sbjct: 75  RWAYRGSELAADTVALIDTLGVGKVHLVGHDWGAAVAWQVAAERPDLLDTVTTVSVPHPL 134

Query: 136 --YDSDVVDWQSL----IDSFLLPSIDE---VQNPLGKKFRKFADLDPGNDLKALASCLS 186
               + V   Q L    + +F LP + E     + LG+KF   +   P N  + L + L+
Sbjct: 135 AFIKAMVTSTQGLKSWYMGAFQLPFVPEKILASSSLGEKFLVSSGQTPENARRDLNAMLA 194

Query: 187 MIR 189
             R
Sbjct: 195 PGR 197


>gi|148256344|ref|YP_001240929.1| putative alpha/beta hydrolase [Bradyrhizobium sp. BTAi1]
 gi|146408517|gb|ABQ37023.1| putative alpha/beta hydrolase [Bradyrhizobium sp. BTAi1]
          Length = 334

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 69/132 (52%), Gaps = 13/132 (9%)

Query: 2   MNEVKFFRSWRKYQFAFYDVG--DKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQG 56
           +N +       + + A+ DV     +  T LL+HG       N+  S W   I+ L +QG
Sbjct: 43  VNLLPLVNDGEQLRMAYMDVAPAQPNGRTALLLHG------RNFPSSYWAPVIKTLTEQG 96

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           FRV+  D +G GKS K   E  +    +A + V+LL+HLGI+KV ++ +SMG  +A  + 
Sbjct: 97  FRVVVPDQVGFGKSTKPSGELHFDT--LARNTVALLDHLGIAKVDIVAHSMGGMLAVRIA 154

Query: 117 LFYPSYVRSVIL 128
             +P  V  ++L
Sbjct: 155 RAFPDRVAHLVL 166


>gi|119961915|ref|YP_949289.1| hydrolase, alpha/beta fold family protein [Arthrobacter aurescens
           TC1]
 gi|119948774|gb|ABM07685.1| putative hydrolase, alpha/beta fold family protein [Arthrobacter
           aurescens TC1]
          Length = 277

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (46%), Gaps = 17/201 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y++       +LL+HG    ++    F   I  L D G RVIA D  GHG+++   I+ 
Sbjct: 21  YYELHGSGGTPLLLLHGGLFDIEQQ--FGALIPGLSD-GRRVIATDFQGHGRTND--IDC 75

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
                 +AAD V+LLEHL + +V V G+S+G  +A  + + +P  VR +I+  V S   D
Sbjct: 76  PLNTQDLAADVVALLEHLNVGEVDVFGFSVGGAVALHLAIKHPELVRKLIVSSV-SFHPD 134

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI------RKP 191
            D     + +    +  I     P+ +++   +   P  D + L   L+ +       K 
Sbjct: 135 GDRGGNAAAVTEMTVDMI--AGTPMEERYLAVS---PHPDHEHLQGLLTKLGGYDAGSKG 189

Query: 192 FCQDDLYRIDVPVLIAVGSQD 212
           +  D++  I  P LI VG  D
Sbjct: 190 WTDDEIRGIQAPTLITVGDCD 210


>gi|326693274|ref|ZP_08230279.1| alpha/beta superfamily hydrolase/acyltransferase [Leuconostoc
           argentinum KCTC 3773]
          Length = 245

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 106/246 (43%), Gaps = 39/246 (15%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + GD+   T+ L+HG   S +    F   I     Q F VIA D  GHG+S  +      
Sbjct: 18  EFGDRQHQTLFLLHGNGGSAR---YFRPQITQYA-QYFHVIAIDTRGHGRSSNT----QR 69

Query: 80  RLVF--MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG-------G 130
           R+ F  M AD  ++ +   I  ++++GYS GA I       YP  V  ++L        G
Sbjct: 70  RITFDDMVADIEAIRQTEQIETLYILGYSDGANIGIKYATLYPKRVTRLVLNAPNLSKKG 129

Query: 131 VGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRK 190
           V  VL+      W      FL+  +  + +   +++++         L  ++  L++ R+
Sbjct: 130 VYQVLW------WFDRTAQFLMRLLAPINHYAKRRYKQ---------LHVMSEPLNISRR 174

Query: 191 PFCQDDLYRIDVPVLIAVGSQDDLAGSP-QELMSFIPSSQYLNICRRDHLLA-VGDKQFK 248
                DL RI  P L+ +G  D +     + + + +P ++ L I R  H +     K+F 
Sbjct: 175 -----DLERISAPTLLVIGRFDLVKKRHIERIAAILPHAEVLIIPRGGHFVTYTNPKKFS 229

Query: 249 QGVVNF 254
             V+ F
Sbjct: 230 ALVLPF 235


>gi|224120854|ref|XP_002318435.1| predicted protein [Populus trichocarpa]
 gi|222859108|gb|EEE96655.1| predicted protein [Populus trichocarpa]
          Length = 413

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
            +V AFDN G G+S     +++Y    MA DA++L++HLG  K H+ G+SMGA IAC + 
Sbjct: 95  IQVCAFDNRGMGRSSVPTKKSEYTTKIMAKDAIALMDHLGWRKAHIFGHSMGAMIACKLA 154

Query: 117 LFYPSYVRSVIL 128
              P  V S+ L
Sbjct: 155 AMVPDRVLSLAL 166


>gi|307726932|ref|YP_003910145.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1003]
 gi|307587457|gb|ADN60854.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1003]
          Length = 284

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 94/212 (44%), Gaps = 20/212 (9%)

Query: 9   RSWRKYQFAFYDV--GDKDA---PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           R   +  +A YD   G+++    P ILL  GL  S   NW +   ++ L D G  V+  D
Sbjct: 38  REGARIWYASYDKAGGERNGQGKPVILLHGGLGHS--GNWGYQ--VRALLDAGRSVVVID 93

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
           + GHG+S +      Y+   MA+D +++++ L I +  ++G+S GA +A  + +  P  V
Sbjct: 94  SRGHGRSTRD--ARPYKYELMASDVLAVMDTLAIQQAALVGWSDGACVAMVLAMMAPERV 151

Query: 124 RSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALAS 183
             V+  G          +D     +    P ID   N   + + + +      D    A 
Sbjct: 152 AGVLFFGCN--------MDPGGTKEFVATPVIDRCFNRHREDYARLSATPDAFDAFVAAV 203

Query: 184 CLSMIRKP-FCQDDLYRIDVPVLIAVGSQDDL 214
              M  +P +   DL RI VPVLIA    D+ 
Sbjct: 204 TEMMRTEPNYAAHDLARIRVPVLIAHSEHDEF 235


>gi|118592922|ref|ZP_01550310.1| 3-oxoadipate enol-lactone hydrolase [Stappia aggregata IAM 12614]
 gi|118434456|gb|EAV41109.1| 3-oxoadipate enol-lactone hydrolase [Stappia aggregata IAM 12614]
          Length = 263

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 36/242 (14%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           GD D   ++  + L +  +   L+   I LL + GFR+I FD  GHG S  S     + +
Sbjct: 17  GDPDGTPVVFANSLGTDFR---LWDKVIDLLPETGFRLIRFDKRGHGLS--SCPSGPFSM 71

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +A DA +LL+HL I     +G S+G  I   +    P  ++ ++L   GS + ++ + 
Sbjct: 72  DDLAMDAENLLDHLQIGSCIFVGLSIGGMIGQLLAHRQPDRIKGLVLSNTGSKMGEAAM- 130

Query: 142 DWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLS----MIRKPF----- 192
            WQ  I       I+ + + +  ++          D +  A CL+    ++R P      
Sbjct: 131 -WQDRISQIRAGGIESLADAILDRWFS-------ADFRQTAECLAWRHMLVRTPVEGYIG 182

Query: 193 -CQ--------DDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRDHLL 240
            CQ        D    + +PVL  +G  +DLA  P   +     +  S+Y+ I    HL 
Sbjct: 183 CCQAIAGTDLTDSTSGLGLPVL-GIGGSEDLASPPAMVRATADLVTGSRYVEISGAGHLP 241

Query: 241 AV 242
            V
Sbjct: 242 CV 243


>gi|297203723|ref|ZP_06921120.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Streptomyces
           sviceus ATCC 29083]
 gi|197711771|gb|EDY55805.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Streptomyces
           sviceus ATCC 29083]
          Length = 366

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 80/179 (44%), Gaps = 20/179 (11%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNL 65
           +R    Y+ AF   G+   P ++LIHG+  S  T      W +L+ D  +   VIA D L
Sbjct: 53  YRVVHGYRRAFRRAGE--GPPLVLIHGIGDSSAT------WAELIPDLARTHTVIAPDLL 104

Query: 66  GHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS 125
           GHG SDK     DY +   A     LL  LGI    ++G+S+G  +A      +P     
Sbjct: 105 GHGDSDKP--RADYSVAAYANGVRDLLTTLGIESATLVGHSLGGGVAMQFAYQFPERTER 162

Query: 126 VIL---GGVG----SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGND 177
           +IL   GGVG     VL    +     ++ S  LP +  +Q  L  +  K  D D G D
Sbjct: 163 LILVSAGGVGREVNPVLRLVSLPGAHLMLSSLRLPGM-RLQVGLAVRLMKLLDTDLGQD 220


>gi|145224533|ref|YP_001135211.1| alpha/beta hydrolase fold [Mycobacterium gilvum PYR-GCK]
 gi|315444864|ref|YP_004077743.1| hydrolase or acyltransferase of alpha/beta superfamily
           [Mycobacterium sp. Spyr1]
 gi|145217019|gb|ABP46423.1| alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]
 gi|315263167|gb|ADT99908.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Mycobacterium sp. Spyr1]
          Length = 340

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 61/127 (48%), Gaps = 8/127 (6%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Y+ A+   G    P ILLIHG+  +  T W     +Q    Q F VIA D LGHGKSDK 
Sbjct: 26  YRRAYRIAGS--GPAILLIHGIGDN-STTW---AGVQTQLAQRFTVIAPDLLGHGKSDKP 79

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
               DY +   A     LL  L I    V+G+S+G  +A      +P  V  +IL G G 
Sbjct: 80  --RADYSVAAYANGMRDLLSVLNIDSATVVGHSLGGGVAMQFAYQFPQLVDRLILVGAGG 137

Query: 134 VLYDSDV 140
           V  D ++
Sbjct: 138 VTKDVNI 144


>gi|300310635|ref|YP_003774727.1| 3-ketoadipate enol-lactone hydrolase [Herbaspirillum seropedicae
           SmR1]
 gi|300073420|gb|ADJ62819.1| 3-ketoadipate enol-lactone hydrolase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 261

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 107/230 (46%), Gaps = 31/230 (13%)

Query: 22  GDKDAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           GD   P ++L + L +S+ + W      W+Q      FRV+ +D  GHG+S+ +    + 
Sbjct: 17  GDASLPVLVLSNSLGTSL-SMWDPQMPQWLQ-----HFRVLRYDTRGHGQSEVT--PGEC 68

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +  + +D ++LL+HLGI++ H  G SMG      + + +P  +  +IL   G+ +  ++
Sbjct: 69  SIAQLGSDVIALLDHLGIAQAHFCGLSMGGSTFMWLAVHHPQRINKLILCNTGAKIGTAE 128

Query: 140 VVDWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPGNDLKALASCL------------ 185
              W S I++     +  +   +  ++   ++A   P   ++AL + L            
Sbjct: 129 A--WNSRIETVRREGLGAIAGAVVSRWLTPEYAQAHP-QQVQALTAMLLATPAEGYAAAC 185

Query: 186 SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLN 232
           + +R    ++ +  I  P LI  GS  D+   P   Q + + IP +QY+ 
Sbjct: 186 AAVRDHDLREAIAGIRAPTLIIAGS-GDVPTPPADAQFMRATIPGAQYVE 234


>gi|255034959|ref|YP_003085580.1| alpha/beta hydrolase fold protein [Dyadobacter fermentans DSM
           18053]
 gi|254947715|gb|ACT92415.1| alpha/beta hydrolase fold protein [Dyadobacter fermentans DSM
           18053]
          Length = 333

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 67/129 (51%), Gaps = 12/129 (9%)

Query: 5   VKFFRSWRKYQFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRV 59
           ++F     K + A+ DV     +   ++L+HG       N+  + W    + L ++GFRV
Sbjct: 44  LEFESQGEKLRMAYMDVRPARANGKAVMLLHG------KNFNGAYWEETAKALAEKGFRV 97

Query: 60  IAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
           +  D +G GKS K  +   Y    +AA+   +L+ LGI+K+ V+G+SMG  +A   VL Y
Sbjct: 98  VIPDQIGFGKSTKP-LHFQYSFHELAANTKKVLDKLGITKISVLGHSMGGMVATRFVLMY 156

Query: 120 PSYVRSVIL 128
           P  V   IL
Sbjct: 157 PEMVTKFIL 165


>gi|297200456|ref|ZP_06917853.1| hydrolase [Streptomyces sviceus ATCC 29083]
 gi|197709578|gb|EDY53612.1| hydrolase [Streptomyces sviceus ATCC 29083]
          Length = 311

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 106/242 (43%), Gaps = 30/242 (12%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           +K +P +LL+HGL     ++W  +  W+     + +R +A D  GHG+SDK       R 
Sbjct: 48  EKRSPGVLLLHGLMGRA-SHWASTARWLS----ERYRAVALDQRGHGQSDKPPRAAFTRD 102

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDV 140
            ++  DA + LE LG++   ++G++MGA  A  +    P  VR VI+  +  S L  +  
Sbjct: 103 AYVE-DAEAALEQLGLAPTVLIGHAMGALTAWQLAARRPDLVRGVIICDMRASALGAASQ 161

Query: 141 VDWQSLIDSFLLPSID---------------EVQNPLGKKFRKFADLDPGNDLKALASCL 185
            +W    +++ +P                  E  NP   +F      +  +  + +    
Sbjct: 162 REWGEWFEAWPVPFATLADVRKWFGEDDPWVERPNPARGEFYAEVMAESPDGWRPVFEPE 221

Query: 186 SMI--RKPFCQD----DLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDH 238
            M+  R+ +  D    +L ++  P L+  G   +L     QE++  +P  +Y  +    H
Sbjct: 222 QMLSSRETWVYDAHWEELTQVRCPALVVRGLDGELGRAEAQEMVRVLPRGEYAEVADAGH 281

Query: 239 LL 240
           L+
Sbjct: 282 LV 283


>gi|229490770|ref|ZP_04384605.1| hydrolase [Rhodococcus erythropolis SK121]
 gi|229322160|gb|EEN87946.1| hydrolase [Rhodococcus erythropolis SK121]
          Length = 327

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 73/154 (47%), Gaps = 17/154 (11%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDN 64
            FR+   Y+ AF   G+   P +LL+HG+  +  T      W +++    + + VIA D 
Sbjct: 2   MFRTIHGYRRAFRIAGE--GPAVLLLHGIGDNSST------WTEIIPHLAKKYTVIAPDL 53

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
           LGHG+SDK     DY +   A     LL  LGI  V V+G+S+G  +A      +P  V 
Sbjct: 54  LGHGRSDKP--RADYSVAAYANGMRDLLSTLGIEHVTVIGHSLGGGVAMQFSYQFPHMVD 111

Query: 125 SVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEV 158
            ++L   G V  D        L+    +P ++EV
Sbjct: 112 RLVLVSAGGVTKDV-----HPLLRLMSVPVVNEV 140


>gi|91787736|ref|YP_548688.1| 3-oxoadipate enol-lactonase [Polaromonas sp. JS666]
 gi|91696961|gb|ABE43790.1| 3-oxoadipate enol-lactonase [Polaromonas sp. JS666]
          Length = 260

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 103/242 (42%), Gaps = 32/242 (13%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           +   P ++L H L   ++   ++ G   LL  + + V+ +D+ GHG+S        Y L 
Sbjct: 11  EGQGPVVVLSHALGCDIR---MWDGVTALLKSR-YTVLRYDHRGHGQSQAP--AGPYSLD 64

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD 142
            +A DA  L+       VH +G SMG   A ++    P  V+S+++    S   D+    
Sbjct: 65  LLAEDAAGLIREQAAGPVHFVGLSMGGMTAQALAASQPQLVKSIVIANAASWYDDTARAL 124

Query: 143 WQSLIDSFLLPSIDEV-----QNPLGKKFRKFADLDPGN-----DLK----------ALA 182
           WQ+ + + L   +  +     Q     +FR  ADL  G      DL+            A
Sbjct: 125 WQARVQTVLAQGVAAIADGAMQRWFTPEFR--ADLAGGGAQRVADLRHQLENTDAAAYAA 182

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA--GSPQELMSFIPSSQYLNICRRDHLL 240
           SC ++    F   +  RI+ P L+  G++D+       Q +   IPS+Q L      HL 
Sbjct: 183 SCEAVASIDFRASN-RRIECPALVIAGTRDEATPLAMSQTIADSIPSAQ-LRTLEAAHLS 240

Query: 241 AV 242
           AV
Sbjct: 241 AV 242


>gi|146311519|ref|YP_001176593.1| alpha/beta hydrolase fold [Enterobacter sp. 638]
 gi|145318395|gb|ABP60542.1| alpha/beta hydrolase fold protein [Enterobacter sp. 638]
          Length = 248

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 58/105 (55%), Gaps = 2/105 (1%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P ++++HGL    Q  W+ +G++       FRV+  D +GHG SD+   ++ Y      
Sbjct: 18  GPLVIMLHGLLMDGQC-WVDNGFVSAFSPF-FRVVCPDLIGHGDSDRVDRQDFYTRENQV 75

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
              V L++ LG  K HVMGYS GA +A  ++  YP  + SV+LGG
Sbjct: 76  LTIVKLMDELGYDKAHVMGYSAGAWLAMGLLDSYPERLTSVVLGG 120


>gi|111020339|ref|YP_703311.1| hydrolase [Rhodococcus jostii RHA1]
 gi|110819869|gb|ABG95153.1| probable hydrolase [Rhodococcus jostii RHA1]
          Length = 259

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 100/221 (45%), Gaps = 26/221 (11%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           + P +LL+ G A++   +W    W ++  D    FR I  D  G G SDK   E  Y  +
Sbjct: 19  EGPPLLLLAGQANT--HHW----WDRVRADFDTHFRTITVDYRGTGASDKP--ETAYSTI 70

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-----GGVGSVLYD 137
             A D +S+L+ LG+ + HV G SMG R+A  + + +P  VR++IL     GG  +V   
Sbjct: 71  LFADDVISVLDSLGVGRAHVYGTSMGGRVAQWVAVRHPERVRALILGCTSPGGTHAVERS 130

Query: 138 SDVVD--WQSLIDSFLLPSIDEVQNP--LGKKFRKFADL-DPGNDLKALASCLSMIRKPF 192
            +V     QS  D      ++ +  P  L +    +  L DPG    A  + L       
Sbjct: 131 REVRASLAQSDPDRSRRALLELMYTPEWLSRNPGPYNTLGDPGMPAHAKLAHLRASNGHD 190

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQE----LMSFIPSSQ 229
             D L  I  P L+  G+ D L  SP +    L   IP+S+
Sbjct: 191 AWDALPSISAPTLVLHGTDDLL--SPADNAPLLAERIPNSR 229


>gi|3077808|dbj|BAA25795.1| esterase2 [Acetobacter pasteurianus]
          Length = 406

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           ++     DVG      I+L+HG    + +NWL +    L  D+  RVIAFD  GHG S K
Sbjct: 120 EHTLNVRDVGTHTGTPIMLVHGFGGDI-SNWLLT-QDALAADR--RVIAFDLPGHGASSK 175

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +       L F+A     LL+ L I K HV+G+S+G  IA +++  +P  V S+ L
Sbjct: 176 NV--GTGTLAFLAGVVSELLKTLKIEKAHVVGHSLGGGIALTLLRDHPDQVASLNL 229


>gi|108797383|ref|YP_637580.1| alpha/beta hydrolase fold [Mycobacterium sp. MCS]
 gi|119866467|ref|YP_936419.1| alpha/beta hydrolase fold [Mycobacterium sp. KMS]
 gi|126433004|ref|YP_001068695.1| alpha/beta hydrolase fold [Mycobacterium sp. JLS]
 gi|108767802|gb|ABG06524.1| alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]
 gi|119692556|gb|ABL89629.1| alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]
 gi|126232804|gb|ABN96204.1| alpha/beta hydrolase fold protein [Mycobacterium sp. JLS]
          Length = 291

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 70/136 (51%), Gaps = 16/136 (11%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRV 59
           MN+V++       + A+ D G  +   +LLIHG+A    T      W  +L    + +RV
Sbjct: 1   MNDVEYV-ELHGERVAYRDAGSGE--VLLLIHGMAGCSDT------WNAVLPRLAENYRV 51

Query: 60  IAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
           IA D LGHG+S K     DY L   AA    LL+ LG+ +  ++G S+G  +A   +  +
Sbjct: 52  IAPDLLGHGRSAKP--RTDYSLGAFAAGLRDLLDELGVDRATIVGQSLGGGVAMQFMYQH 109

Query: 120 PSYVRSVIL---GGVG 132
           P Y R +IL   GG+G
Sbjct: 110 PQYCRRLILISSGGLG 125


>gi|73538847|ref|YP_299214.1| 4-carboxymuconolactone decarboxylase / 3-oxoadipate enol-lactonase
           [Ralstonia eutropha JMP134]
 gi|72122184|gb|AAZ64370.1| 4-carboxymuconolactone decarboxylase / 3-oxoadipate enol-lactonase
           [Ralstonia eutropha JMP134]
          Length = 396

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 107/237 (45%), Gaps = 34/237 (14%)

Query: 18  FYDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ---GFRVIAFDNLGHGKSDKS 73
           +Y V G  +AP IL  + L +   T W      Q   D     FRV+ +D  GHG+S  +
Sbjct: 12  YYTVDGPDNAPAILFSNSLGTD-HTMW------QPQADALAGRFRVVRYDTRGHGRS--T 62

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
              + + +  +  DA+++LE LGI++    G SMG      + +  P     ++L    +
Sbjct: 63  APGDAFTMDQLGGDAIAILEALGIAQAVFCGVSMGGLTGMWLGVHAPERFPKIVLANTAA 122

Query: 134 VLYDSDVVDWQSLIDSFL--------LPSIDEVQNPLGKKFRKFADLDP------GNDLK 179
            + ++D   W S I+  L         PSI+    P G        +DP      G D +
Sbjct: 123 KIGNAD--GWNSRIEGVLRNGMRPMVAPSIERWFTP-GFAATASRAIDPLLTVLAGLDPR 179

Query: 180 ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ---ELMSFIPSSQYLNI 233
             A+  + +R    +D +  I VPVL+  GS DD + S Q   EL + IP ++++ +
Sbjct: 180 GYAANCAAVRDADFRDAVRTIRVPVLVIAGS-DDPSTSAQEGRELAAAIPDARFVEL 235


>gi|226491852|ref|NP_001152729.1| LOC100286370 [Zea mays]
 gi|195659405|gb|ACG49170.1| epoxide hydrolase 2 [Zea mays]
          Length = 320

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G +D P +LL+HG    +  +W     +  L  +GFR +A D  G+G S        Y +
Sbjct: 24  GPEDGPAVLLLHGF-PELWLSWRHQ--MAALAARGFRALAPDLRGYGDSSAPSDPAAYSI 80

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
             +  D V+LL+HL ++KV V G+  GA  A  + LF P  VR+ ++ GV
Sbjct: 81  FHIVGDVVALLDHLQLTKVFVAGHDWGAHAAWLLCLFRPDRVRAAVVLGV 130


>gi|251794408|ref|YP_003009139.1| alpha/beta hydrolase [Paenibacillus sp. JDR-2]
 gi|247542034|gb|ACS99052.1| alpha/beta hydrolase fold protein [Paenibacillus sp. JDR-2]
          Length = 277

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 112/273 (41%), Gaps = 30/273 (10%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
           V FF +    + AF   G    P ++L + +A+S+    ++ G I    +  FRV+ +D 
Sbjct: 16  VSFFTTGEGIRIAFRIDGAAGKPILMLANSIATSMN---MWDGQIARFTEH-FRVLRYDY 71

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVR 124
            GHG SD       Y +  M  D + LL+ L I +VH +G S+G  +   + +  P  + 
Sbjct: 72  RGHGDSDTP--AGPYSMDRMGRDVIELLDSLQIGRVHFLGLSLGGAVGQWLGIHAPERIS 129

Query: 125 SVILGGVGSVLYDSDVVDWQSLIDSFL----------------LPS-IDEVQNPLGKKFR 167
            ++L    S L  S+   W  LIDS L                 PS + E ++ +   FR
Sbjct: 130 RLVLSNTSSYLGPSE--QWNGLIDSVLQAENLNGFADMFINNWFPSPMIESESEIVAAFR 187

Query: 168 KFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIP 226
           +          + +    + IR    +     I  P L+  G  D +   S  EL++   
Sbjct: 188 QMV---LATRAEGIGGSWAAIRDMDLRRTAALISSPTLVIAGQHDTVTLPSHGELIAETV 244

Query: 227 SSQYLNICRRDHLLAVG-DKQFKQGVVNFYANE 258
               L I    HL  V     F++ V++F  +E
Sbjct: 245 PHAKLLILPAVHLPNVEFPDAFEKAVIDFLLSE 277


>gi|21224596|ref|NP_630375.1| epoxide hydrolase [Streptomyces coelicolor A3(2)]
 gi|13940314|emb|CAC37878.1| putative epoxide hydrolase [Streptomyces coelicolor A3(2)]
          Length = 286

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 3/107 (2%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
            G +D   +LL+HG   + + +W  +    LL   G R +A D  G+    +     DYR
Sbjct: 18  TGPEDGEPVLLLHGFPHN-KESWTETA--PLLHAAGLRTVAPDQRGYSPDARPAAVADYR 74

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           L  +AADA+ +L+ LG+S  HV+G+  GA +A  +   +P  VR++ 
Sbjct: 75  LPHLAADALGVLDALGVSSAHVVGHDWGAAVAWYLAARHPGRVRTLT 121


>gi|111221004|ref|YP_711798.1| putative hydrolase [Frankia alni ACN14a]
 gi|111148536|emb|CAJ60208.1| putative hydrolase [Frankia alni ACN14a]
          Length = 300

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 103/229 (44%), Gaps = 24/229 (10%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D+P ++++HG+     +++ FS     L D G  VI +D  GHG+S+++     YRL   
Sbjct: 25  DSPIVVMVHGMVMDNISSFYFS-LGTCLADAGCDVICYDLRGHGRSERT--PGGYRLADS 81

Query: 85  AADAVSLLEHLGISK-VHVMGYSMGARIACSMVLFYPSYVRSVIL-------GGVGSVLY 136
            AD   LL+ LG+ + VHV+G S GA +A +  L + + V S+ L        G+G  + 
Sbjct: 82  MADLAGLLDVLGVDRPVHVVGNSYGATLALAFGLEFTARVASLTLIEPPFLIEGLGEEMA 141

Query: 137 DSDVVDWQSLIDSFLLPSIDEVQ----NPLGKKFRKFADLDPGNDLKALASCLSMIRKP- 191
                  +SL    +  + DEV+    N  G+   K A       L        M+  P 
Sbjct: 142 -------RSLSQILVAMTDDEVEEWLDNGAGRAITK-ATRAAQRLLSDTTIATDMLATPA 193

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240
           F  + L  + +PVL   G   D+ G    L + +P    + +    H++
Sbjct: 194 FSAEALAALPIPVLAVYGENSDIIGQAAGLAALVPECTLIVLEHHTHMV 242


>gi|115396050|ref|XP_001213664.1| predicted protein [Aspergillus terreus NIH2624]
 gi|114193233|gb|EAU34933.1| predicted protein [Aspergillus terreus NIH2624]
          Length = 326

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 27/140 (19%)

Query: 11  WRKYQFAFYDVGDKDAPTI-------------------LLIHGLASSVQTNWLFSGWIQL 51
           W+K+  A+    D DAP++                   LLIHG     QT++ F   I+ 
Sbjct: 25  WKKHN-AWIKTTDDDAPSVRISYIDCAPSTSSLAKGVLLLIHGFP---QTSYQFRHVIRP 80

Query: 52  LCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLL-EHLGI-SKVHVMGYSMGA 109
           L D+GFRVIA D  G G+S  S+  +D+R   MA D   L+ +HL I S ++++G+ +G 
Sbjct: 81  LADEGFRVIAPDYRGAGQS--SHPSHDFRKSTMARDLFVLIHDHLHIESPIYLVGHDIGG 138

Query: 110 RIACSMVLFYPSYVRSVILG 129
            IA + V  YP +V  +I G
Sbjct: 139 MIAHAYVSMYPQHVACIIWG 158


>gi|229008409|ref|ZP_04165871.1| Hydrolase [Bacillus mycoides Rock1-4]
 gi|228752867|gb|EEM02434.1| Hydrolase [Bacillus mycoides Rock1-4]
          Length = 264

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 92/215 (42%), Gaps = 19/215 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y V  K  P + +   + + V   +   G       Q F+VIAFD  GHG+S  S    
Sbjct: 12  YYIVKGKGVPIVFIHPPVLTCVNFEYQIEGL-----SQNFKVIAFDIRGHGRSQYSKQPI 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y L+  A D   LL+HL I K  V GYS G+ I    +L +       IL G  S + D
Sbjct: 67  TYPLI--AEDIRCLLDHLEIKKAFVCGYSTGSSIVLEFLLAFAERALGGILIGGMSEVRD 124

Query: 138 SDVVDWQSL--------IDSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALA-SCLSM 187
             + +  SL          SFL  SI    +   K FRK F +   GN        C S+
Sbjct: 125 GYLKNKISLGVKLAKAGAVSFLAWSISWSNSNTHKLFRKMFKEARKGNGKNIWQYYCYSL 184

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM 222
                C + L  I +PVL+  G +D +  S  +L+
Sbjct: 185 HYD--CTNQLRNIQLPVLLVYGKKDKVFYSHAKLL 217


>gi|84499435|ref|ZP_00997723.1| probable hydrolase [Oceanicola batsensis HTCC2597]
 gi|84392579|gb|EAQ04790.1| probable hydrolase [Oceanicola batsensis HTCC2597]
          Length = 296

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 72/153 (47%), Gaps = 26/153 (16%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN---------LGHG 68
           + ++G +D   IL+I G+ +   T W  + ++ LL  +G+RVI  DN           HG
Sbjct: 13  YEELGPEDGKPILMISGVGTQ-STRWK-ADFVDLLVARGYRVIKMDNRDIGLSQKFTDHG 70

Query: 69  KSDKSYIEND----------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
             D   +  D          Y L  MAAD  +LL+HLGI K HV G+SMG  I   M + 
Sbjct: 71  LPDFKRVIADKAAGKTPDIPYTLSDMAADGAALLDHLGIDKAHVCGFSMGGMIVQLMAIE 130

Query: 119 YPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFL 151
           +P  V S     + SV+ +S   D     D+ +
Sbjct: 131 HPDKVLS-----MSSVMSNSGNPDLPKPTDAAM 158


>gi|256784202|ref|ZP_05522633.1| epoxide hydrolase [Streptomyces lividans TK24]
 gi|289768086|ref|ZP_06527464.1| epoxide hydrolase [Streptomyces lividans TK24]
 gi|289698285|gb|EFD65714.1| epoxide hydrolase [Streptomyces lividans TK24]
          Length = 286

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 3/107 (2%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
            G +D   +LL+HG   + + +W  +    LL   G R +A D  G+    +     DYR
Sbjct: 18  AGPEDGEPVLLLHGFPHN-KESWTETA--PLLHAAGLRTVAPDQRGYSPDARPAAVADYR 74

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           L  +AADA+ +L+ LG+S  HV+G+  GA +A  +   +P  VR++ 
Sbjct: 75  LPHLAADALGVLDALGVSSAHVVGHDWGAAVAWYLAARHPGRVRTLT 121


>gi|258541693|ref|YP_003187126.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256632771|dbj|BAH98746.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635828|dbj|BAI01797.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638883|dbj|BAI04845.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641937|dbj|BAI07892.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-22]
 gi|256644992|dbj|BAI10940.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648047|dbj|BAI13988.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651100|dbj|BAI17034.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654091|dbj|BAI20018.1| esterase/lipase [Acetobacter pasteurianus IFO 3283-12]
          Length = 388

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           ++     DVG      I+L+HG    + +NWL +    L  D+  RVIAFD  GHG S K
Sbjct: 122 EHTLNVRDVGTHTGTPIVLVHGFGGDI-SNWLLT-QDALAADR--RVIAFDLPGHGASSK 177

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +       L F+A     LL+ L I K HV+G+S+G  IA +++  +P  V S+ L
Sbjct: 178 NV--GTGTLAFLAGVVSELLKTLKIEKAHVVGHSLGGGIALTLLRDHPDQVASLNL 231


>gi|148658204|ref|YP_001278409.1| alpha/beta hydrolase fold protein [Roseiflexus sp. RS-1]
 gi|148570314|gb|ABQ92459.1| alpha/beta hydrolase fold [Roseiflexus sp. RS-1]
          Length = 280

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSD 71
           Y       GD     ++L+HG   S ++      W ++       FRVI  D  GHG++ 
Sbjct: 22  YHVTETGAGDP----LVLLHGFTGSSES------WAEVTDQLSHRFRVIRIDLPGHGRTP 71

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
                    L  +A D V+ L  LG +  H++GYSMGAR+A  + L YP  VR++IL
Sbjct: 72  APPDPARCTLPLVAGDIVARLRDLGATPAHLVGYSMGARLALGIALLYPYAVRTLIL 128


>gi|30263120|ref|NP_845497.1| alpha/beta fold family hydrolase [Bacillus anthracis str. Ames]
 gi|47528479|ref|YP_019828.1| alpha/beta fold family hydrolase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49185968|ref|YP_029220.1| alpha/beta fold family hydrolase [Bacillus anthracis str. Sterne]
 gi|165868380|ref|ZP_02213040.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0488]
 gi|167632574|ref|ZP_02390901.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0442]
 gi|167637144|ref|ZP_02395424.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0193]
 gi|170685085|ref|ZP_02876310.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0465]
 gi|170705180|ref|ZP_02895645.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0389]
 gi|177649900|ref|ZP_02932901.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0174]
 gi|190564966|ref|ZP_03017887.1| hydrolase, alpha/beta fold family [Bacillus anthracis
           Tsiankovskii-I]
 gi|227814017|ref|YP_002814026.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. CDC 684]
 gi|229604841|ref|YP_002867389.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0248]
 gi|254685719|ref|ZP_05149578.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254723129|ref|ZP_05184917.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           A1055]
 gi|254738190|ref|ZP_05195893.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742640|ref|ZP_05200325.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Kruger B]
 gi|254752504|ref|ZP_05204540.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Vollum]
 gi|254761020|ref|ZP_05213044.1| hydrolase, alpha/beta fold family protein [Bacillus anthracis str.
           Australia 94]
 gi|30257754|gb|AAP26983.1| alpha/beta hydrolase family protein [Bacillus anthracis str. Ames]
 gi|47503627|gb|AAT32303.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49179895|gb|AAT55271.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. Sterne]
 gi|164715106|gb|EDR20623.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0488]
 gi|167514651|gb|EDR90017.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0193]
 gi|167532872|gb|EDR95508.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0442]
 gi|170130035|gb|EDS98897.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0389]
 gi|170671345|gb|EDT22083.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0465]
 gi|172083852|gb|EDT68911.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0174]
 gi|190564283|gb|EDV18247.1| hydrolase, alpha/beta fold family [Bacillus anthracis
           Tsiankovskii-I]
 gi|227004785|gb|ACP14528.1| alpha/beta hydrolase family protein [Bacillus anthracis str. CDC
           684]
 gi|229269249|gb|ACQ50886.1| hydrolase, alpha/beta fold family [Bacillus anthracis str. A0248]
          Length = 294

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +YQ +  + GDK  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYQASVCEWGDKSNPQIICFHGLGS---TKLSFIEMAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFETDEDYGASHLINWVVALLEHIGKETFHLLAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|167950237|ref|ZP_02537311.1| alpha/beta hydrolase fold protein [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 296

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  + + GD  AP ++L+HGL  S   NWL    I       FR+I  D   HG+S  + 
Sbjct: 38  QLHYREAGDPTAPPLILLHGLFGS-SANWLG---IARRLAADFRLIIPDLRNHGRSAHA- 92

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
           +  DY +  M  D ++L++ LGIS  H+ G+SMG ++A  + L +P  +  +++  +  V
Sbjct: 93  MPMDYPV--MVEDLLALMDQLGISAAHLCGHSMGGKVAMWLALQHPERLERLVVADIAPV 150

Query: 135 LY 136
            Y
Sbjct: 151 SY 152


>gi|300788262|ref|YP_003768553.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
 gi|299797776|gb|ADJ48151.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
          Length = 284

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 111/247 (44%), Gaps = 46/247 (18%)

Query: 16  FAFYDVGDKDA-PTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSD 71
           FA+ ++G K   P + L H LA+      +   W   + D      RVIAFDN G G S 
Sbjct: 26  FAYRELGPKTGVPVVFLTH-LAA------VLDNWDPRVVDGIAARHRVIAFDNRGVGAST 78

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            +  ++   +  MAADAV+ +  LG+ KV ++G+SMG  IA  +V   P  VR +I+ G 
Sbjct: 79  GTTPKS---IQAMAADAVTFIRALGLPKVDLLGFSMGGMIAQVIVQTEPELVRKLIVAGT 135

Query: 132 GSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIR-- 189
           G    +  + D   + +   + ++  +Q+P  K+F  F      N  +A    L+ ++  
Sbjct: 136 GPAGGEG-IKDVTRISNLDTVRALLTLQDP--KQFLFFTRTS--NGKRAGQEFLARLKER 190

Query: 190 -----KPFCQD------------------DLYRIDVPVLIAVGSQDDL--AGSPQELMSF 224
                KP                      DL  I  PVL+A G  D +   G+ ++L S 
Sbjct: 191 KDNRDKPIAPRAYVAQLKAIHRWGLEKPADLSGIRQPVLVANGDHDRMVPTGNTRDLASR 250

Query: 225 IPSSQYL 231
           +P S+ +
Sbjct: 251 LPDSELV 257


>gi|229489193|ref|ZP_04383059.1| 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone
           decarboxylase [Rhodococcus erythropolis SK121]
 gi|229324697|gb|EEN90452.1| 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone
           decarboxylase [Rhodococcus erythropolis SK121]
          Length = 393

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 99/224 (44%), Gaps = 29/224 (12%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F   G+ DAP ++L+  L S +    ++   I  L ++ +RVIA D+ GHGKS       
Sbjct: 7   FQQTGNLDAPAVVLLGSLGSDLS---MWQPQIHALSNR-YRVIAVDHRGHGKS--PVPAG 60

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y +  +A D ++LL+ L +  VH++G S+G  ++  +   +P+ V ++ L     +   
Sbjct: 61  PYSIADLAGDVIALLDSLELESVHLVGLSLGGAVSQWIAAHHPTRVETLTL-----MCTS 115

Query: 138 SDVVDWQSLIDSFLLPSIDEVQN----PLGKKFRK-FADLDP-----------GNDLKAL 181
           S     Q  ID       D + +     +G+ F    AD DP               +  
Sbjct: 116 SQFAPAQPWIDRARAVRADGIASIAAAVVGRWFTPGLADNDPELVARHVAMVEATPDEGY 175

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFI 225
           A+C   +     ++DL RI  P L+  G QD    +P   +S I
Sbjct: 176 AACCEALSTWDGRNDLARIVAPTLLIAGEQDP--ATPPATLSAI 217


>gi|197122029|ref|YP_002133980.1| alpha/beta hydrolase fold [Anaeromyxobacter sp. K]
 gi|196171878|gb|ACG72851.1| alpha/beta hydrolase fold [Anaeromyxobacter sp. K]
          Length = 284

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 107/234 (45%), Gaps = 24/234 (10%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +  +       P ++L+HG  SS+ T+  F+  +  L     RVIAFD  GHG++     
Sbjct: 46  YEIHGPAGAKGPPLVLLHGGGSSIDTS--FASLLPALARH-RRVIAFDQQGHGRT-ADLP 101

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
           +  +     A DA +LL HLG+++  ++G+S G  IA  + + +P+ VR ++   V S L
Sbjct: 102 DRPFTFEQSADDAAALLRHLGVARADLLGFSNGGTIALRVAVRHPALVRRLV---VASTL 158

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIR----KP 191
              D +  Q+  ++     ++++   L + +   A   P  D  A     S  R    + 
Sbjct: 159 VRRDGLAPQAW-EAIRRGRLEDMPVELRQAYLAVA---PHPDQLASFHAKSARRMLEFRD 214

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLAGS---------PQELMSFIPSSQYLNICRR 236
           +   ++  I VPVL+  G +D +            P   ++ +P++ +  + RR
Sbjct: 215 WPDAEVRSITVPVLVVAGDRDAVLPEHAVALTRMLPDARLAVLPATDHDGVVRR 268


>gi|118478470|ref|YP_895621.1| alpha/beta fold family hydrolase [Bacillus thuringiensis str. Al
           Hakam]
 gi|196042815|ref|ZP_03110054.1| hydrolase, alpha/beta fold family [Bacillus cereus 03BB108]
 gi|229185381|ref|ZP_04312564.1| hypothetical protein bcere0004_29350 [Bacillus cereus BGSC 6E1]
 gi|118417695|gb|ABK86114.1| hydrolase, alpha/beta fold family [Bacillus thuringiensis str. Al
           Hakam]
 gi|196026299|gb|EDX64967.1| hydrolase, alpha/beta fold family [Bacillus cereus 03BB108]
 gi|228598114|gb|EEK55751.1| hypothetical protein bcere0004_29350 [Bacillus cereus BGSC 6E1]
          Length = 294

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +YQ +  + GDK  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYQASVCEWGDKSNPQIICFHGLGS---TKLSFIEMAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFEKDEDYGASHLTNWVVALLEHIGKETFHIVAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|270262046|ref|ZP_06190318.1| hypothetical protein SOD_b02530 [Serratia odorifera 4Rx13]
 gi|270043922|gb|EFA17014.1| hypothetical protein SOD_b02530 [Serratia odorifera 4Rx13]
          Length = 301

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 64/132 (48%), Gaps = 21/132 (15%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY- 74
            A+ D G+   P +LLI G+ +  Q       + + L D+GFRVI FDN   G S K+  
Sbjct: 18  IAYEDWGNIAHPPLLLIMGIGA--QMLLWPDDFCRELVDKGFRVIRFDNRDVGLSGKTQG 75

Query: 75  ------------------IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                              +  Y L  MA DAV LL+HL I++ HV+G SMG  IA  + 
Sbjct: 76  KRLQPLWLLILRAQLGWQTQVPYSLEDMAQDAVHLLDHLQIAQAHVLGASMGGMIALVLA 135

Query: 117 LFYPSYVRSVIL 128
             YP  V+S+ +
Sbjct: 136 AEYPQRVKSLTI 147


>gi|311109113|ref|YP_003981966.1| 3-oxoadipate enol-lactonase 2 [Achromobacter xylosoxidans A8]
 gi|310763802|gb|ADP19251.1| 3-oxoadipate enol-lactonase 2 [Achromobacter xylosoxidans A8]
          Length = 259

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 101/231 (43%), Gaps = 31/231 (13%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSYIENDY 79
           G  DAP ++L + L +          W + + +  + FRV+ +D  GHGKS  S  E +Y
Sbjct: 17  GPADAPVLVLSNSLGTCSDM------WARQIPELSKHFRVLRYDTRGHGKS--SIPEGEY 68

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
               +  D   LL HL I + H  G SMG      + L  P  +  +IL    + +  ++
Sbjct: 69  SFEQLGNDVAELLAHLNIKRAHFCGLSMGGPTGLWLALARPELLDKLILCNTAARIGSAE 128

Query: 140 VVDWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPG------------NDLKALASCL 185
              W + I +    +++++   L +++    +   +PG             D     +C 
Sbjct: 129 --GWSARIAAVAEQTLEKMAPTLVERWLTDSYRAAEPGLTQVLIDMLRRTPDAGYSGNCA 186

Query: 186 SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNI 233
           ++    F ++ +  I  P L+ + S  DLA +P   QEL + IP ++Y  +
Sbjct: 187 ALRDADF-REQVASIKAPTLV-ISSTHDLAATPAQGQELAAAIPGARYFEM 235


>gi|75910516|ref|YP_324812.1| alpha/beta hydrolase fold protein [Anabaena variabilis ATCC 29413]
 gi|75704241|gb|ABA23917.1| Alpha/beta hydrolase fold protein [Anabaena variabilis ATCC 29413]
          Length = 277

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
             YQF +    + D P ILL+HG   ++     F   I+LL D  F  +  D  GHGK+ 
Sbjct: 4   ENYQFNYSLTSNTDKPVILLLHGFMGNIDE---FDAAIELLGDD-FSYLKLDLPGHGKTQ 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
               +  Y +   A   ++LL+ L ISK  ++GYSMG R+   + L +P     V+L
Sbjct: 60  VFGGDEYYSMANTAQGLINLLDKLEISKCFLVGYSMGGRLGLYLALHFPERFYQVVL 116


>gi|120403895|ref|YP_953724.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119956713|gb|ABM13718.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
          Length = 295

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 16/143 (11%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQG--FR 58
           M ++VK+       + A+ + G    P +LLIHG+  S  T      W  LL      +R
Sbjct: 1   MHDDVKYL-DLHGDRVAYREAGQ--GPAVLLIHGMGGSSLT------WKALLPHLATRYR 51

Query: 59  VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
           VIA D LGHG+SDK     DY L   A     LL+ LGI++V ++G+S+G  +A   V  
Sbjct: 52  VIAPDLLGHGQSDKP--RGDYSLGAFAVWLRDLLDLLGIARVTLVGHSLGGGVAMQFVHQ 109

Query: 119 YPSYVRSVIL---GGVGSVLYDS 138
           +P Y   ++L   GG+G  L  S
Sbjct: 110 HPDYCERLVLISSGGLGPELGRS 132


>gi|42782256|ref|NP_979503.1| alpha/beta fold family hydrolase [Bacillus cereus ATCC 10987]
 gi|42738181|gb|AAS42111.1| hydrolase, alpha/beta fold family [Bacillus cereus ATCC 10987]
          Length = 294

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +Y+ +  + GDK  P I+  HGL S   T   F    +LL D  + +++FD  G
Sbjct: 4   FFVEFGEYEASVCEWGDKSNPQIICFHGLGS---TKLSFIEVAELLKD-SYHIVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTQNFEKDEDYGASHLTNWVVALLEHIGKETFHIVAHSWGASVALHYAAECPEKVNKI 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|126433583|ref|YP_001069274.1| alpha/beta hydrolase fold [Mycobacterium sp. JLS]
 gi|126233383|gb|ABN96783.1| alpha/beta hydrolase fold protein [Mycobacterium sp. JLS]
          Length = 302

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 60/123 (48%), Gaps = 22/123 (17%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG- 68
           S  K Q  + D+GD + P +LLI GL +  Q  +    + + L DQG RVI +DN   G 
Sbjct: 10  SGEKVQIHYEDMGDPNHPAVLLIMGLGA--QLTFWREDFCRKLVDQGLRVIRYDNRDVGL 67

Query: 69  -------KSDKSYIEND------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGA 109
                  ++  S I N             Y L  MA DA +LL+HLGI   HV+G SMG 
Sbjct: 68  STYFDGQRTKGSQIGNMARSLVGRPSPALYTLEDMADDAAALLDHLGIDSAHVVGGSMGG 127

Query: 110 RIA 112
            IA
Sbjct: 128 MIA 130


>gi|15230367|ref|NP_190669.1| epoxide hydrolase, putative [Arabidopsis thaliana]
 gi|13937213|gb|AAK50099.1|AF372961_1 AT3g51000/F24M12_40 [Arabidopsis thaliana]
 gi|6562252|emb|CAB62622.1| epoxide hydrolase-like protein [Arabidopsis thaliana]
 gi|18491129|gb|AAL69533.1| AT3g51000/F24M12_40 [Arabidopsis thaliana]
          Length = 323

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           GD++ P +LL+HG     +T + +   I  L   G+ V+A D  G+G SD       Y +
Sbjct: 23  GDEEGPLVLLLHGFP---ETWYSWRHQIDFLSSHGYHVVAPDLRGYGDSDSLPSHESYTV 79

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
             + AD + LL+H G ++  V G+  GA I   + LF P  V+  I
Sbjct: 80  SHLVADVIGLLDHYGTTQAFVAGHDWGAIIGWCLCLFRPDRVKGFI 125


>gi|75832164|ref|NP_001028817.1| epoxide hydrolase 2 [Gallus gallus]
 gi|71564542|gb|AAZ38461.1| soluble epoxide hydrolase [Gallus gallus]
          Length = 562

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 107/254 (42%), Gaps = 40/254 (15%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  F ++G    P I L HG   S   +W +   I  L D GFRVIA +  G+G+S    
Sbjct: 249 QLHFVEMGH--GPAICLCHGFPES-WLSWRYQ--IPALADAGFRVIALEMKGYGESTAPP 303

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
              +Y    +  D    L+ LGI +   +G+  G  +  +M LFYP  VR+V    + + 
Sbjct: 304 EIEEYSQEQICKDLTIFLDKLGIPQAVFIGHDWGGAVVWNMALFYPERVRAV--ASLNTP 361

Query: 135 LYDSD-VVDWQSLIDSFLL---------PSIDEVQNPLGKKFRKFADLDPGNDLKALASC 184
              +D  VD    + SF +         P + E +           + D G  LKAL   
Sbjct: 362 YRPADPTVDIVETMKSFPMFDYQFYFQEPGVAEAE----------LEKDIGRTLKAL--- 408

Query: 185 LSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDHLLAVG 243
              IR    +D L+   VP L+ V  +   L G P++    IP S  L+     + +   
Sbjct: 409 ---IRSTRPEDRLH--SVPGLLGVQERGGLLVGFPED----IPESLILHGAELQYYIERF 459

Query: 244 DKQFKQGVVNFYAN 257
            +   +G +N+Y N
Sbjct: 460 QRSGFRGPLNWYRN 473


>gi|330810062|ref|YP_004354524.1| Dihydrolipoyllysine-residue acetyltransferase, component of acetoin
           cleaving system [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378170|gb|AEA69520.1| Dihydrolipoyllysine-residue acetyltransferase, component of acetoin
           cleaving system [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 370

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +++ G+   P +LL+HG    +  NWLF+         G RVIA D  GHG+S K+    
Sbjct: 125 YFERGEGGTP-LLLVHGFGGDL-NNWLFN---HEALAAGRRVIALDLPGHGESSKTLQRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D  L  ++   ++LL+HL I+  H++G+SMG  ++ +     P  VRS+ L G
Sbjct: 180 D--LDELSGVVLALLDHLDINAAHLVGHSMGGAVSLNAARLMPQRVRSLTLIG 230


>gi|225865113|ref|YP_002750491.1| hydrolase, alpha/beta fold family [Bacillus cereus 03BB102]
 gi|225786041|gb|ACO26258.1| alpha/beta hydrolase family protein [Bacillus cereus 03BB102]
          Length = 294

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +YQ +  + GDK  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYQASVCEWGDKSNPQIICFHGLGS---TKLSFIEMAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFEKDEDYGASHLTNWVVALLEHIGKETFHIVAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|120401141|ref|YP_950970.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119953959|gb|ABM10964.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
          Length = 310

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (51%), Gaps = 16/122 (13%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS-- 70
           +   A+   G    P  +LI G+A+ +  NW    +I+ L D+G +VI FDN   G+S  
Sbjct: 14  RLDIAYRRHGHSGDPAAVLIMGIAAQL-VNWPPE-FIRALTDRGLQVIVFDNRDTGRSTH 71

Query: 71  ------DKSYIEN------DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
                 D S ++        Y L  MAAD V L++HLGI   H++G SMG  IA ++ + 
Sbjct: 72  LDSAPADLSAVQAGDLTSVSYTLSDMAADTVGLMDHLGIRAAHLVGASMGGAIAQTIAIE 131

Query: 119 YP 120
           +P
Sbjct: 132 HP 133


>gi|52142353|ref|YP_084477.1| hydrolase [Bacillus cereus E33L]
 gi|51975822|gb|AAU17372.1| possible hydrolase [Bacillus cereus E33L]
          Length = 294

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 62/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +Y+ +  + GDK  P I+  HGL S   T   F    + L D+ + +++FD  G
Sbjct: 4   FFVEFGEYKASVCEWGDKSNPQIICFHGLGS---TKLSFIEIAEFLKDK-YHIVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A   V   P  V  +
Sbjct: 60  HGKTPNFEKDEDYGAAHLTNWVVALLEHIGKETFHIVAHSWGASVALHYVAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|154247964|ref|YP_001418922.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Xanthobacter autotrophicus Py2]
 gi|154162049|gb|ABS69265.1| alpha/beta hydrolase fold [Xanthobacter autotrophicus Py2]
          Length = 372

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 108/228 (47%), Gaps = 33/228 (14%)

Query: 9   RSWRKYQFA--------FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
            S  KY+FA        +   GD  A T++LIHG    +  NWLF+  I  L      V 
Sbjct: 109 ESAPKYEFADTPFGRLRYARRGDG-ARTVVLIHGFGGDLD-NWLFN--IDALAGSAT-VY 163

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           A D  GHG+SDK+    +  L +++   ++ ++  GI K H++G+SMG  +A    L  P
Sbjct: 164 ALDLPGHGQSDKAI--GEASLGWLSGAVLAFMDQTGIEKAHLVGHSMGGAVAMRTALDQP 221

Query: 121 SYVRSVIL---GGVGSVL---YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFR------- 167
             V S+ L    G+G+ +   Y    V   S  D  + P ++++ +  G   R       
Sbjct: 222 GRVASLGLIGSAGLGAEINSGYTDGFVAGSSRRD--MKPVLEQLFHDPGTVTRQLVEDIL 279

Query: 168 KFADLDPGND-LKALASCL--SMIRKPFCQDDLYRIDVPVLIAVGSQD 212
           K+  LD  +D L+ALA+ L  +  +     + L   DVPVL+  G+ D
Sbjct: 280 KYKRLDGVDDALRALAANLFPASRQSEILAEKLKAADVPVLVIFGASD 327


>gi|255535736|ref|YP_003096107.1| alpha/beta hydrolase fold protein [Flavobacteriaceae bacterium
           3519-10]
 gi|255341932|gb|ACU08045.1| alpha/beta hydrolase fold protein [Flavobacteriaceae bacterium
           3519-10]
          Length = 332

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 112/263 (42%), Gaps = 44/263 (16%)

Query: 15  QFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           + AF DV     +  TI+L+HG   +    + F    ++L  +GFRV+  D +G GKS K
Sbjct: 54  KMAFMDVKPAKANGNTIVLLHGKNFN---GYYFEQTAKVLQAEGFRVVIPDQVGFGKSSK 110

Query: 73  SYIENDYRLVF--MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
                 Y+  F  +A +   +L+ L I +  +MG+SMG  +A  M + YP  V  +IL  
Sbjct: 111 P---KQYQFSFEQLAENTKLILDDLKIDRFIIMGHSMGGMLATKMAVMYPQNVEKLILTN 167

Query: 131 -VG-------------SVLYDSDVVDWQSLIDSFLL---------PSIDEVQNPL-GKKF 166
            +G               LY S++ +  S    + L         P  D+  N L G   
Sbjct: 168 PIGLEDYRNFSPYQNIDKLYTSELKNTYSSYRDYQLKFYYDGKWKPEYDKWLNLLAGWTV 227

Query: 167 RKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL----AGSPQELM 222
            K   +   N   AL S   MI      DD   I VP L+ +G++D      A +P+EL 
Sbjct: 228 HKDFPITAWN--AALTS--DMIYTQPVVDDFQNIKVPTLLIIGTRDRTAIGKANAPKELQ 283

Query: 223 SFIPSSQYLNICRRDHLLAVGDK 245
             +    Y N+ +  H    G K
Sbjct: 284 PLM--GLYQNLGKETHRKIKGSK 304


>gi|16800850|ref|NP_471118.1| hypothetical protein lin1782 [Listeria innocua Clip11262]
 gi|16414269|emb|CAC97013.1| lin1782 [Listeria innocua Clip11262]
          Length = 275

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 103/241 (42%), Gaps = 36/241 (14%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P +L++HG   S +T   F   I LL +  F +IA D LGHGK+        Y +  +
Sbjct: 17  EKPVLLMLHGFTGSSET---FQDSISLLKEH-FSIIAPDLLGHGKTSCPKEVARYSIENI 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD------- 137
             D  S+L  L I    V+GYSMG R+A +    Y   VR ++L      L D       
Sbjct: 73  CDDLASILHQLKIDSCFVLGYSMGGRVATAFAAKYKELVRGLVLVSSSPGLRDEKARASR 132

Query: 138 -------SDVVD----------WQSLIDSFLLPSIDEVQNPLGKKFR--KFADLDPGNDL 178
                  +D +D          W++L    L  S   +   L K+ R  + A  +P    
Sbjct: 133 ISADNRLADTLDADGIEPFVAYWENLA---LFASQKNLPFALKKRIRLERLAQ-NPHGLA 188

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRD 237
           K+L   +   ++P   ++L     PVL+  G+ D+      +E+   +P+S ++ +    
Sbjct: 189 KSLRG-MGTGKQPSYWENLADFTFPVLLITGNLDEKFEKIAREMKQLLPNSTHVTVQEAG 247

Query: 238 H 238
           H
Sbjct: 248 H 248


>gi|119487538|ref|ZP_01621148.1| Alpha/beta hydrolase fold protein [Lyngbya sp. PCC 8106]
 gi|119455707|gb|EAW36843.1| Alpha/beta hydrolase fold protein [Lyngbya sp. PCC 8106]
          Length = 264

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 4/115 (3%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Y F ++   +   P +L +HG   + +    F+  I LL ++ F  +A D  GHG +  +
Sbjct: 5   YHFHYFRTENTSLPILLFLHGFMGNGKD---FNAVISLLSEK-FNCLAVDLPGHGHTQVN 60

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             +  Y L   A   ++ LE L I +  ++GYSMG R+A  + L YP Y + V+L
Sbjct: 61  AGDEFYSLANTANGLINWLEELKIKRCFLVGYSMGGRLALYLALHYPQYFQKVVL 115


>gi|103485948|ref|YP_615509.1| alpha/beta hydrolase fold [Sphingopyxis alaskensis RB2256]
 gi|98976025|gb|ABF52176.1| alpha/beta hydrolase fold [Sphingopyxis alaskensis RB2256]
          Length = 250

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 115/266 (43%), Gaps = 31/266 (11%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           M  + +FF +    + A+ + G+     ++L+HGL SS + NW+  G    +  +G+RVI
Sbjct: 1   MTIDPQFFEARDGVRLAWRETGEGR--PVVLLHGLFSSGEVNWIKFGTAARIAAEGYRVI 58

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
             D   HG SD  +    Y    +  D   L+ HLG+    + G+S+GAR          
Sbjct: 59  MPDLRVHGSSDAPHDAQHYPPDVLVRDVEDLVAHLGLVDFDLGGFSLGAR---------- 108

Query: 121 SYVRSVILG-----GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-------LGKKFRK 168
           + VR+V+ G      +   +  + +  WQ    +F   +I E +         L  +F K
Sbjct: 109 TSVRAVVAGMKPRRLILGGMGLAGLAGWQRR-GAFFRRAIAEYETAKRGDDTWLSIQFMK 167

Query: 169 FADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSS 228
              +D    + A     S    P   + L  + +PVL+  G QD   GS +EL++ +  +
Sbjct: 168 TMKVD---RIAAGHLLESFTDTP--PEALAALTMPVLVVCGEQDQDNGSAEELVAVLADA 222

Query: 229 QYLNICRRDHLLAVGDKQFKQGVVNF 254
           +   I    H+ +V +    + +  F
Sbjct: 223 RLATIP-GTHMSSVTEPALGEAIAAF 247


>gi|138896409|ref|YP_001126862.1| menaquinone biosynthesis related protein [Geobacillus
           thermodenitrificans NG80-2]
 gi|196250037|ref|ZP_03148732.1| alpha/beta hydrolase fold protein [Geobacillus sp. G11MC16]
 gi|134267922|gb|ABO68117.1| Menaquinone biosynthesis related protein [Geobacillus
           thermodenitrificans NG80-2]
 gi|196210551|gb|EDY05315.1| alpha/beta hydrolase fold protein [Geobacillus sp. G11MC16]
          Length = 266

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 110/257 (42%), Gaps = 41/257 (15%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQG-FRVIAFDNLGHGKSD 71
           +Y    Y  G+     +LL+HG   S  T      W  LL   G FR+IA D +GHG+++
Sbjct: 7   RYHVEQYGEGE----PLLLLHGFTGSADT------WRPLLRSWGDFRLIAVDLIGHGRTE 56

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
                  Y++   AAD  +LL+ L I K +V+GYSMG R+A S  ++YP  +R ++L   
Sbjct: 57  APKSVERYQMKQAAADLAALLDALRIEKANVLGYSMGGRLALSFAIWYPHRLRRLVLESS 116

Query: 132 GSVLYDSDVVDWQSLIDSFLLPSIDE-------------------------VQNPLGKKF 166
              L        +   D  L   I+                          VQ+ + ++ 
Sbjct: 117 SPGLKTEAERRARQEADEALAQMIERNGVRAFVDYWEQLPLFATQKKLPKPVQDAIRRER 176

Query: 167 RKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFI 225
            +  +    N L+ + + +    +P   D L  + VPVL+  G  D+       ++   +
Sbjct: 177 LRHTERGLANSLRGMGTGV----QPSWWDRLGEVKVPVLLLCGEYDEKFCRIAADMHERL 232

Query: 226 PSSQYLNICRRDHLLAV 242
           P+S+ + + +  H + V
Sbjct: 233 PNSELVCVQKVGHAIHV 249


>gi|109899660|ref|YP_662915.1| alpha/beta hydrolase fold [Pseudoalteromonas atlantica T6c]
 gi|109701941|gb|ABG41861.1| alpha/beta hydrolase fold familiy [Pseudoalteromonas atlantica T6c]
          Length = 313

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 101/244 (41%), Gaps = 51/244 (20%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD--- 71
           + AF   G  + P+I+LI GL +  Q  +   G+  +L +QGF VI FDN   G+S    
Sbjct: 17  RLAFDAFGKCENPSIMLIMGLGA--QRIFWEDGFCNMLAEQGFWVIRFDNRDVGESTVLA 74

Query: 72  ----------------KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
                            + +   Y L  MA D VSL+  LGI+K H++G SMG  IA  +
Sbjct: 75  DSLPPNLLQLAASGLFDATVSTPYSLKDMADDVVSLMAQLGITKAHIVGASMGGMIAQLL 134

Query: 116 VLFYPSYVRSV--ILGGVG-SVLY----------------------DSDVVDWQSLIDSF 150
            + +P  V S+  I+   G   LY                      +S V  W+ L   F
Sbjct: 135 AIHHPQNVLSLTSIMSSTGDKNLYKPDKMVLLKLLKPMPKEREKCIESGVEFWRLLHGHF 194

Query: 151 LLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGS 210
               +   QN + + +      D    L+  A+ L+   +     DL R+ +P L+  G 
Sbjct: 195 YTFDLPRTQNLVRRAYEIGVSTD--GVLRQFAAILTAKDR---TSDLNRLSLPTLVIHGE 249

Query: 211 QDDL 214
            D L
Sbjct: 250 GDPL 253


>gi|326777459|ref|ZP_08236724.1| alpha/beta hydrolase fold protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657792|gb|EGE42638.1| alpha/beta hydrolase fold protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 288

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 101/238 (42%), Gaps = 28/238 (11%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           AP +LL+HGL     ++W  +   + L ++  R +  D  GHG+S+K   +  Y      
Sbjct: 33  APGVLLLHGLMGRA-SHWAPTA--RWLAER-HRAVGLDQRGHGRSEKPS-DGPYSRDAYV 87

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQ 144
           +DA + +E LG+  V V+G++MGA     +    P  VR++++  +  S L  +   +W 
Sbjct: 88  SDAEAAIEQLGLGPVTVVGHAMGALTGWQLAAKRPDLVRALVVCDMRASALGAASQREWS 147

Query: 145 SLIDSFLLPSID---------------EVQNPLGKKFRKFADLDPGNDLKALASCLSMIR 189
               S+ LP                  E  NP   +F      +  +  + + S   M+R
Sbjct: 148 DWFASWPLPFATLADVRKWFGEDDPWVERPNPSRGEFYAEVMAEREDGWRPVFSRRQMLR 207

Query: 190 KPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLL 240
                      ++L ++  P L+  G   +L     QE++  +P  QY  +    HL+
Sbjct: 208 TRATWVFDAHWEELAQVQCPALVLRGLDGELGRAEAQEMVRVLPRGQYAEVADAGHLV 265


>gi|169630957|ref|YP_001704606.1| lipase/esterase LipG [Mycobacterium abscessus ATCC 19977]
 gi|169242924|emb|CAM63952.1| Probable lipase/esterase LipG [Mycobacterium abscessus]
          Length = 310

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 22/129 (17%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + D+G+   P ++L+ G+A+  Q      G+ + L DQG+RVI FDN   G S K   + 
Sbjct: 24  YEDLGNPGDPAVVLVMGVAA--QLPMWPDGFCRQLLDQGYRVIRFDNRDCGLSTKLDGQK 81

Query: 78  --------------------DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
                                Y L+ MA D  SL++HLG+ KVH+ G SMG  I      
Sbjct: 82  APGSVQRRVVRYALGMGSKVPYTLIDMAEDVRSLVDHLGLEKVHIAGASMGGMIVQVFAG 141

Query: 118 FYPSYVRSV 126
            YP  V SV
Sbjct: 142 TYPERVHSV 150


>gi|167035042|ref|YP_001670273.1| alpha/beta hydrolase fold family protein [Pseudomonas putida GB-1]
 gi|166861530|gb|ABY99937.1| alpha/beta hydrolase fold [Pseudomonas putida GB-1]
          Length = 270

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 106/243 (43%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS Q +W     +  L  + +RVI  D  GHG+SDK    + Y++   +AD 
Sbjct: 22  LVLLHGLGSSCQ-DWELQ--VPAL-SRHYRVILMDIRGHGRSDKP--RDGYQIATFSADL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           ++LLEHL    VH +G SMG  I     + +P ++RS+ +      +      DW     
Sbjct: 76  LALLEHLHTGPVHFVGLSMGGMIGFQFAVDHPQWLRSLCIVNSAPEVKRRTRSDWVWWFK 135

Query: 149 SFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
            + L    S++ V   L ++           +  A     ND +A       I     Q+
Sbjct: 136 RWGLARVLSVETVGKGLAERLFPKPRQANLRQTMAQRWARNDKRAYLKSFDAIVDWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQE-LMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN 253
            + +I  P L+     D      +E  ++ +P+++ + +    H   +   + F Q ++ 
Sbjct: 196 RIGQIHCPTLVIAADHDYTPIQLKERYVALMPNARLVVVDDSRHATPLDQPEVFNQTLLQ 255

Query: 254 FYA 256
           F A
Sbjct: 256 FLA 258


>gi|42475485|dbj|BAD10902.1| hypothetical protein [Rhodococcus rhodochrous]
          Length = 264

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 103/237 (43%), Gaps = 22/237 (9%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y V     P +L++HG+  S  +   F+  +  L D   RVIA+D  G+ +S+    E D
Sbjct: 3   YTVDYGTGPAVLMLHGIGGSSDS---FAPQVAGLGDS-LRVIAWDAPGYARSEDPSRELD 58

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
                 AA  + + E    +  HV+G S G  IA  + L +P  VRS++L G  +V   +
Sbjct: 59  LDDYADAAAEL-IREKCSDAGAHVLGMSWGGVIATRLALRHPELVRSLVL-GASTVGSGA 116

Query: 139 DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL--KALASCLSMIRKPF---- 192
           D     ++    +       Q+   ++  +    +  +DL  +A       +R P     
Sbjct: 117 DADSAATMRSRIIDLGRSGPQDFAVRRAPRLLSPNASDDLVERATGIMTDAVRLPGYGYA 176

Query: 193 --------CQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHL 239
                     DDL +IDVP L+  G  D + G+P  QEL   IP + Y+ +    HL
Sbjct: 177 AESMAATDHTDDLEKIDVPTLVMCGDVDTVTGTPASQELAGGIPGAVYVTLRGAGHL 233


>gi|331697490|ref|YP_004333729.1| alpha/beta hydrolase fold protein [Pseudonocardia dioxanivorans
           CB1190]
 gi|326952179|gb|AEA25876.1| alpha/beta hydrolase fold protein [Pseudonocardia dioxanivorans
           CB1190]
          Length = 276

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 113/247 (45%), Gaps = 22/247 (8%)

Query: 6   KFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL 65
            F  +    + A+ ++G    PT+LL HG +S+   NW+  G    +   G RVI  D  
Sbjct: 11  SFLTTADGVRLAYRELG-AGRPTVLL-HGFSSTALINWVTPGHAAAVAATGRRVILPDLR 68

Query: 66  GHGKSDKSYIENDYRLVFMAADAVSLLEHLGIS--KVHVMGYSMGARIACSMVLFYPSYV 123
           GHG SD+S+    Y    +  D  +LL+HLG++     + GYS+GAR +   V+      
Sbjct: 69  GHGDSDRSHDPRAYPADVLTDDVFALLDHLGLADGDYDLGGYSLGARTSLRAVVRGARPG 128

Query: 124 RSVILG-GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGK-----KFRKFADLDP--G 175
           R V+ G G+  V++    +   S  D F    +D+   P G        R+ AD     G
Sbjct: 129 RLVVAGMGLAGVVH----IRGHSFADVFTQ-VLDDAAPPAGTFAPASPQRRIADFVERIG 183

Query: 176 NDLKALASCL-SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNIC 234
            D  AL   L + +  P  + +L  +  P L+  G +DD   + + L   +P S +  + 
Sbjct: 184 ADRTALRLALGTAVDTP--EVELAGVVAPTLVVCGDRDDPDDA-RALADVLPHSTFATV- 239

Query: 235 RRDHLLA 241
           + DH+ A
Sbjct: 240 KGDHISA 246


>gi|110680652|ref|YP_683659.1| hydrolase, putative [Roseobacter denitrificans OCh 114]
 gi|109456768|gb|ABG32973.1| hydrolase, putative [Roseobacter denitrificans OCh 114]
          Length = 253

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 108/255 (42%), Gaps = 26/255 (10%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G   AP ++++HGL  S + NW   G I      GFRV   D   HG S  +     +
Sbjct: 8   EFGAPTAPAVMIVHGLYGSAR-NW---GVIAKRLSDGFRVYTVDLRNHGLSPHT---QTH 60

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
               MAAD    +EHLG   V ++G+SMG + A ++ L  P  V  +++  +  V Y   
Sbjct: 61  SYPEMAADLAETIEHLG-GPVQLVGHSMGGKAAMALALTRPDLVHRLLVADIAPVAYTHS 119

Query: 140 VVDWQSLIDSFLLPSIDE------------VQNPLGKKFRKFADLDPGNDLKALASCLSM 187
            + +   + +  L ++              V+  L   F +  DL        LA+  + 
Sbjct: 120 QLPFIHAMKAVNLDAVSRRSDAEAQLAAQGVEPALCSFFTQSLDLGEKRWRLNLATLEAE 179

Query: 188 IRK--PFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHLL-AV 242
           + K   F Q D  R D P L   G++ D       Q + S    +Q+  +    H L A 
Sbjct: 180 MDKIMSFPQFDT-RFDGPTLFLSGAESDYVQPQHRQTIKSLFTRAQFAKLRGAGHWLHAD 238

Query: 243 GDKQFKQGVVNFYAN 257
             ++F+  V +F+A+
Sbjct: 239 KPREFETAVRSFFAS 253


>gi|47093553|ref|ZP_00231313.1| hydrolase, alpha/beta fold family [Listeria monocytogenes str. 4b
           H7858]
 gi|47018067|gb|EAL08840.1| hydrolase, alpha/beta fold family [Listeria monocytogenes str. 4b
           H7858]
          Length = 253

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 97/232 (41%), Gaps = 30/232 (12%)

Query: 31  LIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVS 90
           ++HG   + +T   F   I  L +  F +IA D LGHG +      + Y +  +  D   
Sbjct: 1   MLHGFTGTSET---FQDSISGLKEH-FNIIAPDLLGHGNTASPEEISPYTMENICEDLAG 56

Query: 91  LLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV---------- 140
           +L  L IS+  V+GYSMG R+A +    +P  VR +IL      L  +D+          
Sbjct: 57  ILHQLNISRCFVLGYSMGGRVATAFAATFPKRVRGLILVSSSPGLEQADIRESRVAADNR 116

Query: 141 -VDWQSLIDSFLLPSIDEVQN------------PLGKKFRKFADLDPGNDLKALASCLSM 187
             DW  + +  L+P +D  +N             + ++ R        + L      +  
Sbjct: 117 LADW--IEEEGLVPFVDYWENLALFASQKVLSPEMKRRIRSERLSQNSHGLAMSLRGMGT 174

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
            ++P   + L     PVL+  G+ D+      QE+   +P+S +++I    H
Sbjct: 175 GKQPSYWNCLANFTFPVLLITGALDEKFEKIAQEMHQLLPNSTHVSIQEAGH 226


>gi|319950381|ref|ZP_08024298.1| alpha/beta hydrolase [Dietzia cinnamea P4]
 gi|319435951|gb|EFV91154.1| alpha/beta hydrolase [Dietzia cinnamea P4]
          Length = 293

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 108/259 (41%), Gaps = 28/259 (10%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           + A  +L +HG    V     FSG   +  ++ F  I  D  G GKS     E  Y ++ 
Sbjct: 38  ESAVPVLFLHGSGPGVTAWSNFSGNFPVFAER-FHTILLDMPGFGKSSDLEWEKAYPMI- 95

Query: 84  MAADAV-SLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GGVGSVLYDSD 139
            AA+A+ +  E  GI KV ++G SMG  +AC   L YP  VR + L   GG+ + L+  D
Sbjct: 96  -AAEAIDAFCEAKGIEKVDIIGNSMGGNVACETALAYPDRVRKMALMGPGGLAAPLFAPD 154

Query: 140 VVDWQSLIDSFLLPSIDE--------------VQNPLGKKFRKFADLDPGNDLKALASCL 185
             +    +  FL    DE              V +P   + R  A   PG   +  +   
Sbjct: 155 PSEGSRRLFEFLADPTDEKMSAWVDTMVGNKKVVSPELIRARTEAATAPGAVERMYSIFG 214

Query: 186 SMIRKPFCQDDLY----RIDVPVLIAVGSQDDLAGSPQELMSF--IPSSQYLNICRRDHL 239
           S+++       LY    +I    L+  G  D +    Q   +F  +P ++     R  H 
Sbjct: 215 SILKPENAYTPLYTRASQIRQETLLIWGRDDRMLPYEQAHFAFRQLPKAELHAFSRCGHW 274

Query: 240 LAVGDK-QFKQGVVNFYAN 257
             +  K +F++ V++F  N
Sbjct: 275 AMIEQKDKFERLVIDFLLN 293


>gi|254784558|ref|YP_003071986.1| hydrolase, alpha/beta fold family protein [Teredinibacter turnerae
           T7901]
 gi|237684578|gb|ACR11842.1| hydrolase, alpha/beta fold family protein [Teredinibacter turnerae
           T7901]
          Length = 258

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 97/212 (45%), Gaps = 24/212 (11%)

Query: 47  GW---IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVM 103
           GW   +  L +Q FRVI  DN G G SDK     +Y    MAADA+++L  L I   HV+
Sbjct: 35  GWGSFVNALAEQ-FRVIVLDNRGTGNSDKPDAP-EYSTRGMAADAIAVLNTLQIFSAHVL 92

Query: 104 GYSMGARIACSMVLFYPSYVRSVIL----GGVGSVLYDSDVVDW-------QSLIDSFLL 152
           G+SMG RIA  + + +P  V  ++L     G    +  +  VD+       + +++  + 
Sbjct: 93  GFSMGGRIAQWVAVDHPKRVNKLVLVATTPGNTHGVARAQSVDFIFASGNRERMLELMVS 152

Query: 153 PSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF--CQDDLYRIDVPVLIAVGS 210
           PS  +  NP   +F++       N   A A  L  +      C  +L  +  P LI  G+
Sbjct: 153 PSWYD-SNP---EFQQLWQYQAENRPPAYAQRLHFVASECHDCWHELSSVTTPTLIVHGN 208

Query: 211 QD--DLAGSPQELMSFIPSSQYLNICRRDHLL 240
            D  +L  + + L   IP ++ + I    H +
Sbjct: 209 DDTINLPANARLLAEQIPKAEVVFIPEGRHYI 240


>gi|182436864|ref|YP_001824583.1| putative hydrolase [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|178465380|dbj|BAG19900.1| putative hydrolase [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 288

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 101/238 (42%), Gaps = 28/238 (11%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           AP +LL+HGL     ++W  +   + L ++  R +  D  GHG+S+K   +  Y      
Sbjct: 33  APGVLLLHGLMGRA-SHWAPTA--RWLAER-HRAVGLDQRGHGRSEKPS-DGPYTRDAYV 87

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQ 144
           +DA + +E LG+  V V+G++MGA     +    P  VR++++  +  S L  +   +W 
Sbjct: 88  SDAEAAIEQLGLGPVTVVGHAMGALTGWQLAAKRPDLVRALVVCDMRASALGAASQREWS 147

Query: 145 SLIDSFLLPSID---------------EVQNPLGKKFRKFADLDPGNDLKALASCLSMIR 189
               S+ LP                  E  NP   +F      +  +  + + S   M+R
Sbjct: 148 DWFASWPLPFATLADVRKWFGEDDPWVERPNPSRGEFYAEVMAEREDGWRPVFSRRQMLR 207

Query: 190 KPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLL 240
                      ++L ++  P L+  G   +L     QE++  +P  QY  +    HL+
Sbjct: 208 TRATWVFDAHWEELAQVQCPALVLRGLDGELGRAEAQEMVRVLPRGQYAEVADAGHLV 265


>gi|86742098|ref|YP_482498.1| alpha/beta hydrolase [Frankia sp. CcI3]
 gi|86568960|gb|ABD12769.1| alpha/beta hydrolase fold [Frankia sp. CcI3]
          Length = 256

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 97/224 (43%), Gaps = 17/224 (7%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSD-KSYIEND 78
           G  D P +LL+HG+A S       + W  ++ +     RVIA+D  GHG S   +     
Sbjct: 13  GGGDIP-VLLLHGIAGST------ADWAAVVPELATSRRVIAYDQRGHGASGWATTGRAG 65

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           Y    + AD  ++++ LG+  VH++G+SMG  +A    L +P  VRS++L    +     
Sbjct: 66  YSFDQLVADLATVVDVLGLPAVHLIGHSMGGVVALRYTLNHPGRVRSLVLADTAAAPATG 125

Query: 139 DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADL---DPGNDLKALASCLSMIRKPFCQD 195
                + ++   L  +          + R  A L   DP N + AL   LS    P   D
Sbjct: 126 TGGITKRVVSVLLAGAAAIATAVHAGRNRAVAGLGRMDP-NAIVALWRDLSSY--PSLTD 182

Query: 196 DLYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRDH 238
            L  I  P  + VG +D  L  + + L   +P +    I   DH
Sbjct: 183 RLGEICAPTTVIVGERDFSLRDAAETLARSVPDAHLAVIAGADH 226


>gi|183981001|ref|YP_001849292.1| lipase/esterase LipG1 [Mycobacterium marinum M]
 gi|183174327|gb|ACC39437.1| lipase/esterase LipG1 [Mycobacterium marinum M]
          Length = 314

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 61/115 (53%), Gaps = 22/115 (19%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK----- 72
           + D+GD +AP +LLI GL + +   W  +G+ Q L DQG RVI +DN   G S K     
Sbjct: 30  YEDMGDINAPPVLLIMGLGAQLLL-WR-TGFCQKLVDQGLRVIRYDNRDVGLSTKMEQPS 87

Query: 73  -----------SYI----ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
                      S++    +  Y L  MA DA +LL+HL I + H++G SMG  IA
Sbjct: 88  ARQPLMPQLIRSWLGRRSQTPYTLEDMADDAAALLDHLDIERAHIVGASMGGMIA 142


>gi|284052037|ref|ZP_06382247.1| alpha/beta hydrolase fold protein [Arthrospira platensis str.
           Paraca]
          Length = 268

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 99/226 (43%), Gaps = 31/226 (13%)

Query: 11  WRKYQFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           WR   ++FY    GD+  P ILL+HG   + +    F   I  L  Q F  +  D  G G
Sbjct: 4   WRGGCYSFYGELHGDRTQPIILLLHGFMGNCRD---FDPAIPSL-SQHFSCLTIDLPGQG 59

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           K+     +  Y++  +A+  + LL++L I    ++GYSMG R+   ++L YP+  +  IL
Sbjct: 60  KTQVLAGDEAYQIPAIASGLIGLLDYLKIDNCVLIGYSMGGRLGLYLILHYPTRFKQAIL 119

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQN-------------PLGKKFRKFADLDP- 174
                 L        + L D+ +    +++QN             PL   F+   + D  
Sbjct: 120 ESASPGLKTEIERSQRRLSDNQI---ANKLQNSNFQDFLNWWYSLPLFTSFKNSPNFDKI 176

Query: 175 -GNDLKALASCLSMI-------RKPFCQDDLYRIDVPVLIAVGSQD 212
            G+ LK   + L+ I        +P   D L +  +P+L+ VG  D
Sbjct: 177 IGDRLKNNPTELAKILINSGTGTQPTLWDKLSQNQIPLLLLVGEFD 222


>gi|148254309|ref|YP_001238894.1| hypothetical protein BBta_2861 [Bradyrhizobium sp. BTAi1]
 gi|146406482|gb|ABQ34988.1| hypothetical protein BBta_2861 [Bradyrhizobium sp. BTAi1]
          Length = 306

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 62/128 (48%), Gaps = 21/128 (16%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY--- 74
           +   GD  AP +LLI GL +  Q    +  + + L  +GFRVI FDN   G+S K +   
Sbjct: 21  YETFGDPAAPPLLLIMGLGA--QMIIWYDEFCEQLASRGFRVIRFDNRDIGQSSKMHGGR 78

Query: 75  ----------------IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
                           +   Y+L+ MA D V L++ L I   H++G SMG  IA  + L 
Sbjct: 79  RLTPFELIKLRFFNIPVAAPYKLIDMAKDTVGLMDALDIKSAHLVGASMGGMIAQEIALN 138

Query: 119 YPSYVRSV 126
           +P  +RS+
Sbjct: 139 FPQRLRSL 146


>gi|257055882|ref|YP_003133714.1| putative hydrolase or acyltransferase of alpha/beta superfamily
           [Saccharomonospora viridis DSM 43017]
 gi|256585754|gb|ACU96887.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Saccharomonospora viridis DSM 43017]
          Length = 350

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 59/110 (53%), Gaps = 3/110 (2%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F+     + P +LL+HG   S  +   +S  I ++ + G+R +A D  G+G+S K    +
Sbjct: 13  FHYAEQGEGPLVLLLHGFPESWHS---WSHQIPMIAEAGYRAVAPDLRGYGRSSKPRRVD 69

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           DYR+  + AD V L+E LG ++  V+G+  G+ +A +     P   R V+
Sbjct: 70  DYRITELVADCVGLVEALGETEAVVVGHDWGSMLAWTAAWTRPDVFRGVV 119


>gi|262279268|ref|ZP_06057053.1| 3-oxoadipate enol-lactonase I [Acinetobacter calcoaceticus RUH2202]
 gi|262259619|gb|EEY78352.1| 3-oxoadipate enol-lactonase I [Acinetobacter calcoaceticus RUH2202]
          Length = 261

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 107/260 (41%), Gaps = 34/260 (13%)

Query: 15  QFAFYDVGDKDAPTILLIHGLAS-----SVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           Q A Y  G KDAP ++  + L +       Q N L S          F VI +D  GHG+
Sbjct: 12  QLAVYTEGLKDAPVLVFSNSLGTDHGMWQPQLNELKSH---------FNVITYDTRGHGE 62

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           SD   + +D  L  +A D V +L+ L I K H  G SMG      + + YP    S+ + 
Sbjct: 63  SD---VISDTTLQNLAEDVVDILDALNIEKAHFCGISMGGITGLWLGIHYPERFHSITVA 119

Query: 130 GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-----LGKKFRKFADLDPGNDLKALASC 184
              + +  +D   W S  +S     + E+          +KF    ++     +++LA+ 
Sbjct: 120 NSAAKIGQADA--WLSRAESVEQNGLAELVKTTHTRWFSEKFDYQHNVVAQTTIQSLANT 177

Query: 185 LSMIRKPFC--------QDDLYRIDVPVLIAVGSQDDLAG-SPQELMSFIPSSQYLNICR 235
            +      C        +D++ +I +PVL+  G+ D +   +  E M    ++  L    
Sbjct: 178 PAQGYANACRALAHADLRDEIAQIQIPVLLVAGTYDPVTTVADAEFMQRAINNSQLAKLE 237

Query: 236 RDHLLAVGDKQ-FKQGVVNF 254
             HL  +   Q F Q +  F
Sbjct: 238 ASHLSNIEQPQRFTQELTRF 257


>gi|296130924|ref|YP_003638174.1| alpha/beta hydrolase fold protein [Cellulomonas flavigena DSM
           20109]
 gi|296022739|gb|ADG75975.1| alpha/beta hydrolase fold protein [Cellulomonas flavigena DSM
           20109]
          Length = 309

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 6/116 (5%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           +F     GD+DAP +LL+HG+    Q  W +   + LL   G+RV A D  G G SDK  
Sbjct: 26  RFHVALAGDQDAPLVLLLHGVP---QLWWAWRHQLPLLAAAGYRVAAMDLRGTGGSDKP- 81

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILG 129
               Y +  +AAD   ++  LG     V+G   G  +A +   ++P  VR++ +LG
Sbjct: 82  -PQGYDVPTLAADVAGVVRSLGAGSAVVVGTGTGGDVAWATAAYHPQVVRALGVLG 136


>gi|296140938|ref|YP_003648181.1| alpha/beta hydrolase fold protein [Tsukamurella paurometabola DSM
           20162]
 gi|296029072|gb|ADG79842.1| alpha/beta hydrolase fold protein [Tsukamurella paurometabola DSM
           20162]
          Length = 250

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 15/151 (9%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
            +V+    WR        V     P ++LIHG+A+  +T   + G  + L   G   + F
Sbjct: 12  GDVRLRVQWRA-------VAAPSGPPVVLIHGMAADHRT---WRGTARALRAAGRPTVTF 61

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D  GHG SD S    DY L  +AADA  +++ LG+ +  V+G+S+G + A  +    P  
Sbjct: 62  DQRGHGGSDHS---PDYLLDELAADAERVIDGLGLDRFDVVGHSLGGQTALRLAWRRPDA 118

Query: 123 VRSVILGGVGSVLYDSDVVDWQSLIDSFLLP 153
           VR ++L  +  +    D V     ID+ + P
Sbjct: 119 VRRLVLEEMPPLPQHPDQV--PESIDAPITP 147


>gi|297194162|ref|ZP_06911560.1| hydrolase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197721989|gb|EDY65897.1| hydrolase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 276

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 87/170 (51%), Gaps = 17/170 (10%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           +RVIA D  GHG+SD++    +Y       DAV+LLEHLG+ +V V+G+S+G   A  + 
Sbjct: 71  WRVIALDQRGHGRSDRT---PEYDRDGYVRDAVALLEHLGLEEVVVLGHSLGGLNAYQLA 127

Query: 117 LFYPSYVRSVILGGVGSVLYD--SDVVDW--QSLIDSFLLPSIDEVQNPLGKKFRKFAD- 171
             +P  VR++++  VG+V+ D  S  + W  ++   + L+ ++ +    L    R+  D 
Sbjct: 128 ARHPQAVRALVIEDVGAVVADDLSFCLSWPRRAPTRAALVEALGDAVRYLADAVREHPDG 187

Query: 172 ----LDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGS 217
                +P    + + +  + +R     DD    D P L+  G+  D+ G+
Sbjct: 188 WGLAFEP----RDMVTSHAHVRGDHW-DDWLASDCPALLVHGTDSDVLGA 232


>gi|149181418|ref|ZP_01859914.1| hypothetical protein BSG1_14669 [Bacillus sp. SG-1]
 gi|148850819|gb|EDL64973.1| hypothetical protein BSG1_14669 [Bacillus sp. SG-1]
          Length = 267

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 60/110 (54%), Gaps = 8/110 (7%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIEND 78
           +V  K  P ILL+HG      T      W +LL   + +R IA D LGHG++D     + 
Sbjct: 12  EVHGKGTP-ILLLHGFTGDNST------WDELLPYLENYRTIAVDLLGHGRTDTPDNPDR 64

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           Y++     D  ++++ L   +V+++GYSMG R+A +    YP  V+++IL
Sbjct: 65  YQIEHAIEDLKAIIDELNTEEVYLLGYSMGGRLALAFSAAYPERVKALIL 114


>gi|294633501|ref|ZP_06712060.1| hydrolase [Streptomyces sp. e14]
 gi|292831282|gb|EFF89632.1| hydrolase [Streptomyces sp. e14]
          Length = 278

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 14/136 (10%)

Query: 1   MMNEV---KFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGF 57
           +M+EV   +FF S      A+ D G    P +LL  G      T W     I +L ++ F
Sbjct: 3   VMSEVTDLRFFES-SDGALAYRDTGGAGLPVVLLHAGFVD--HTMW--DEQIPVLAEE-F 56

Query: 58  RVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
           RVIA D  GHG+S      N  R      D   LL HLG+    ++G SMGA IA +  L
Sbjct: 57  RVIAPDARGHGRS-----ANASRPFRQDDDLAELLRHLGVGPAALVGVSMGAMIAVATAL 111

Query: 118 FYPSYVRSVILGGVGS 133
            +P  VR++++ G G+
Sbjct: 112 EHPELVRALVVSGGGA 127


>gi|258512337|ref|YP_003185771.1| alpha/beta hydrolase fold protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479063|gb|ACV59382.1| alpha/beta hydrolase fold protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 274

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 5/103 (4%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +YDV  +  P +LLI G+  +++  W  SG+++ L ++   VIAFDN G G+S+      
Sbjct: 12  YYDVHGEGYP-LLLIMGVGGNIR--WWGSGFVRRLAEK-HTVIAFDNRGAGQSEAD-PAK 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
            + L  MA DA ++L+  G+ + HV+GYSMG  IA  + L +P
Sbjct: 67  PWTLEQMADDARAVLDAAGVGRAHVLGYSMGGMIAQELALRHP 109


>gi|126731593|ref|ZP_01747398.1| Esterase/lipase/thioesterase [Sagittula stellata E-37]
 gi|126707759|gb|EBA06820.1| Esterase/lipase/thioesterase [Sagittula stellata E-37]
          Length = 266

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 110/235 (46%), Gaps = 26/235 (11%)

Query: 18  FYD-VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           +YD +GD DAP + + H L S    + ++S  +  + + G++V+  D  GHG S  S   
Sbjct: 11  YYDLIGDPDAPVVCMSHSLTSD---HGMWSEQVPAILEAGYQVLRIDTRGHGGS--SADA 65

Query: 77  NDYRLVFMAADAVSLLEHLG-ISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV- 134
            DY +  +A D +S+L+ LG  S VH +G SMG  I   +   +P  + S++     S  
Sbjct: 66  ADYTIEELADDVLSVLDALGFTSGVHFIGLSMGGMIGQVIAADHPGRLASLMACCTASKW 125

Query: 135 LYDSDVVD--WQSLIDSFLLPSI--DEVQNPLGKKFRKFADLD--------PGNDLKALA 182
           + D++++    Q++ +S  L SI    ++   G  F++   L          G  L    
Sbjct: 126 MGDTELMKGRLQAVRESGTLESIVAANMERRYGPGFQERRPLRWEALRQTFLGTKLDGYF 185

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE----LMSFIPSSQYLNI 233
            C++       +  L  I +P L+  GS+D    +P E    +   IP ++++ I
Sbjct: 186 GCMNACLTHNVEPRLGGISIPTLVVAGSEDPT--TPPEDNRLIAECIPGARFVEI 238


>gi|221635664|ref|YP_002523540.1| alpha/beta hydrolase fold protein [Thermomicrobium roseum DSM 5159]
 gi|221157779|gb|ACM06897.1| alpha/beta hydrolase fold protein [Thermomicrobium roseum DSM 5159]
          Length = 281

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 62/110 (56%), Gaps = 7/110 (6%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G  +AP ILL+HGL    +T   +   +  L ++ FRVIAFD  GHG+S +      Y
Sbjct: 19  EAGPSEAPPILLLHGLYDRWET---WEPVVPALAER-FRVIAFDMRGHGRSSQPA--GGY 72

Query: 80  RLVFMAADAVSLLEHLGISK-VHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            L   A DAV LL  L  S+ + V+G+S+GA +A  +   +P  +R V+L
Sbjct: 73  TLRDYADDAVRLLARLRPSRPIVVIGFSLGALVAIVLAAEHPELIRGVVL 122


>gi|218190535|gb|EEC72962.1| hypothetical protein OsI_06850 [Oryza sativa Indica Group]
 gi|222622651|gb|EEE56783.1| hypothetical protein OsJ_06362 [Oryza sativa Japonica Group]
          Length = 389

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 1/93 (1%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           +G  V  FDN G G+S     ++ Y  V MA DA++L++HLG  K HV G+SMG+ IA  
Sbjct: 79  EGAEVCCFDNRGIGRSSVPPHKSQYTTVIMAKDALALMDHLGWRKAHVFGHSMGSMIASK 138

Query: 115 MVLFYPSYVRSV-ILGGVGSVLYDSDVVDWQSL 146
           +    P  V S+ +L   G        +DWQ++
Sbjct: 139 LAAIAPERVASLALLNTTGGGYQCIPKIDWQTI 171


>gi|307265572|ref|ZP_07547126.1| alpha/beta hydrolase fold protein [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919370|gb|EFN49590.1| alpha/beta hydrolase fold protein [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 279

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 60/111 (54%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y++     P I+LI GL  S    W++   I  L  + F+VI FD  G G SDK  +E 
Sbjct: 12  YYEIHGNGQP-IVLIEGLGCS---KWMWFKQIDEL-KKHFKVIVFDLRGVGDSDKPDME- 65

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            Y +   A D  +L+  LG  KVH++G SMG  IA  + L YP+ V  +IL
Sbjct: 66  -YSIKLFADDTAALVTELGFKKVHILGVSMGGYIAQELALEYPALVDRLIL 115


>gi|52549798|gb|AAU83647.1| predicted hydrolases or acyltransferases [uncultured archaeon
           GZfos32E7]
          Length = 262

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 6/100 (6%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHGL+   Q  W+   W+     + +R IA D  GHG S K   +  Y +   +AD 
Sbjct: 22  LVLIHGLSGD-QAGWV---WVMPEFSKHYRTIAPDVRGHGDSGKP--DMPYSIQQFSADI 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            +L + L I + H++G+SMGA IA   VL YP  V+S+IL
Sbjct: 76  FALFQKLEIRQAHLLGFSMGAAIAQQFVLDYPERVKSLIL 115


>gi|146220113|gb|ABQ11270.1| lipase/esterase [uncultured bacterium]
          Length = 273

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           +R IA DN G G+SD       Y +  MA+DA ++L+  G+   HV G SMG  I+    
Sbjct: 46  YRTIALDNRGVGQSDMP--PGPYPIPVMASDAAAVLDAAGVESAHVFGISMGGMISQEFA 103

Query: 117 LFYPSYVRSVIL-----GGVGSVLYDSDVVD 142
           L YP+ VRS+IL     GG  +V  D D  +
Sbjct: 104 LQYPNRVRSLILGCTAAGGPNAVRADQDATN 134


>gi|158423967|ref|YP_001525259.1| alpha/beta hydrolase [Azorhizobium caulinodans ORS 571]
 gi|158330856|dbj|BAF88341.1| alpha/beta hydrolase [Azorhizobium caulinodans ORS 571]
          Length = 265

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 92/217 (42%), Gaps = 24/217 (11%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R   +A    G  DAP +LL    A+S+ T +L    +       F V+ +D  GHG SD
Sbjct: 9   RTVHYALE--GRTDAPVLLL----ANSLGTGFLVWDAVMPALAAHFNVLRYDMRGHGLSD 62

Query: 72  KSYIEND---YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            + + ++   Y +V +A DA+ LL+ LGI+K HV G S+G  +A  +    P+ V  ++L
Sbjct: 63  AAPLGDEASGYSIVDLAGDALGLLDALGIAKAHVCGLSIGGMVAQHLGAHAPARVDRLVL 122

Query: 129 GGVGSVLYDSDVVDWQSLIDSF-------LLPSI------DEVQNPLGKKFRKFADLDPG 175
                 +  + V  W   +          + P +      D  +  +    R +A++   
Sbjct: 123 CDTAMQIGPASV--WNERVAGIRRDGLAAIAPGVMGRWFTDGFRERVPHIVRGYANMVAR 180

Query: 176 NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD 212
             L     C   +R         RI  P L+ VG +D
Sbjct: 181 TTLDGYVGCALAVRDADLTASAARITAPTLVVVGDKD 217


>gi|255034459|ref|YP_003085080.1| alpha/beta hydrolase fold protein [Dyadobacter fermentans DSM
           18053]
 gi|254947215|gb|ACT91915.1| alpha/beta hydrolase fold protein [Dyadobacter fermentans DSM
           18053]
          Length = 310

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 107/242 (44%), Gaps = 36/242 (14%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V  K  P I+L+HG   ++ +NW  +  I +L D+  +VI  +   HG++    I  
Sbjct: 59  YYEVYGKGKP-IVLVHGSFMNIPSNW--AHIIPMLGDR--QVIVAEMQAHGRTRD--IAR 111

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS-VILGGVGSVLY 136
                 MA D   LL+HL +    ++GYSMG  +A  + + +P  VR  VIL G     Y
Sbjct: 112 PLSYEGMADDVSGLLKHLRVDSADILGYSMGGGVAFQLAIRHPEQVRRLVILSGT----Y 167

Query: 137 DSDVVDWQSLIDSFLLPSIDEVQ-NPLGKKFRKFADLDPGNDLKALASCLSMIRKPF-CQ 194
             D   W     SF   + D  +  P+  +F    + DP      +   +S+  KP+   
Sbjct: 168 AHDGW-WPDAEASFSTITADMFKGTPIQTQFDSLGN-DPAKFPDFIKKVISIDLKPYDWS 225

Query: 195 DDLYRIDVPVLIAVGSQD--------------------DLAGSPQELMSFIPSSQYLNIC 234
            D   I VP+ +A+G  D                    ++ G P+  ++ +P + ++ + 
Sbjct: 226 KDAKNIKVPLFMAIGDADGVRYEHALELFRAKGGGKMGEMHGLPKSRLAILPGTTHIGMI 285

Query: 235 RR 236
           +R
Sbjct: 286 QR 287


>gi|154252127|ref|YP_001412951.1| alpha/beta hydrolase fold protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154156077|gb|ABS63294.1| alpha/beta hydrolase fold [Parvibaculum lavamentivorans DS-1]
          Length = 301

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 61/126 (48%), Gaps = 23/126 (18%)

Query: 20  DVGDKDAPTILLIHGLASSVQT--NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK----- 72
           D G  D   IL ++G  S++ +  + L  G    L D+GFRVI +DN   GKS+K     
Sbjct: 17  DRGPADGTPILFVNGYTSTMMSWPDELMDG----LRDKGFRVIRYDNRDVGKSEKFSGLP 72

Query: 73  ------------SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
                          +  Y L  MAAD + +L+ LGI + HVMG SMG  I   M + +P
Sbjct: 73  KIADVVAAVREGRKPDMPYTLADMAADGIGVLDALGIKRAHVMGISMGGMIVQRMAIHHP 132

Query: 121 SYVRSV 126
             + SV
Sbjct: 133 ERLLSV 138


>gi|313618577|gb|EFR90552.1| shchc synthase [Listeria innocua FSL S4-378]
          Length = 275

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 102/239 (42%), Gaps = 36/239 (15%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           P +L++HG   S +T   F   I LL +  F +IA D LGHGK+        Y +  +  
Sbjct: 19  PVLLMLHGFTGSSET---FQDSISLLKEH-FSIIAPDLLGHGKTSCPKEVARYSIENICD 74

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD--------- 137
           D  S+L  L I    V+GYSMG R+A +    Y   VR ++L      L D         
Sbjct: 75  DLASILHQLKIDSCFVLGYSMGGRVATAFAAKYKELVRGLVLVSSSPGLRDEKARASRIS 134

Query: 138 -----SDVVD----------WQSLIDSFLLPSIDEVQNPLGKKFR--KFADLDPGNDLKA 180
                +D +D          W++L    L  S   +   L K+ R  + A  +P    K+
Sbjct: 135 ADNRLADTLDSDGIEPFVAYWENLA---LFASQKNLPFALKKRIRLERLAQ-NPHGLAKS 190

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
           L   +   ++P   ++L     PVL+  G+ D+      +E+   +P+S ++ +    H
Sbjct: 191 LRG-MGTGKQPSYWENLAGFTFPVLLITGNLDEKFEKIAREMKQLLPNSTHVTVQEAGH 248


>gi|297819800|ref|XP_002877783.1| hypothetical protein ARALYDRAFT_485452 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297323621|gb|EFH54042.1| hypothetical protein ARALYDRAFT_485452 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 323

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 3/106 (2%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           GD + P +LL+HG     +T + +   I  L   G+ V+A D  G+G SD       Y +
Sbjct: 23  GDTEGPLVLLLHGFP---ETWYSWRHQIDFLSSHGYHVVAPDLRGYGDSDSLPSHESYTV 79

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
             + AD + LL+H G ++  V G+  GA I   + LF P  V+  I
Sbjct: 80  SHLVADVIGLLDHYGTAQAFVAGHDWGAIIGWCLCLFRPDRVKGYI 125


>gi|119504439|ref|ZP_01626519.1| probable hydrolase [marine gamma proteobacterium HTCC2080]
 gi|119459947|gb|EAW41042.1| probable hydrolase [marine gamma proteobacterium HTCC2080]
          Length = 308

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 69/130 (53%), Gaps = 21/130 (16%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK--- 72
            A+ D G+ + P ILLI G+A+ + T W  S + Q L D+GF V+ FDN   G S+K   
Sbjct: 13  LAYDDFGNANDPAILLIMGMATQM-TAWPLS-FCQGLADRGFYVVRFDNRDVGLSEKMLA 70

Query: 73  SYIEN----------------DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           +YI +                 Y+L  MA DA+ L++ L + + HV+G SMG  I+  + 
Sbjct: 71  AYIPSTLSMMLKAALNRPLTVSYKLGDMANDAIGLMDALNLDQAHVVGVSMGGMISQILA 130

Query: 117 LFYPSYVRSV 126
             +P+ V S+
Sbjct: 131 AKHPARVLSL 140


>gi|146339525|ref|YP_001204573.1| hydrolase [Bradyrhizobium sp. ORS278]
 gi|146192331|emb|CAL76336.1| conserved hypothetical protein; probable hydrolase [Bradyrhizobium
           sp. ORS278]
          Length = 306

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 115/280 (41%), Gaps = 72/280 (25%)

Query: 19  YDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ----GFRVIAFDNLGHGKSDKS 73
           Y++ GD  AP +LLI GL   +        W    C+Q    GFRVI FDN   G+S   
Sbjct: 21  YEIFGDPSAPPLLLIMGLGGQMII------WDDAFCEQLAACGFRVIRFDNRDIGQSSHL 74

Query: 74  Y-------------------IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           +                   +   Y+++ MA D V L++ L I   H++G SMG  IA  
Sbjct: 75  HGGRRITPFELLKLRFFNIPVSAPYKILDMAKDTVGLMDALDIKSAHLVGASMGGMIAQE 134

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRK------ 168
           + + +P  VRS  L  + S   +  +      +   L+      ++   K+F+K      
Sbjct: 135 VAISFPHRVRS--LTSIMSTTGNPRIPPPTREVAMLLMAPPPRTRDEYIKRFQKTWKALR 192

Query: 169 ------------------FA-DLDP---GNDLKALASCLSMIRKPFCQDDLYRIDVPVLI 206
                             FA  L+P   G  L+A+ +  S  RKP     L+++  P L+
Sbjct: 193 AGSFPEDEARDVALAERCFARGLNPAGVGRQLRAILASGS--RKP----RLHQVTAPTLV 246

Query: 207 AVGSQDDL----AGSPQELMSFIPSSQYLNICRRDHLLAV 242
             G  D L    AG+  +    IP+++ L I R  H + +
Sbjct: 247 IHGKLDPLVHHSAGT--DTAESIPNAKLLMIERMGHAIPI 284


>gi|229092148|ref|ZP_04223329.1| hypothetical protein bcere0021_29380 [Bacillus cereus Rock3-42]
 gi|228691139|gb|EEL44903.1| hypothetical protein bcere0021_29380 [Bacillus cereus Rock3-42]
          Length = 294

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +YQ +  + GDK  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYQASVCEWGDKSNPQIICFHGLGS---TKLSFIEIAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFEKDEDYGASHLINWVVALLEHIGKETFHIVAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|83951167|ref|ZP_00959900.1| putative alpha/beta hydrolase [Roseovarius nubinhibens ISM]
 gi|83839066|gb|EAP78362.1| putative alpha/beta hydrolase [Roseovarius nubinhibens ISM]
          Length = 308

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
            G +D P ++LIHGL +    +++++     L  QGFR +++D+ G G SD+     D  
Sbjct: 51  AGPEDGPLVILIHGLTTP---SFVWTPIADHLNGQGFRTLSYDHYGRGYSDRPGGAQDEE 107

Query: 81  LVFMAADAVSLLEHLGI-SKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             F  +    LL+HLG+     VMGYSMG  IA +    +P  VR +IL
Sbjct: 108 --FFLSHLSELLDHLGLRGPATVMGYSMGGAIATAWSARHPDLVRDLIL 154


>gi|297158271|gb|ADI07983.1| putative hydrolase [Streptomyces bingchenggensis BCW-1]
          Length = 288

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 114/260 (43%), Gaps = 31/260 (11%)

Query: 27  PTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           P +LL+HGL      +W  +  W+        R +A D  GHG+S+K       R  ++A
Sbjct: 35  PGVLLLHGLMGR-GAHWARTARWLATR----HRAVALDQRGHGRSEKPADGPFDRGTYVA 89

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQ 144
            DA + +E LG++ V ++G+SMGA  A  +    P  V ++++  +  S L  +   +W 
Sbjct: 90  -DAAAAVEQLGLAPVTLIGHSMGALTAWQLAARRPDLVSALVICDMRASALGSASQAEWA 148

Query: 145 SLIDSFLLP--SIDEVQNPLGKKFRKFADLDPG-------------NDLKALASCLSMI- 188
               S+ LP  ++ +V+   G+   +    +P              +  + + S   M+ 
Sbjct: 149 QWFSSWPLPFATLADVRKWFGEDDPRLERPNPARGDFFAEIMAERSDGWRPVFSRRQMLK 208

Query: 189 -RKPFCQD----DLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLLAV 242
            R  +  D    +L  +  P L+  G   +L     QE++  +P  +Y  +    HL+  
Sbjct: 209 ARATWVHDAHWEELALVQCPTLVVRGLDGELGRAEAQEMVRVLPRGEYAEVTDAGHLVHY 268

Query: 243 GDKQ-FKQGVVNFYANELRA 261
              + +++ V  F A+ L A
Sbjct: 269 DQPEGWRRAVEPFLASVLPA 288


>gi|170722996|ref|YP_001750684.1| alpha/beta hydrolase fold family protein [Pseudomonas putida W619]
 gi|169760999|gb|ACA74315.1| alpha/beta hydrolase fold [Pseudomonas putida W619]
          Length = 270

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 105/243 (43%), Gaps = 21/243 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS Q +W     +  L  + +RVI  D  GHG+SDK    + Y++   + D 
Sbjct: 22  LVLLHGLGSSSQ-DWELQ--VPAL-SRHYRVILMDIRGHGRSDKP--NDGYQIATFSEDL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLID 148
           ++LLEHL    VH +G SMG  +     + +P ++RS+ +      +      DW     
Sbjct: 76  LALLEHLQTGPVHFVGLSMGGMVGFQFAVDHPQWLRSLCIVNSAPEVKRRTRNDWVWWAK 135

Query: 149 SFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKALASCLSMIRKPFCQD 195
            + L    S++ V   L ++           +K A     ND +A       I     Q+
Sbjct: 136 RWGLARILSVETVGKGLAQRLFPKPEQADLRQKMAQRWARNDKRAYLKSFDAIVDWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQE-LMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN 253
            + +I  P L+     D      +E  ++ +P ++ + I    H   +   + F Q ++ 
Sbjct: 196 RIGQIHCPTLVVAADHDYTPVQLKERYVALMPQARLVVIDDSRHATPLDQPEVFNQTLLQ 255

Query: 254 FYA 256
           F A
Sbjct: 256 FLA 258


>gi|291569905|dbj|BAI92177.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 268

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 99/226 (43%), Gaps = 31/226 (13%)

Query: 11  WRKYQFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           WR   ++FY    GD+  P ILL+HG   + +    F   I  L  Q F  +  D  G G
Sbjct: 4   WRVGCYSFYGELHGDRTQPIILLLHGFMGNCRD---FDPAIPSL-SQHFSCLTIDLPGQG 59

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           K+     +  Y++  +A+  + LL++L I    ++GYSMG R+   ++L YP+  +  IL
Sbjct: 60  KTQVLAGDEAYQIPAIASGLIGLLDYLKIDNCVLIGYSMGGRLGLYLILHYPTRFKQAIL 119

Query: 129 GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQN-------------PLGKKFRKFADLDP- 174
                 L        + L D+ +    +++QN             PL   F+   + D  
Sbjct: 120 ESASPGLKTEIERSQRRLSDNQI---ANKLQNSNFQDFLNWWYSLPLFTSFKNSPNFDKI 176

Query: 175 -GNDLKALASCLSMI-------RKPFCQDDLYRIDVPVLIAVGSQD 212
            G+ LK   + L+ I        +P   D L +  +P+L+ VG  D
Sbjct: 177 IGDRLKNNPTELAKILINSGTGTQPTLWDKLSQNQIPLLLLVGEFD 222


>gi|254425499|ref|ZP_05039216.1| hydrolase, alpha/beta fold family, putative [Synechococcus sp. PCC
           7335]
 gi|196187922|gb|EDX82887.1| hydrolase, alpha/beta fold family, putative [Synechococcus sp. PCC
           7335]
          Length = 302

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 85/175 (48%), Gaps = 33/175 (18%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK----- 72
           + DVG+    T+LL+HG+ +     +L+   I  L + GFRV+A D LGHG SD+     
Sbjct: 45  YIDVGEAKQGTVLLMHGIPT---WGYLYHATIPPLVEAGFRVLAPDFLGHGWSDRRDRFD 101

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
              ++  R++      +S L  L + +V V+G+  G  +A  + + Y SYV  +I+    
Sbjct: 102 RSFQDQARMI------ISFLSALNLDQVDVVGHDTGGAVALILAIEYASYVNKLII--TN 153

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
           SV YD          D  +L    +  +P+  K R  ADL     ++AL   L+M
Sbjct: 154 SVCYDR--------FDDDML----DFGHPIKWKSRSVADL-----VEALEESLAM 191


>gi|160897439|ref|YP_001563021.1| alpha/beta hydrolase fold protein [Delftia acidovorans SPH-1]
 gi|160363023|gb|ABX34636.1| alpha/beta hydrolase fold [Delftia acidovorans SPH-1]
          Length = 254

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 116/257 (45%), Gaps = 25/257 (9%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
            + V     P I+L H L   +Q   ++ G  Q L D+ F V+ +D+ GHG+S    I  
Sbjct: 4   LHVVQQGQGPAIVLSHALGCDLQ---MWDGVAQALEDR-FTVVRYDHRGHGRSPA--IGE 57

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            + +  +A DA  ++E LG   VH +G SMG   A ++ + +P+ VRS+ +    S   +
Sbjct: 58  AFDMNDLADDAAGVIEALGQGPVHFVGLSMGGMTAQALAVRHPALVRSITIANSASYYDE 117

Query: 138 SDVVDWQSLIDSFLLPSI-----DEVQNPLGKKFR-----KFADLDPGNDLKALASCLSM 187
           +    WQ+ I +     +       +Q     +FR     + A L  G +  A     + 
Sbjct: 118 AARAGWQARIATVHDQGVAVIADGAMQRWFTPEFRTGQAARVASLRAGLEALAAKPYAAA 177

Query: 188 IRKPFC---QDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRDHLLA 241
                    ++   RI  P L+  GS+D+ A  P   +++ + IP +Q +++    HL A
Sbjct: 178 CAAVGGIDFRESNRRIACPALLIAGSRDE-ATPPALSEDMQAQIPGAQLVSLPAA-HLSA 235

Query: 242 VG-DKQFKQGVVNFYAN 257
           V    +F Q V +F A 
Sbjct: 236 VEMPVEFAQLVSDFVAQ 252


>gi|227507869|ref|ZP_03937918.1| alpha/beta hydrolase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227192652|gb|EEI72719.1| alpha/beta hydrolase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 280

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 109/242 (45%), Gaps = 36/242 (14%)

Query: 16  FAFYDVGDKDA-PTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSD 71
           +A+ ++G+K   P +  +H LA ++        W   + D   Q   VIAFDN G G S 
Sbjct: 22  YAYRELGEKKGVPVVFFVH-LAGTLDN------WDPRVVDGVAQNHWVIAFDNQGVGFS- 73

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
           +  + N      MA D+++ +  LG+ ++ V+ +SMG  IA  ++   PS VR +IL G 
Sbjct: 74  RGQVPNSIEQ--MARDSLTFIHALGLKEIDVLSFSMGGMIAQELIAIEPSLVRKLILAGT 131

Query: 132 G--------SVLYDSDVVDWQSL-----IDSFLLPSIDEVQNPLGKKF-----RKFADLD 173
           G        +V   SD    ++L     + ++L  +  +      K F      +  + D
Sbjct: 132 GPRGGEGIENVTKLSDRDSIRALLTLKDVKTYLFFTRTDNGKKKAKAFLLRLKERQENRD 191

Query: 174 PGNDLKALASCLSMIRK--PFCQDDLYRIDVPVLIAVGSQDDLAGSPQ--ELMSFIPSSQ 229
            G  LKA  + L  I         DL +I  P LI  G +D +  +    EL S IP+SQ
Sbjct: 192 KGISLKAYRTQLKAITAWGLALPADLSQIKQPTLIVNGDEDRMVPTVNSYELNSRIPNSQ 251

Query: 230 YL 231
            +
Sbjct: 252 LI 253


>gi|169628262|ref|YP_001701911.1| putative hydrolase, alpha/beta fold [Mycobacterium abscessus ATCC
           19977]
 gi|169240229|emb|CAM61257.1| Putative hydrolase, alpha/beta fold [Mycobacterium abscessus]
          Length = 292

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 94/201 (46%), Gaps = 23/201 (11%)

Query: 29  ILLIHGLASSVQTN--WLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           ++L+HG   S+Q +  W   G+I  L  Q +RV   D  GHG S+K      Y +   A 
Sbjct: 42  VVLVHG---SLQNSAVWSKHGYIAQLSQQ-YRVTTIDVRGHGASEKPDHPGGYAIASSAR 97

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV------GSVLYDSDV 140
           D  ++L+HL + + H +GYS+G RI  ++    P  + S+++ G       G+V    DV
Sbjct: 98  DVCAVLDHLQVHQAHYLGYSLGGRIGLTLAATAPERLTSLVVAGSSHRPQRGAV----DV 153

Query: 141 VDWQSLI----DSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALASCLSMI--RKPFC 193
           + + + I    +S L   ID  ++  G++    F         + LA+ L          
Sbjct: 154 LIFPNAIRVVEESGLPAFIDGWESHRGQRMASGFRATIEALGQRGLAALLRQWDDEPGVT 213

Query: 194 QDDLYRIDVPVLIAVGSQDDL 214
           ++ L +I+ P L   GS+D +
Sbjct: 214 EEALLQIETPTLFFAGSEDPM 234


>gi|104782955|ref|YP_609453.1| alpha/beta fold family hydrolase [Pseudomonas entomophila L48]
 gi|95111942|emb|CAK16667.1| putative hydrolase, alpha/beta fold family [Pseudomonas entomophila
           L48]
          Length = 270

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 88/207 (42%), Gaps = 20/207 (9%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y+   +  P +LL HGL SS Q +W           + +RVI  D  GHG+S K      
Sbjct: 13  YEEHGQGEPLVLL-HGLGSSSQ-DWELQ---VPEFSRHYRVILMDIRGHGQSAKP--RRG 65

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           YR+   + D ++LL+HLG   VH +G SMG  +     + +P ++RS+ +      +   
Sbjct: 66  YRIKTFSEDLLALLKHLGTGPVHFVGLSMGGMVGFQFAVDHPDWLRSLCIVNSAPEVKRR 125

Query: 139 DVVDWQSLIDSFLLP---SIDEVQNPLGKKF----------RKFADLDPGNDLKALASCL 185
              DW   +  + L    S++ V   L ++           RK A+    ND +A     
Sbjct: 126 TRSDWIWWLKRWGLARLLSVETVGKGLAQRLFPKPGQSELRRKMAERWARNDKRAYLKSF 185

Query: 186 SMIRKPFCQDDLYRIDVPVLIAVGSQD 212
             I     Q+ + +I  P L+     D
Sbjct: 186 DAIVDWGVQERIGQIRCPTLVIAADHD 212


>gi|228928222|ref|ZP_04091263.1| hypothetical protein bthur0010_29210 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228946784|ref|ZP_04109089.1| hypothetical protein bthur0007_29210 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228812908|gb|EEM59224.1| hypothetical protein bthur0007_29210 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228831269|gb|EEM76865.1| hypothetical protein bthur0010_29210 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 294

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +Y+ +  + GDK  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYEASVCEWGDKSNPQIICFHGLGS---TKLSFIEMAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFETDEDYGASHLINWVVALLEHIGKETFHLLAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|196032563|ref|ZP_03099977.1| hydrolase, alpha/beta fold family [Bacillus cereus W]
 gi|228915753|ref|ZP_04079335.1| hypothetical protein bthur0012_29720 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|229122704|ref|ZP_04251914.1| hypothetical protein bcere0016_29970 [Bacillus cereus 95/8201]
 gi|195995314|gb|EDX59268.1| hydrolase, alpha/beta fold family [Bacillus cereus W]
 gi|228660755|gb|EEL16385.1| hypothetical protein bcere0016_29970 [Bacillus cereus 95/8201]
 gi|228843928|gb|EEM88995.1| hypothetical protein bthur0012_29720 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 294

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +Y+ +  + GDK  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYEASVCEWGDKSNPQIICFHGLGS---TKLSFIEMAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFETDEDYGASHLINWVVALLEHIGKETFHLLAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|190890865|ref|YP_001977407.1| putative peroxidase protein [Rhizobium etli CIAT 652]
 gi|190696144|gb|ACE90229.1| putative peroxidase protein [Rhizobium etli CIAT 652]
          Length = 268

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 106/251 (42%), Gaps = 23/251 (9%)

Query: 9   RSWRKYQFAFYDVGDKDAPTILLIHG-LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           R+  +  +A Y  G    P ++L+HG L  S   NW +   +  L   G RV+  D+ GH
Sbjct: 30  RAGARIWYASYGAG----PAVILLHGGLGHS--GNWGYQ--VPALLQSGRRVVLIDSRGH 81

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+S +      Y L  MA+D +++++ L + K   +G+S GA IA  +    P+      
Sbjct: 82  GRSTRDARPYSYEL--MASDVLAVMDELSLEKAAFVGWSDGACIALILAATAPAR----- 134

Query: 128 LGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKF-ADLDPGNDLKALASCLS 186
              V  V + +  +D    ++    P ID   +   K +    A  D  N      S + 
Sbjct: 135 ---VAGVFFFACNMDPSGTLEFVATPVIDRCFSRHAKDYAALSATPDDFNGFIEAVSLMM 191

Query: 187 MIRKPFCQDDLYRIDVPVLIAVGSQDDL--AGSPQELMSFIPSSQYLNICRRDHLLAVG- 243
                +  +DL RI VPV I +G  D+       + L   IP +  + +    H   +  
Sbjct: 192 RTEPNYRAEDLSRIRVPVAIVLGEHDEFIKPAHAEYLARSIPDAHMITLKGVSHFAPLQR 251

Query: 244 DKQFKQGVVNF 254
             +F   V++F
Sbjct: 252 PAEFNAAVLSF 262


>gi|163858852|ref|YP_001633150.1| 3-oxoadipate enol-lactone hydrolase [Bordetella petrii DSM 12804]
 gi|163262580|emb|CAP44883.1| 3-oxoadipate enol-lactone hydrolase [Bordetella petrii]
          Length = 259

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 100/235 (42%), Gaps = 39/235 (16%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  DAP ++L + L +      +++  +  L    FRV+ +D  GHGKS  S    +Y  
Sbjct: 17  GPADAPVLVLSNSLGTCAD---MWARQVPALSRH-FRVLRYDTRGHGKS--SVPAGEYSF 70

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +A D   LL+HL I++    G SMG      + L +P  VR ++L    + +    V 
Sbjct: 71  AQLAGDVAELLDHLNIAQADFCGLSMGGPTGLQLALDHPQRVRKLVLSNTAARI--GSVE 128

Query: 142 DWQS----------------LIDSFLLPSIDEVQNPLGK----KFRKFADLDPGNDLKAL 181
            W +                L++ +L P+    Q  L +      R+ ++       +  
Sbjct: 129 GWSARIAAVAQNGLEAMAPGLVERWLSPAFRAEQPGLTQVLVDMLRRISN-------EGY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ---ELMSFIPSSQYLNI 233
           +   + +R    +  L  I  P L+  G+QD  A +PQ   EL + I  ++Y+ +
Sbjct: 182 SGNCAALRDADLRGRLGEIKAPTLVIAGTQDP-AATPQDGRELAAGIAGARYVEL 235


>gi|323484061|ref|ZP_08089431.1| hypothetical protein HMPREF9474_01180 [Clostridium symbiosum
           WAL-14163]
 gi|323402503|gb|EGA94831.1| hypothetical protein HMPREF9474_01180 [Clostridium symbiosum
           WAL-14163]
          Length = 248

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 100/211 (47%), Gaps = 38/211 (18%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y    K  P +L +HG  +S +   +F   + L  D+ F VI  D LGHGKSD+  IE 
Sbjct: 12  YYTESGKGKP-VLFLHGNTASSR---MFELLLPLYEDR-FHVILIDFLGHGKSDR--IEE 64

Query: 78  DYRLVFM--AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
               ++M  A   ++LLEHL + KV+++G S GA +A +  L  P        G VG V+
Sbjct: 65  FPAELWMEEARQTIALLEHLKLEKVNLVGTSGGAWVAVNTALERP--------GLVGRVV 116

Query: 136 YDSDVVDWQSLIDSFLLPSIDE-------------VQNPLGKKFRKFADLDPGNDLKALA 182
            DS   D ++L D F    I E              Q   G+ + +  DLD    L+   
Sbjct: 117 ADS--FDGRTLADDFSKNLIQERTGAKTDNMAVEFYQWCQGEDWERIVDLDTKALLQCAG 174

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD 213
             L +  KP     L+ + VP+L+ +GS+ D
Sbjct: 175 EKLPLFSKP-----LHSLQVPLLL-MGSEGD 199


>gi|317401144|gb|EFV81794.1| 3-oxoadipate enol-lactone hydrolase [Achromobacter xylosoxidans
           C54]
          Length = 259

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 112/255 (43%), Gaps = 28/255 (10%)

Query: 18  FYDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           FY + G  DAP ++L + L ++     +++  +  L    FRV+ +D  GHGKS  S  +
Sbjct: 12  FYVIDGPADAPVLVLSNSLGTNAD---MWARQVPALSKH-FRVLRYDTRGHGKS--SIPD 65

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
            +Y    +  D   LL HL I + H  G SMG      + L  P  +  +IL    + + 
Sbjct: 66  GEYSFAQLGNDVAELLAHLNIERAHFCGLSMGGPTGLWLALNRPELIGKLILCNTAARIG 125

Query: 137 DSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRK--FADLDPG------------NDLKALA 182
            ++   W + I +    +++++   L +++    +   +PG             D     
Sbjct: 126 SAE--GWSARIAAVAEQTLEKMAPTLVERWLTDGYRAAEPGLSQVLVDMLRRTPDAGYSG 183

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRDHL 239
           +C ++    F ++ +  I  P L+ + S  DLA +P   QEL + I  ++YL +      
Sbjct: 184 NCAALRDADF-REQVSAITAPTLV-ISSTHDLAATPAQGQELAAAINGARYLELNTSHIS 241

Query: 240 LAVGDKQFKQGVVNF 254
                + F + VV+F
Sbjct: 242 NWEQPEAFTRAVVDF 256


>gi|254823010|ref|ZP_05228011.1| LipG [Mycobacterium intracellulare ATCC 13950]
          Length = 301

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 58/115 (50%), Gaps = 22/115 (19%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + D+GD D P +LLI GL +  Q     + + Q L DQG RVI +DN   G S K+   +
Sbjct: 17  YEDMGDVDDPPVLLIMGLGA--QLLLWRTAFCQKLIDQGLRVIRYDNRDVGLSSKTQYGS 74

Query: 78  D--------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
                                Y+L  MA DA ++L+HLGI + H++G SMG  IA
Sbjct: 75  SGQPLATRLVRSWLGLPSRAVYKLEDMADDAAAVLDHLGIERAHIVGASMGGMIA 129


>gi|182413998|ref|YP_001819064.1| alpha/beta hydrolase fold [Opitutus terrae PB90-1]
 gi|177841212|gb|ACB75464.1| alpha/beta hydrolase fold [Opitutus terrae PB90-1]
          Length = 273

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 117/249 (46%), Gaps = 21/249 (8%)

Query: 18  FYDV-GDKDAPT--ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           +Y++ G   A T  ++L+HG   +++T+  F   + +L  +  RVIA +  G+G +    
Sbjct: 23  YYEIHGPAKATTTPLVLLHGGGDTIETS--FGALLPVLA-RTRRVIALEQQGYGHT-ADV 78

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            +  +     A D  +LL HLGI++  ++G+S G  IA  + + +P  VR ++L    + 
Sbjct: 79  PDRPFTFEQSADDTAALLAHLGIARADLLGFSNGGTIALQVAIRHPQCVRKLVLVSTLTF 138

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF-- 192
            + +D   W+ + ++ L     E+Q+     +RK A   P N L+ +    +   + F  
Sbjct: 139 RHGADPALWEWMKNARLENMPVELQD----AYRKVAP-QPEN-LRLMHDKAAQRMRDFRD 192

Query: 193 -CQDDLYRIDVPVLIAVGSQDDLAGSPQ---ELMSFIPSSQYLNICRRDHLLAVGDKQFK 248
              D L  I  P L+ VG  D +   P+   EL   +P +Q   +   DH+  +   +  
Sbjct: 193 IPSDALRAITAPALVIVGDTDVI--RPEHALELARLLPHAQLAVLPATDHMAIMHRTELL 250

Query: 249 QGVVNFYAN 257
           + ++  + N
Sbjct: 251 EPMLTRFLN 259


>gi|49478061|ref|YP_037277.1| hydrolase [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|49329617|gb|AAT60263.1| possible hydrolase [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 294

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +YQ +  + GDK  P I+  HGL S   T   F    + L D+ + +++FD  G
Sbjct: 4   FFVEFGEYQASVCEWGDKSNPQIICFHGLGS---TKLSFIEMAEFLKDK-YHIVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFEKDEDYGASHLINWLVALLEHIGKETFHIVAHSWGASVALHYAAERPEKVNEM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|56965198|ref|YP_176930.1| hypothetical protein ABC3436 [Bacillus clausii KSM-K16]
 gi|56911442|dbj|BAD65969.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 303

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  + + G++ + T++L+HG   S    W+   ++     + +RV+A D  G+G SDK  
Sbjct: 23  QLHYVEGGEQHSNTVVLLHGFPQS----WVLWRFVIPDLVKRYRVLAVDLRGYGDSDKPE 78

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
               Y    MA D   L+ HL + KV ++G+  GAR+A    L YP YV S+ L
Sbjct: 79  GIEGYTKANMAKDIYDLVTHLRLEKVTLIGHDRGARVARRFALDYPDYVASLCL 132


>gi|182678796|ref|YP_001832942.1| alpha/beta hydrolase fold [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634679|gb|ACB95453.1| alpha/beta hydrolase fold [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 285

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 102/229 (44%), Gaps = 43/229 (18%)

Query: 15  QFAFYDVGDKDA-PTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKS 70
           ++A+   G  +  P +LL H +A+    +W    W  LL D   +   VI FDN G G S
Sbjct: 18  RYAYRRFGKHNGTPLLLLPHFIAT---MDW----WDPLLVDGLAETREVILFDNRGVGLS 70

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-- 128
                E   R+  MAAD  + +  LG+++V V+G+S+G  +A  + L YP  VR ++L  
Sbjct: 71  SG---ETPDRIATMAADVHAFIHGLGLARVDVLGFSIGGMVAQELALLYPDDVRKLLLVG 127

Query: 129 ----GGVGSVLYDSDVVDWQSLIDS---------FLLPSIDEVQNPLGKKF-----RKFA 170
               GG G      DVV  ++L ++         FL  S  E       +F      +  
Sbjct: 128 TGPRGGEGMQEPKPDVV--KALTEAGPDPKSARPFLFFSQSENGRTEAARFTARNAERTV 185

Query: 171 DLDPGNDLKALASCLSMI----RKPFCQDDLYRIDV---PVLIAVGSQD 212
           DLDPG  ++ L +    +    R     D L R+     P L+A G+ D
Sbjct: 186 DLDPGASMQTLQAQSEALGEWGRAASHTDYLARLRTLLHPTLVANGNDD 234


>gi|226309351|ref|YP_002769311.1| hydrolase [Rhodococcus erythropolis PR4]
 gi|226188468|dbj|BAH36572.1| putative hydrolase [Rhodococcus erythropolis PR4]
          Length = 270

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 118/281 (41%), Gaps = 35/281 (12%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFR 58
           M++  + F +    +  +Y+    + P ++L HGL  +         W Q +    Q +R
Sbjct: 1   MISRTEGFITVADGERVWYETA-GEGPDLILTHGLGGNAAV------WYQQVPYFAQHYR 53

Query: 59  VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
           VI++D  G G+S     + ++  V   +D + ++  L + + HV+G SMG   A    + 
Sbjct: 54  VISWDQRGFGRSTNE--KGNHGPVAAVSDLIEIMNLLEVDRAHVVGQSMGGWAALGTAIA 111

Query: 119 YPSYVRSVIL----GGV-------GSVLYDSDVVDWQSLID----SFLLPSIDEVQNPLG 163
            P  V SV+L    GG+       G+    +  V  + L +       LPS+D  +  L 
Sbjct: 112 VPERVESVVLACTTGGIPVGFGPDGAPPLTAAPVTARPLGEHPAVGGRLPSLDMARAYLY 171

Query: 164 KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMS 223
           +    F    P  +   +    +     +   DL  +  PVL+  G  DDL  +P+ + S
Sbjct: 172 QALGTFGHRPPDTEFFRILKAHN-----YSPSDLAAVTAPVLLIAGELDDLM-TPERIRS 225

Query: 224 ---FIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYANELRA 261
              F+P ++ + +  R H     D      +V  +  ++RA
Sbjct: 226 AAEFLPHAEVVELADRGHSPYFEDPHAWNELVAHFLADVRA 266


>gi|121716094|ref|XP_001275656.1| epoxide hydrolase, putative [Aspergillus clavatus NRRL 1]
 gi|119403813|gb|EAW14230.1| epoxide hydrolase, putative [Aspergillus clavatus NRRL 1]
          Length = 333

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
             Y + +         +IL +HG  SS   +W     I    D+G+ V+A D LG+G + 
Sbjct: 19  HTYNYVYQAPASSSHTSILFLHGFPSSCY-DWRHQ--ISYFTDKGYGVLAPDLLGYGGTS 75

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           K      Y+L  MAA+ V LL+H G+++VH++ + MG  +   +  ++P
Sbjct: 76  KPAATEKYKLKSMAAEIVELLDHEGLARVHIVAHDMGCNLLSRLADYFP 124


>gi|327190706|gb|EGE57788.1| putative peroxidase protein [Rhizobium etli CNPAF512]
          Length = 268

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 107/252 (42%), Gaps = 25/252 (9%)

Query: 9   RSWRKYQFAFYDVGDKDAPTILLIHG-LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           R+  +  +A Y  G    P ++L+HG L  S   NW +   +  L   G RV+  D+ GH
Sbjct: 30  RAGARIWYASYGAG----PAVILLHGGLGHS--GNWGYQ--VPALLQSGRRVVLIDSRGH 81

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+S +      Y L  MA+D +++++ L + K   +G+S GA +A  +    PS      
Sbjct: 82  GRSTRDARPYSYEL--MASDVLAVMDELSLDKAAFVGWSDGACVALILAATAPSR----- 134

Query: 128 LGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKF-ADLDPGNDLKALASCLS 186
              V  V + +  +D    ++    P ID   +   K +    A  D  N      S + 
Sbjct: 135 ---VAGVFFFACNMDPSGTLEFVATPVIDRCFSRHAKDYAALSATPDDFNGFVEAVSLMM 191

Query: 187 MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNICRRDHLLAVG 243
                +  +DL RI VPV + +G  D+    P+    L   IP +Q + +    H   + 
Sbjct: 192 RTEPNYRAEDLSRIRVPVAVVLGEHDEFI-KPEHAEYLARSIPDAQMITLKGVSHFAPLQ 250

Query: 244 -DKQFKQGVVNF 254
              +F   V +F
Sbjct: 251 RPAEFNAAVFSF 262


>gi|115489754|ref|NP_001067364.1| Os12g0636400 [Oryza sativa Japonica Group]
 gi|77557178|gb|ABA99974.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa
           Japonica Group]
 gi|113649871|dbj|BAF30383.1| Os12g0636400 [Oryza sativa Japonica Group]
 gi|125537544|gb|EAY84032.1| hypothetical protein OsI_39263 [Oryza sativa Indica Group]
 gi|125580194|gb|EAZ21340.1| hypothetical protein OsJ_36997 [Oryza sativa Japonica Group]
          Length = 320

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 9/113 (7%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           G  D P +LLIHG         L+  W   +  L  +GFR +A D  G+G S        
Sbjct: 24  GPADGPPVLLIHGFPE------LWLSWRHQMAALAARGFRALAPDLRGYGDSTVPDDPAA 77

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
           Y +  +  D V+LL+HL + KV V+G+ +GA++A  + LF P  + +V+  GV
Sbjct: 78  YTVFHIVGDLVALLDHLALPKVMVVGHDLGAQVAWHLCLFRPDMLLAVVNLGV 130


>gi|310829259|ref|YP_003961616.1| hypothetical protein ELI_3697 [Eubacterium limosum KIST612]
 gi|308740993|gb|ADO38653.1| hypothetical protein ELI_3697 [Eubacterium limosum KIST612]
          Length = 240

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 110/225 (48%), Gaps = 33/225 (14%)

Query: 11  WRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS 70
           W +     Y+     AP ++L HG     +    FSG I     + ++++  D+ GHG+S
Sbjct: 9   WNRGASIHYETVGDGAPLVML-HGNGGDKED---FSGLIDYFLPR-YQIVLVDSRGHGRS 63

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D   ++    L  MA D +++++HLG+++  ++G+S GA IA  + +  P  V++VI   
Sbjct: 64  DTGSLKLTTGL--MAEDVLAVMDHLGVAEAIILGFSDGANIALELAVQAPERVQAVI--- 118

Query: 131 VGSVLYDSDVVDWQSLIDSFLLPS------IDEVQNPLGKKFRKFADLDPGNDLKALASC 184
             +V  ++D    ++L   F+         ++++  P+G + +++  +           C
Sbjct: 119 --AVSGNTDPKGMRALPYLFIKLQYRFWSFLEKLGLPVGNRPQRYGLM-----------C 165

Query: 185 LSMIRKPFCQDDLYRIDVPVLIAVGSQDDL-AGSPQELMSFIPSS 228
            S        ++L RID PVL+  G++D +  G  +++  +IP +
Sbjct: 166 WS---PRLSGEELRRIDSPVLLLAGTRDLIRTGHTRQMAEWIPGA 207


>gi|312139416|ref|YP_004006752.1| lipase [Rhodococcus equi 103S]
 gi|325672697|ref|ZP_08152393.1| alpha/beta hydrolase fold family hydrolase [Rhodococcus equi ATCC
           33707]
 gi|311888755|emb|CBH48067.1| putative lipase [Rhodococcus equi 103S]
 gi|325556574|gb|EGD26240.1| alpha/beta hydrolase fold family hydrolase [Rhodococcus equi ATCC
           33707]
          Length = 345

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 73/150 (48%), Gaps = 13/150 (8%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           FR+   Y+ AF   G+   P +LLIHG+  +  T   +S  I  L ++ + VIA D LGH
Sbjct: 21  FRTIHGYRRAFRIAGE--GPALLLIHGIGDNSST---WSEIIPHLAEK-YTVIAPDLLGH 74

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+SDK     DY +   A     LL  L + KV V+G+S+G  +A      +P  V  ++
Sbjct: 75  GRSDKP--RADYSVAAYANGMRDLLSVLDVDKVTVVGHSLGGGVAMQFAYQFPHMVDRLV 132

Query: 128 LGGVGSVLYDSDVVDWQSLIDSFLLPSIDE 157
           L   G V  D        L+    +P ++E
Sbjct: 133 LVSAGGVTKDV-----HPLLRLITMPVVNE 157


>gi|302530749|ref|ZP_07283091.1| predicted protein [Streptomyces sp. AA4]
 gi|302439644|gb|EFL11460.1| predicted protein [Streptomyces sp. AA4]
          Length = 250

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 106/253 (41%), Gaps = 22/253 (8%)

Query: 20  DVGDKDAP--TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           D G  + P  +ILL+HGL    +T W  + W++       RV A D  GHG++  S    
Sbjct: 7   DFGGDERPGVSILLLHGLMGRARTWWPVAQWLKRYG----RVRALDARGHGRAPHS---G 59

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            +     A D   +L  LG S   ++G+SMG   A +    YP  VR+V+          
Sbjct: 60  PWTTEQFAEDIADVLAELGPSV--LIGHSMGGLHAWATAAKYPELVRAVVSEDFAPDQRG 117

Query: 138 SDVVDWQSLIDSFLLP--SIDEVQNPLGKKFRKFADL----DPGNDLKALASCLSMIRKP 191
             V  W+   +S+ +P  S+  V+   G     F +     + G  L A    L  I   
Sbjct: 118 RTVETWRGYFESWPVPFESLAHVREFFGAAGDYFTECVEEREDGYHLIADLEHLYEIAAE 177

Query: 192 FCQDDLYR----IDVPVLIAVGSQDDL-AGSPQELMSFIPSSQYLNICRRDHLLAVGDKQ 246
           + + D +     I  P+L+  G    + AG   E+ + +P +++L +    HL      +
Sbjct: 178 WGRRDYWSIVDGIRCPLLLVEGEHTAMPAGQQAEVAARVPGAKHLVVPGSAHLPHAEAPE 237

Query: 247 FKQGVVNFYANEL 259
             +G V  + + L
Sbjct: 238 TYRGAVEAFLSGL 250


>gi|255030444|ref|ZP_05302395.1| hypothetical protein LmonL_17531 [Listeria monocytogenes LO28]
          Length = 235

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 4/133 (3%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P +L++HG   + +T   F   I  L  + F +IA D LGHG +      + Y +  +
Sbjct: 1   EKPALLMLHGFTGTSET---FQDSISGL-KKRFNIIAPDLLGHGNTASPEEISSYTMENI 56

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ 144
             D   +L  L +S+  V+GYSMG R+A +    +P  VR +IL      L   D+   +
Sbjct: 57  CEDLAGILHQLNVSRCFVLGYSMGGRVATAFAATFPKRVRGLILVSSSPGLEQEDIRASR 116

Query: 145 SLIDSFLLPSIDE 157
              D+ L   I+E
Sbjct: 117 VEADNRLADWIEE 129


>gi|329923242|ref|ZP_08278727.1| putative 3-oxoadipate enol-lactonase [Paenibacillus sp. HGF5]
 gi|328941477|gb|EGG37768.1| putative 3-oxoadipate enol-lactonase [Paenibacillus sp. HGF5]
          Length = 275

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 121/278 (43%), Gaps = 32/278 (11%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           M+N + FF +    + A+   G    P ++L + +A+++    ++ G I  L +  F V+
Sbjct: 10  MINGLNFFTTIDGVRIAYRMDGPAGKPVLMLANSIATTMH---MWDGQIADLSEH-FLVL 65

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
            +D  GHG+SD    E  Y    +  D + LL+ L I +VH +G S+G  +A  + +  P
Sbjct: 66  RYDYRGHGESDTP--EVPYSFDRLGRDVIELLDSLHIDRVHFLGLSLGGAVAQWLAIHAP 123

Query: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFL----LPS-------------IDEVQNPLG 163
             +  ++L    S L  ++   WQ LI S L    LP              + E +N + 
Sbjct: 124 ERIDRLVLSNTSSYLGPAE--QWQGLITSVLQRENLPEFADTFMKNWFPSHMVESENEIV 181

Query: 164 KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA-GSPQELM 222
             FR+            +A   + IR    +     I  P L+  G  D +   S  EL+
Sbjct: 182 ASFREMV---LSTRPHGIAGSWAAIRDMDMRRTASLISSPTLVISGQYDTVTLPSHGELI 238

Query: 223 S-FIPSSQYLNICRRDHLLAVG-DKQFKQGVVNFYANE 258
           +  +P+S+++ +    HL  V    +F   V+ F  +E
Sbjct: 239 AKTVPNSKFV-LFPSVHLTNVEYQSEFLSTVLEFLQSE 275


>gi|254490618|ref|ZP_05103804.1| hydrolase, alpha/beta fold family, putative [Methylophaga
           thiooxidans DMS010]
 gi|224464362|gb|EEF80625.1| hydrolase, alpha/beta fold family, putative [Methylophaga
           thiooxydans DMS010]
          Length = 254

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 106/257 (41%), Gaps = 51/257 (19%)

Query: 29  ILLIHGLASSVQTNW-----LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           +L+IHGL  S   NW      FS +        F+VI+ D   HG+S  S  ++      
Sbjct: 14  LLIIHGLFGS-SDNWRSMARYFSKF--------FQVISLDLRNHGQSPHSEKQD---FTL 61

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY------- 136
           MA D  +L + LGISK HV+G+S+G ++A      YP  V  +++  +    Y       
Sbjct: 62  MAEDVRALCDSLGISKAHVLGHSLGGKVAMQFAAHYPQSVDKLVVVDISPRQYFSQHTPM 121

Query: 137 -------DSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGND---------LKA 180
                  D D    +S ID  L  SI +      K  R+F  ++   D         L A
Sbjct: 122 MDTMMALDMDQYASRSEIDEALSASISD------KTVRQFLLMNLRTDESGFSWRINLPA 175

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE--LMSFIPSSQYLNICRRDH 238
           L      +  P C   +  +D+P L   G+  D   +     +      ++++ I +  H
Sbjct: 176 LKQNYQQLMAPVCTTAV--LDMPSLFVYGALSDYVNTQDRTLIQQHFTQAEFVAIEKAGH 233

Query: 239 LL-AVGDKQFKQGVVNF 254
            + A   +QFKQ V  F
Sbjct: 234 WVHAEKPQQFKQIVEEF 250


>gi|297197317|ref|ZP_06914714.1| alpha/beta hydrolase [Streptomyces sviceus ATCC 29083]
 gi|197714889|gb|EDY58923.1| alpha/beta hydrolase [Streptomyces sviceus ATCC 29083]
          Length = 257

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 109/242 (45%), Gaps = 30/242 (12%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +  +  G      ++L+HG A +V     FS  +  L      V+A +  GHG +  +  
Sbjct: 20  YETHGTGPGQGRPLVLLHGGALTV--GLTFSAVLPALAAD-RPVVAPELQGHGHTADT-- 74

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
           + +  + ++AAD V LL+ LGI +   +G+S+G  +A  + + +P  V  + L    + +
Sbjct: 75  DREMTVPYLAADVVGLLDELGIRQADFLGFSLGGLVALEIAVRHPERVGRLAL---AATM 131

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADL------DPGN--DLKALASCLSM 187
           Y  D V      D   +P     + P    F+  AD        PG+  D  A  S  + 
Sbjct: 132 YTQDGVH-----DDVRVPDYGSPRLPSQDDFQGMADAYAVTAPHPGHFQDFLAKVSAAAH 186

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQD----DLAGSPQEL-----MSFIPSSQYLNICRRDH 238
              P+  DDL  + +P L+ VG +D    + A   Q+L     ++ +P++ ++ + +R  
Sbjct: 187 APLPWTADDLRGLRMPTLLLVGDRDFVRVEHAAEMQQLIPEAQLAVLPATTHMTLMQRTS 246

Query: 239 LL 240
           LL
Sbjct: 247 LL 248


>gi|94498923|ref|ZP_01305461.1| epoxide hydrolase-related protein [Oceanobacter sp. RED65]
 gi|94428555|gb|EAT13527.1| epoxide hydrolase-related protein [Oceanobacter sp. RED65]
          Length = 151

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 46/81 (56%)

Query: 52  LCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARI 111
           L + G+RVIA D  G G SD     +DY    +AAD V++L+ L I KV V+G+  GA I
Sbjct: 37  LLEAGYRVIAPDTRGRGASDMPSNVSDYHWSLLAADMVAILDKLDIKKVQVVGHDWGAFI 96

Query: 112 ACSMVLFYPSYVRSVILGGVG 132
              M + YP YV+  I   VG
Sbjct: 97  GWQMAISYPGYVQKYITLSVG 117


>gi|119715304|ref|YP_922269.1| alpha/beta hydrolase fold [Nocardioides sp. JS614]
 gi|119535965|gb|ABL80582.1| alpha/beta hydrolase fold protein [Nocardioides sp. JS614]
          Length = 297

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 97/246 (39%), Gaps = 58/246 (23%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD--- 71
           +  +   GD D   +LL+ GL   +  NW        L   GF VI +DN   G+S    
Sbjct: 16  ELCYQTFGDPDDDPLLLVMGLGGPM--NWWDPELCAALARAGFYVIRYDNRDTGRSTVLQ 73

Query: 72  -------------KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
                           +   Y +  +A DA  LL+HLG+   HV+G SMG  I  +M + 
Sbjct: 74  APVRRATLVRAFAGGRVRAPYDMRDLAEDAFGLLDHLGLESAHVVGVSMGGMIVQTMAIT 133

Query: 119 YPSYVRSV--ILGGVGSVLYDSDVVDWQ---------------------------SLIDS 149
            P+ VRS+  I+   G        V WQ                           +LI S
Sbjct: 134 RPARVRSMTSIMSTTG-----KRTVGWQHPSLLPALIARRKPGREAYIRTSAMVWTLIGS 188

Query: 150 FLLP-SIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAV 208
              P  + E++   G+ + +   +DP   ++ +   L+++ +P   D L  + VP L+  
Sbjct: 189 PAFPLDLAEIEKRAGETYDR--GVDPRGVMRQM---LAVLTQPSRGDRLRAVRVPTLVVH 243

Query: 209 GSQDDL 214
           G  D +
Sbjct: 244 GMADKM 249


>gi|126437721|ref|YP_001073412.1| alpha/beta hydrolase fold [Mycobacterium sp. JLS]
 gi|126237521|gb|ABO00922.1| alpha/beta hydrolase fold protein [Mycobacterium sp. JLS]
          Length = 341

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G++ AP ++L HG    +  +W     I +L + G+ VIA D  G+G+S +     DY
Sbjct: 52  EAGERGAPVVVLAHGF-PELAYSWRHQ--IPVLAEAGYHVIAPDQRGYGESSRPEAVTDY 108

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +V +  D   LL+ +G  +  V+G+  G+ +  +  L YP  V  ++   V  V   SD
Sbjct: 109 DIVALTGDLAGLLDDVGAQRAVVVGHDWGSPVVTNFALLYPDRVAGMVNLSVPPVPRASD 168


>gi|325959734|ref|YP_004291200.1| alpha/beta hydrolase fold protein [Methanobacterium sp. AL-21]
 gi|325331166|gb|ADZ10228.1| alpha/beta hydrolase fold protein [Methanobacterium sp. AL-21]
          Length = 257

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 106/238 (44%), Gaps = 31/238 (13%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Y   +Y+   K  PTI L HGL+ S Q        I      G + I  D  GHG+SD  
Sbjct: 8   YAQIYYNTHGKGDPTIFL-HGLSDSSQFFKPLKNNIT-----GIKAIQPDLRGHGESDHD 61

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL----G 129
               D  +  +  D ++LL  L I + +++G+S+G+ IA +  L +P +V+S+I+     
Sbjct: 62  V---DISMELLTEDLINLLNELHIKRANILGFSLGSLIAQNFALEFPEHVKSLIICSGYS 118

Query: 130 GVGSVLYDS----DVVDWQSLIDSFLLPSIDEVQNP----LGKKFRKFADLD-PGNDLKA 180
             G  L ++    + +  Q  + +F    I  V         ++   F D+    N   A
Sbjct: 119 KCGHELSETFKKLEDLTSQGGVPAFFDEMIKLVYTKDYLLKHREIYGFKDMAVQTNSKAA 178

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDH 238
           +   LS+ R    +  L  I+VP LI  GS+D L   P E      SSQ ++ C+  H
Sbjct: 179 VLKSLSICRTFDVESRLSEINVPTLIMYGSEDILV--PPE------SSQKMH-CKLTH 227


>gi|319793133|ref|YP_004154773.1| alpha/beta hydrolase fold protein [Variovorax paradoxus EPS]
 gi|315595596|gb|ADU36662.1| alpha/beta hydrolase fold protein [Variovorax paradoxus EPS]
          Length = 283

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 114/256 (44%), Gaps = 63/256 (24%)

Query: 15  QFAFYDVGDKDA--PTILLIHGLASSVQTNWLFSGWIQLLCDQGF----RVIAFDNLGHG 68
           +FA+ ++G ++   P + LIH LA+      +   W   + D GF    RVIAFDN G G
Sbjct: 23  RFAYRELGTQNPGPPVVFLIH-LAA------VLDNWDPRVVD-GFAARHRVIAFDNRGVG 74

Query: 69  KSD---KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS 125
            S     + IE+      MA DA++ ++ LG+  V + G+SMG  +A  +V   P  VR 
Sbjct: 75  ASSGAPAASIED------MARDAITFIQALGLGPVDLFGFSMGGMVAQDIVRMAPQLVRR 128

Query: 126 VILGGVGSVLYDSDVVDWQSLIDSF-LLPSIDEVQNP--------------LGKKF-RKF 169
           +IL G G      + +   + +  F +L  +   Q+P               GK F ++ 
Sbjct: 129 MILTGTGPA--GGEGIAKVARVTYFDMLRGLLTGQDPKQFLFFTRTPEGIRAGKAFLQRL 186

Query: 170 ADLDPGND----LKALASCLSMIR-----KPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE 220
           A+     D    + AL + L  +R     KP    DL ++  PVL+A G  D +      
Sbjct: 187 AERSDNRDKAITVAALQAQLKALRRWGNGKP---ADLSKVQQPVLVANGDSDRM------ 237

Query: 221 LMSFIPSSQYLNICRR 236
               +PSS    + RR
Sbjct: 238 ----VPSSNTHEMARR 249


>gi|307327719|ref|ZP_07606903.1| alpha/beta hydrolase fold protein [Streptomyces violaceusniger Tu
           4113]
 gi|306886617|gb|EFN17619.1| alpha/beta hydrolase fold protein [Streptomyces violaceusniger Tu
           4113]
          Length = 289

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 100/228 (43%), Gaps = 29/228 (12%)

Query: 58  RVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
           R +A D  GHG+SDK   E  +       DA + +E LG++ V ++G++MGA  A  +  
Sbjct: 63  RAVALDQRGHGRSDKP-AEGPFDRSTYVDDAEAAVEQLGLAPVTLIGHAMGALTAWQLAA 121

Query: 118 FYPSYVRSVILGGV-GSVLYDSDVVDWQSLIDSFLLPSID---------------EVQNP 161
             P  VR++++  +  S L  +   +W     S+ +P                  E  NP
Sbjct: 122 RRPDLVRALVICDMRASALGAASQREWAEWFRSWPVPFATLADVRRWFGEDDPALERPNP 181

Query: 162 LGKKFRKFADL--DPGNDLKALASCLSMI--RKPFCQD----DLYRIDVPVLIAVGSQDD 213
               F  FA++  +  +  +   SC  M+  R+ + +D    +L  ++ P L+  G   +
Sbjct: 182 ARGDF--FAEVMAERSDGWRPAFSCRQMLKARETWVRDAHWEELALVECPTLVVRGLDGE 239

Query: 214 LA-GSPQELMSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVNFYANEL 259
           L     QE++  +P  QY  +    HL+       +++ V  F A+ L
Sbjct: 240 LGRAEAQEMVRVLPHGQYAEVVDAGHLVHYDQPDGWRRAVEPFLASAL 287


>gi|90425752|ref|YP_534122.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB18]
 gi|90107766|gb|ABD89803.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB18]
          Length = 287

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 102/226 (45%), Gaps = 38/226 (16%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSDK 72
           Q  + +VGD     ILL+H  A        ++ W   +    +G R I++   G+  S  
Sbjct: 11  QLYYEEVGD--GTPILLLHEFAGD------YASWEPQMRAFARGHRCISYSARGYTPSHI 62

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
              + DY    +  DA+++L+HL I+  H +G SMGA  A  + L  PS V S+ L G+G
Sbjct: 63  PDNDTDYDYHHVRDDAIAILDHLRIAAAHFVGLSMGAYSALQVALHVPSRVLSLTLAGIG 122

Query: 133 SVLYDSDVVDW-----QSLIDSFL---LPSIDE------------VQNPLGKKFRKFADL 172
           S  +++D ++      ++  D F     P I +            V++P G  FR F D 
Sbjct: 123 SG-FEADRLEAYRARCRAEADEFERGGAPEITKLAGLTPGRIPFLVKDPRG--FRDFHDA 179

Query: 173 DPGNDLKALASCLSMI---RKPFCQ--DDLYRIDVPVLIAVGSQDD 213
              +D    A  +      R P  +  + + ++ +P LI VG +DD
Sbjct: 180 LGEHDANGAARTMRNFQGARPPLSEFKEAIAKLSLPTLIIVGDEDD 225


>gi|209517266|ref|ZP_03266110.1| alpha/beta hydrolase fold [Burkholderia sp. H160]
 gi|209502275|gb|EEA02287.1| alpha/beta hydrolase fold [Burkholderia sp. H160]
          Length = 279

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 108/253 (42%), Gaps = 59/253 (23%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y +  + A  ++ IHG+ S ++    + G    LCD  FR++ FD  GHG+S  S+I   
Sbjct: 26  YRLQGRGARQLICIHGVGSYLEA---WEGVATHLCDD-FRILTFDLRGHGES--SHILGR 79

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---------- 128
           Y +     D ++L +H+G    ++ G+S+G  IA  M L +P  +R + L          
Sbjct: 80  YEIDEFVDDTLALADHVGFETFNLAGFSLGGLIAQRMALSHPQRLRGLALLATVSGRTRE 139

Query: 129 -------------GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLD 173
                         G     YD+ +  W  L + F      + +NP    +  ++ A+ D
Sbjct: 140 ERSRVLERLAALQNGERGAHYDASLSRW--LTEDF------QARNPEMVAYLRKRNAEND 191

Query: 174 PGNDLKALASCLSMIRKPFCQDD----LYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQ 229
           P         C +   +   + D    + +I VP LIA G +DD   +P+        ++
Sbjct: 192 P--------HCYAAAYRVLAETDFGGLIDQIRVPTLIATG-EDDQGSNPR-------MAR 235

Query: 230 YLNICRRDHLLAV 242
           Y++ C  D  L +
Sbjct: 236 YMHECIEDSQLEI 248


>gi|255710004|gb|ACU30832.1| lipase/esterase [uncultured bacterium]
          Length = 242

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 98/236 (41%), Gaps = 46/236 (19%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           GF+ I FDN G G SDK   E +Y +  MA DA +LL  L I +  V G SMG  IA  +
Sbjct: 19  GFKCIYFDNRGTGLSDKP--EGNYTVELMAEDASNLLAALKIPRAKVFGVSMGGMIAQEL 76

Query: 116 VLFYPSYVRSVILG----GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF----- 166
            L +P  V  V+LG    G  S    +  V  Q +  + L+       NP  K F     
Sbjct: 77  TLRHPEQVAKVVLGCTFPGGPSAKLGAPEVTMQLMEGTKLM-----AVNP-DKAFDLILP 130

Query: 167 ----RKFADLDPGNDLKALA-SCLSMIRKPFCQ---------------DDLYRIDVPVLI 206
               R F +  P  +LKA+  + LSM+     +               D L +I  PVLI
Sbjct: 131 LLYPRAFVNAHP--ELKAMMLAGLSMLPPTPPETADRAMAGLASFNAYDRLGQIRCPVLI 188

Query: 207 AVGSQDDLAGSPQE----LMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNFYAN 257
             G QD L   P E    + S IP ++   I    H     D     Q +V F  N
Sbjct: 189 VHGDQDVLI--PVENAHLIKSRIPQAEEFIIPGAGHGFQAADPIGIHQRIVGFLKN 242


>gi|325276651|ref|ZP_08142382.1| acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue
           acetyltransferase [Pseudomonas sp. TJI-51]
 gi|324098213|gb|EGB96328.1| acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue
           acetyltransferase [Pseudomonas sp. TJI-51]
          Length = 368

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 65/111 (58%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++++G+   P ++L+HG    +  NWLF+    L  ++  RVIA D  GHG+S K+    
Sbjct: 125 WFELGEGGTP-LVLVHGFGGDL-NNWLFN-HPALAAER--RVIALDLPGHGESAKALQRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D  L  ++   ++LL+HLGI+K H+ G+SMG  ++ ++    P  V S+ L
Sbjct: 180 D--LDELSESVLALLDHLGIAKAHLGGHSMGGAVSLNLARLAPQRVASLSL 228


>gi|209516464|ref|ZP_03265319.1| alpha/beta hydrolase fold [Burkholderia sp. H160]
 gi|209503068|gb|EEA03069.1| alpha/beta hydrolase fold [Burkholderia sp. H160]
          Length = 287

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 66/125 (52%), Gaps = 12/125 (9%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQ---TNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + + G  DAP ++L+HG A S++   TN+           + FRV+  D LG G +DK  
Sbjct: 30  YLEAGPADAPVVILLHGTAGSLENFSTNYAAYA-------RHFRVVGLDMLGCGWTDKP- 81

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            ++DY +          ++ LGI+K  V+G S+GA ++ ++ L YP+ V  ++L     +
Sbjct: 82  -DHDYLIKDYVEHVRGFMDALGIAKASVVGVSLGAWVSAALALAYPTRVEKLVLVAPAGI 140

Query: 135 LYDSD 139
           + D +
Sbjct: 141 ITDPE 145


>gi|158321794|ref|YP_001514301.1| alpha/beta hydrolase fold [Alkaliphilus oremlandii OhILAs]
 gi|158141993|gb|ABW20305.1| alpha/beta hydrolase fold [Alkaliphilus oremlandii OhILAs]
          Length = 294

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 6/107 (5%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           ++  TI+ IH    ++   W  +G +    ++ + ++  D  GHGKS+K  + N Y L  
Sbjct: 20  RNGETIVFIHFSGGNL-AQW--NGVVPYFINK-YHIVTLDLRGHGKSEK--VMNGYTLDN 73

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           MA D + ++  LGI K H++G S+G  IA ++   +P  VRS++  G
Sbjct: 74  MAIDIIEVMNQLGIEKAHIVGSSLGGEIAVNLAAHFPERVRSIVAEG 120


>gi|33595117|ref|NP_882760.1| 3-oxoadipate enol-lactone hydrolase [Bordetella parapertussis
           12822]
 gi|33565194|emb|CAE35992.1| 3-oxoadipate enol-lactone hydrolase [Bordetella parapertussis]
          Length = 274

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 104/229 (45%), Gaps = 27/229 (11%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  DAP ++L + L +      +++  I  L  + FRV+ +D  GHGKS  S  + +Y  
Sbjct: 32  GPADAPVLVLSNSLGTCAD---MWARQIPELSRR-FRVLRYDTRGHGKS--SVPDGEYSF 85

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +  D   LLEHL I + H  G SMG      + L  P  +  +IL    + +  ++  
Sbjct: 86  AQLGGDVAELLEHLRIERAHFCGLSMGGPTGMWLALERPELIDRLILCNTAARIGSAE-- 143

Query: 142 DWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPG------------NDLKALASCLSM 187
            W + I +     ++ +   L +++   ++   +PG             D   +A+C + 
Sbjct: 144 GWSARIAAVRQDGLETMAPGLVERWLTPQYRAAEPGLVQLLIDMLRRIPDAGYMANC-AA 202

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNI 233
           +R    ++ +  I    L+ + S  DLA +PQ+   L + IP ++Y+ +
Sbjct: 203 LRDADLRERVAAIRARTLV-ISSTHDLAATPQDGKALAAAIPGARYVEL 250


>gi|325274178|ref|ZP_08140305.1| alpha/beta hydrolase fold family protein [Pseudomonas sp. TJI-51]
 gi|324100685|gb|EGB98404.1| alpha/beta hydrolase fold family protein [Pseudomonas sp. TJI-51]
          Length = 277

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 113/239 (47%), Gaps = 39/239 (16%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHG+  + +   ++ G    L +  +RVIA+D LGHG+S       D  L   A   
Sbjct: 24  VVLIHGVGLNKE---MWGGQFVGLAND-YRVIAYDMLGHGQS--RVPAADTPLEGYADQL 77

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL----YDSDVVDWQ 144
             LL+HL I++  V+G+SMG  +A +  L YP  + ++++  + SV       S  V  +
Sbjct: 78  AELLDHLQIAQATVIGFSMGGLVARAFALNYPQRLAALVV--LNSVFNRSPEQSAGVIAR 135

Query: 145 SLIDSFLLPSIDEVQNPLGKKF-RKFADLDPG-----------NDLKALASCLSMIRKPF 192
           +   + L P  + V   L + F R++   +P            NDL+   +  S+    F
Sbjct: 136 AAQAAELGPDAN-VDAALERWFSREYKAANPAQVAAIRQVLASNDLQGYHTTYSL----F 190

Query: 193 CQDDLYR------IDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRDHLLAV 242
              D+YR      I VP LIA G  D    +P   ++L + IP +  + +  + H++AV
Sbjct: 191 ATQDMYRASDLGSIQVPTLIATGELDS-GSTPAMTRQLAARIPGAHSVVLAEQRHMMAV 248


>gi|325673239|ref|ZP_08152931.1| alpha/beta hydrolase fold family hydrolase [Rhodococcus equi ATCC
           33707]
 gi|325555829|gb|EGD25499.1| alpha/beta hydrolase fold family hydrolase [Rhodococcus equi ATCC
           33707]
          Length = 301

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F DVG    P ++L+HGL  S ++   +   I  L  + +RV+A D  GHG SDK     
Sbjct: 29  FVDVGS--GPPVVLVHGLLGSHES---WGPQISQLSRK-YRVVAPDLFGHGASDKPA--G 80

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
           DY L   AA    L+EHLGIS    +G+S+G  I   +   +P  V  + L G G +
Sbjct: 81  DYSLSSHAATLRDLVEHLGISSASFVGHSLGGGIVMQLTYLFPERVDRLCLVGSGGL 137


>gi|322383541|ref|ZP_08057305.1| hydrolase-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321152085|gb|EFX45015.1| hydrolase-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 280

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 109/262 (41%), Gaps = 31/262 (11%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +   + D G+  A  +L IH     V T+  F+  IQ L    FR IAFD  GHGKS  S
Sbjct: 31  HSMNYIDRGEGTA--VLFIH---PPVLTSLNFTYQIQELSPS-FRTIAFDIRGHGKSQPS 84

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILGGVG 132
                Y L+  A D V L++ LGI+K  + GYS G  I    +L YP      V++GG+ 
Sbjct: 85  AQPITYPLI--AEDIVQLIDRLGINKCFLCGYSTGGTIVLEFLLNYPDRAWGGVVIGGM- 141

Query: 133 SVLYDSDVVDWQ--------------SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL 178
                S+V DW+                +++    +     N L    + + D   GN  
Sbjct: 142 -----SEVNDWRLKNLISVGAGLAKIGAVNTLAFSTAWGQTNKLSLFRKLYKDARKGNA- 195

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRD 237
           + +           C   L  I +PVL+  G +D       + L   +P+S+ + I + +
Sbjct: 196 RNIEQYYRYSLTCNCTSRLQEIRLPVLLIYGEKDRHFHPYAKILYDRLPNSELVFISKAN 255

Query: 238 HLLAVGDKQFKQGVVNFYANEL 259
           H +          ++  + N+L
Sbjct: 256 HRIPTKVPVLLNELIEKFVNKL 277


>gi|301061460|ref|ZP_07202230.1| hydrolase, alpha/beta domain protein [delta proteobacterium NaphS2]
 gi|300444499|gb|EFK08494.1| hydrolase, alpha/beta domain protein [delta proteobacterium NaphS2]
          Length = 292

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 16/152 (10%)

Query: 21  VGDKDAPTILLIHGLASSVQT-NWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           V + D   IL IHGL+++ +  + + SG      +  FRV+A D  G G SDK      Y
Sbjct: 20  VWEGDGENILCIHGLSANCRCWDRIVSG-----LEPEFRVLAMDLRGRGLSDKP--PTGY 72

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +   A D +++L+  G++ + +MG+S+GA ++ +    YP+ V  +IL   G  L D  
Sbjct: 73  SIDQHAKDVLAVLKDQGLTTITLMGHSLGAYVSLAFAAHYPTLVNKLILVDGGGSLPD-- 130

Query: 140 VVDWQSLIDSFLLPSIDEVQNPLGKKFRKFAD 171
            V W   I+  + PSID     LG+ F  + D
Sbjct: 131 -VQWDK-IEQAIKPSIDR----LGQVFPSYED 156


>gi|169600665|ref|XP_001793755.1| hypothetical protein SNOG_03175 [Phaeosphaeria nodorum SN15]
 gi|111068786|gb|EAT89906.1| hypothetical protein SNOG_03175 [Phaeosphaeria nodorum SN15]
          Length = 265

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 93/204 (45%), Gaps = 29/204 (14%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T + +HGL SS    +  +   Q L  +GFR I FDN G G+S  +++E       +A D
Sbjct: 25  TFIFMHGLGSSQDYYYALA---QGLLTKGFRCIIFDNTGAGRSPYTFVEQSVH--SLADD 79

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV------ 141
            + +L+ LG+SK   +G+SMG  +   +       + + +L  VG V  + +VV      
Sbjct: 80  VIGVLDALGVSKAVFVGHSMGGIVGAHLAAERSDRIVAAVL--VGPVYPNENVVPVFEKR 137

Query: 142 -------DWQSLIDSFLLPSIDEVQNPLGKKFRK--FADLDPGNDLKALASCLSMIR-KP 191
                    Q + D+    ++    +PL K F +      DP       ++C  +I  KP
Sbjct: 138 IETVQKEGMQPMADTVPHAAVGTRASPLVKAFIRELLLSQDPAG---YCSNCRVIINAKP 194

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLA 215
               +  +I++PVLI  G +D  A
Sbjct: 195 ---PNYGKINIPVLILAGDEDKSA 215


>gi|167463470|ref|ZP_02328559.1| possible hydrolase [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 258

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 109/262 (41%), Gaps = 31/262 (11%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +   + D G+  A  +L IH     V T+  F+  IQ L    FR IAFD  GHGKS  S
Sbjct: 9   HSMNYIDRGEGTA--VLFIH---PPVLTSLNFTYQIQEL-SPSFRTIAFDIRGHGKSQPS 62

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILGGVG 132
                Y L+  A D V L++ LGI+K  + GYS G  I    +L YP      V++GG+ 
Sbjct: 63  AQPITYPLI--AEDIVQLIDRLGINKCFLCGYSTGGTIVLEFLLNYPDRAWGGVVIGGM- 119

Query: 133 SVLYDSDVVDWQ--------------SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL 178
                S+V DW+                +++    +     N L    + + D   GN  
Sbjct: 120 -----SEVNDWRLKNLISVGAGLAKIGAVNTLAFSTAWGQTNKLSLFRKLYKDARKGNA- 173

Query: 179 KALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRD 237
           + +           C   L  I +PVL+  G +D       + L   +P+S+ + I + +
Sbjct: 174 RNIEQYYRYSLTCNCTSRLQEIRLPVLLIYGEKDRHFHPYAKILYDRLPNSELVFISKAN 233

Query: 238 HLLAVGDKQFKQGVVNFYANEL 259
           H +          ++  + N+L
Sbjct: 234 HRIPTKVPVLLNELIEKFVNKL 255


>gi|225453498|ref|XP_002275186.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297734551|emb|CBI16602.3| unnamed protein product [Vitis vinifera]
          Length = 317

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 26  APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
            P +LLIHG         L+S W   I  L   G+RV+A D  G+G SD       Y ++
Sbjct: 26  GPLVLLIHGFPE------LWSSWNYQITHLAKHGYRVVAPDMRGYGDSDSPPDPASYTIL 79

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            +  D + LL+ LG  K  V+G+  GA +A  + L  P  V++++  GV
Sbjct: 80  HLVGDLIGLLDQLGEEKAFVVGHDWGAEVAWHLCLLRPDRVKALVNLGV 128


>gi|302538442|ref|ZP_07290784.1| predicted protein [Streptomyces sp. C]
 gi|302447337|gb|EFL19153.1| predicted protein [Streptomyces sp. C]
          Length = 312

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 63/128 (49%), Gaps = 17/128 (13%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD--- 71
           + A+   GD   P +LLI G+A  +Q +    G+   L  +G R+I FDN   G S    
Sbjct: 29  EVAYERWGDAQDPPVLLIMGIA--LQMHGWPDGFCAELTARGLRLIRFDNRDAGLSTHFP 86

Query: 72  -------KSYIEND-----YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
                   + +  D     Y L  MA DAV LL+ LG+   HV+G S+G  IA +M + +
Sbjct: 87  DAPLPDVAAALAGDLSSASYSLSDMAGDAVGLLDALGLDSAHVVGLSLGGAIAQTMAIEH 146

Query: 120 PSYVRSVI 127
           P  VRS+ 
Sbjct: 147 PGRVRSLT 154


>gi|169630959|ref|YP_001704608.1| lipase/esterase LipG [Mycobacterium abscessus ATCC 19977]
 gi|169242926|emb|CAM63954.1| Probable lipase/esterase LipG [Mycobacterium abscessus]
          Length = 324

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 24/134 (17%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK-- 72
           +  + + G+   P +LLI G+ +  Q  +    + Q L DQG+RVI FDN   G S K  
Sbjct: 22  ELCYEEFGNPADPAVLLIMGIGA--QMVFWRPEFCQQLADQGYRVIRFDNRDCGLSTKLD 79

Query: 73  --------------------SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
                                     Y LV MA DA  LL+HLGI + H++G SMG  IA
Sbjct: 80  GVRAGGGSLIPSMAKFLAGVKITGTAYTLVDMAGDAAGLLDHLGIEQAHIVGASMGGMIA 139

Query: 113 CSMVLFYPSYVRSV 126
                 +P    +V
Sbjct: 140 QVFAAEHPDRTATV 153


>gi|227538778|ref|ZP_03968827.1| hydrolase of the alpha/beta superfamily protein [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227241287|gb|EEI91302.1| hydrolase of the alpha/beta superfamily protein [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 363

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (52%), Gaps = 7/118 (5%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           GD+  P ++ +HG   S+   +        L D G+ VIA D  GHG++    I      
Sbjct: 65  GDRKNPAVVWLHG---SLTNAYELMSIAPQLADAGYFVIAMDYYGHGQTP---IPAHEVS 118

Query: 82  VFMAADAVS-LLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           ++ AAD V  LL  L ISK ++ G+S GA IA +    YPS VR +IL   G+V ++S
Sbjct: 119 LYHAADDVHFLLNELNISKAYIGGFSRGAYIATAFYDSYPSSVRGLILEEGGTVAFNS 176


>gi|120406321|ref|YP_956150.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119959139|gb|ABM16144.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
          Length = 337

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 3/107 (2%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G+  AP ++L HG      T W     ++ L D GF V+A D  G+G SDK    + Y
Sbjct: 39  EAGEPGAPVVVLCHGFPELAFT-WRHQ--VRALADAGFHVLAPDQRGYGGSDKPDAVDSY 95

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            +  + AD V LL+ LG  +  ++G+  GA +A +  L  P    SV
Sbjct: 96  NVAELTADVVGLLDDLGAERAALVGHDFGAVVAWAAPLLQPDRFSSV 142


>gi|312137962|ref|YP_004005298.1| alpha/beta hydrolase [Rhodococcus equi 103S]
 gi|311887301|emb|CBH46612.1| putative alpha/beta hydrolase [Rhodococcus equi 103S]
          Length = 290

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F DVG    P ++L+HGL  S ++   +   I  L  + +RV+A D  GHG SDK     
Sbjct: 18  FVDVGS--GPPVVLVHGLLGSHES---WGPQISQLSRK-YRVVAPDLFGHGASDKP--AG 69

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
           DY L   AA    L+EHLGIS    +G+S+G  I   +   +P  V  + L G G +
Sbjct: 70  DYSLSSHAATLRDLVEHLGISSASFVGHSLGGGIVMQLTYLFPERVDRLCLVGSGGL 126


>gi|256786142|ref|ZP_05524573.1| hydrolase [Streptomyces lividans TK24]
          Length = 304

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 104/262 (39%), Gaps = 30/262 (11%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           G  D P +LL+HGL     ++W  +  W+        R +A D  GHG+SDK       R
Sbjct: 46  GAGDLPGVLLLHGLMGRA-SHWAPTARWLSAR----HRAVALDQRGHGRSDKPPRAAYTR 100

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSD 139
             ++  D  + LE LG+    ++G++MGA  A  +    P  VR +I+  +  S L  + 
Sbjct: 101 EAYVE-DVEAALEQLGLGPAVLIGHAMGALTAWQLAAKRPDLVRGLIICDMRASALGAAS 159

Query: 140 VVDWQSLIDSFLLPSID---------------EVQNPLGKKFRKFADLDPGNDLKALASC 184
              W     ++ +P                  E  NP   +F      +  +  + +   
Sbjct: 160 QHTWTEWFRAWPVPFATLADVRKWFGEDDPWVERPNPARGEFYAEVMAESPDGWRPVFEP 219

Query: 185 LSMIRKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRD 237
             M+R           ++L ++  P L+  G   +L     QE++  +PS QY  +    
Sbjct: 220 EQMLRSRETWVYDAHWEELAQVRCPTLVVRGLDGELGRAEAQEMVRVLPSGQYAEVADAG 279

Query: 238 HLLAVGDKQFKQGVVNFYANEL 259
           HL+     +  +  +  + N L
Sbjct: 280 HLVHYDQPEAWRTAIEPFLNAL 301


>gi|240173066|ref|ZP_04751724.1| putative hydrolase [Mycobacterium kansasii ATCC 12478]
          Length = 305

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 64/131 (48%), Gaps = 22/131 (16%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY--- 74
           + D+GD D P +LLI GL + +   W  +G+ + L  QG RVI +DN   G S ++    
Sbjct: 21  YEDMGDPDDPPVLLIMGLGAQLLL-WR-TGFCERLVAQGLRVIRYDNRDVGLSSRTEHCD 78

Query: 75  ---------------IEND--YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
                          + N   Y L  MA DA +LL+HLGI   H++G SMG  IA     
Sbjct: 79  SGPSMPARLLRFWFGLRNQAAYSLEDMADDAAALLDHLGIEHAHIVGASMGGMIAQIFAA 138

Query: 118 FYPSYVRSVIL 128
            +P   +++ +
Sbjct: 139 RFPERTKALAI 149


>gi|223950267|gb|ACN29217.1| unknown [Zea mays]
 gi|224031227|gb|ACN34689.1| unknown [Zea mays]
          Length = 407

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 54  DQGFRVIAFDNLGHGKS----DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGA 109
           D G  V  FDN G G+S    +KSY    Y    MA DA++L++HLG  K HV G+SMGA
Sbjct: 83  DDGIEVCCFDNRGVGRSSVLPNKSY----YSTAIMATDALALIDHLGWKKAHVFGHSMGA 138

Query: 110 RIACSMVLFYPSYVRSVIL 128
            IAC +    P  + S+ L
Sbjct: 139 MIACKLAAMAPHRLCSLAL 157


>gi|33591469|ref|NP_879113.1| 3-oxoadipate enol-lactone hydrolase [Bordetella pertussis Tohama I]
 gi|33571111|emb|CAE40605.1| 3-oxoadipate enol-lactone hydrolase [Bordetella pertussis Tohama I]
          Length = 259

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 103/231 (44%), Gaps = 31/231 (13%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSYIENDY 79
           G  DAP ++L + L +          W + + +  + FRV+ +D  GHGKS  S  + +Y
Sbjct: 17  GPADAPVLVLSNSLGTCADM------WARQIPELSRRFRVLRYDTRGHGKS--SVPDGEY 68

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
               +  D   LLEHL I + H  G SMG      + L  P  +  ++L    + +  ++
Sbjct: 69  SFAQLGGDVAELLEHLRIERAHFCGLSMGGPTGMWLALERPELIDRLVLCNTAARIGSAE 128

Query: 140 VVDWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPG------------NDLKALASCL 185
              W + I +     ++ +   L +++   ++   +PG             D   +A+C 
Sbjct: 129 --GWSARIAAVRQDGLETMAPGLVERWLTPQYRAAEPGLVQVLVDMLRRIPDAGYMANC- 185

Query: 186 SMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNI 233
           + +R    ++ +  I    L+ + S  DLA +PQ+   L + IP ++Y+ +
Sbjct: 186 AALRDADLRERVAAIRARTLV-ISSTHDLAATPQDGKALAAAIPGARYVEL 235


>gi|167645565|ref|YP_001683228.1| alpha/beta hydrolase fold protein [Caulobacter sp. K31]
 gi|167347995|gb|ABZ70730.1| alpha/beta hydrolase fold [Caulobacter sp. K31]
          Length = 328

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 91/225 (40%), Gaps = 28/225 (12%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           + AFY+ G +    I+L HG       +W +   I  L   G  VI  D  G+G +++  
Sbjct: 20  RMAFYEAGPRQGVPIVLCHGF-PEFSYSWRWQ--IAALAAAGRWVIVPDQRGYGLTERPE 76

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  +  D V LL+HLG+ K    G+  G  +   M L +P  V  V+  GV + 
Sbjct: 77  AVEAYDMAHLTGDLVGLLDHLGVEKAVFCGHDWGGLVVWQMPLMHPERVAGVV--GVNTP 134

Query: 135 LYDSDVVDWQSL----------IDSFLLPSIDEVQ--NPLGKKFRKFADLDPGNDLKALA 182
                 VD  ++          I  F  P + + Q    + K  R F    P  +  A  
Sbjct: 135 FLPRLSVDPITVFRNAFGDDMYIVHFQTPGVADAQLAADVEKTMRYFMR-KPTEEQAAFT 193

Query: 183 SCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG--SPQELMSFI 225
           S  S  R    QD L R DV         DD +   +P+EL +F+
Sbjct: 194 SGASERRSLALQDGLARYDV--------ADDASQLLTPEELATFV 230


>gi|149746435|ref|XP_001492725.1| PREDICTED: similar to soluble epoxide hydrolase [Equus caballus]
          Length = 555

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 52/101 (51%), Gaps = 3/101 (2%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P + L HG   S   +W +   I  L   GFRV+A D  G+G+S       +Y +  + 
Sbjct: 258 GPAVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLAVDMKGYGESSAPPEIEEYSMEVLC 314

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            D V+ L+ LGIS+   +G+  G  +  +M LFYP  VR+V
Sbjct: 315 KDMVTFLDKLGISQAVFIGHDWGGMLVWNMALFYPERVRAV 355


>gi|309791570|ref|ZP_07686067.1| alpha/beta hydrolase fold-containing protein [Oscillochloris
           trichoides DG6]
 gi|308226391|gb|EFO80122.1| alpha/beta hydrolase fold-containing protein [Oscillochloris
           trichoides DG6]
          Length = 277

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (52%), Gaps = 6/119 (5%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           S + Y+  + + G    P +LL+HG   S + +W  +G +  L   G+R +AFD LG G+
Sbjct: 8   SVQGYRLHYLEAGS--GPVVLLLHGFGRSAE-DWRQTGAV--LARAGYRALAFDCLGFGR 62

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           S+K   +  Y L  ++   V  L  LG+ +  ++ +SMG + A +  L YP  V  ++L
Sbjct: 63  SEKPG-DAPYSLELISGLYVEALNQLGVDQCTIVAHSMGGKYALATALIYPQRVNGLLL 120


>gi|241203651|ref|YP_002974747.1| alpha/beta hydrolase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857541|gb|ACS55208.1| alpha/beta hydrolase fold protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 276

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 105/246 (42%), Gaps = 27/246 (10%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +A Y  G    P ILL  GL  S   NW +   +  L  +G RV+  D+ GHG+S +   
Sbjct: 37  YASYGAG---PPVILLHGGLGHS--GNWGYQ--VPALLRRGRRVVLVDSRGHGRSTRDSR 89

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              Y L  MAAD +++++ L + K  ++G+S GA IA  + +  PS V  V         
Sbjct: 90  PYSYEL--MAADVLAVMDELHLDKAAIIGWSDGACIALILAMTAPSRVEGVFFFACN--- 144

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG-NDLKALASCLSMIRKP--- 191
                +D     +    P ID      G+  + +  L    +D       +S++ +    
Sbjct: 145 -----MDPSGTREFVPTPVIDRC---FGRHAKDYGALSTTPDDFNPFVEAVSLMMRTEPN 196

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLAG--SPQELMSFIPSSQYLNICRRDHLLAVGDK-QFK 248
           +   DL  I VPV I +G  D+       + L   IP+++ + +    H   +    +F 
Sbjct: 197 YQASDLGLIRVPVAIVLGEHDEFIKLDHAEYLARSIPNAEMIYLTGVSHFAPLQRPGEFN 256

Query: 249 QGVVNF 254
             VVNF
Sbjct: 257 VAVVNF 262


>gi|183982870|ref|YP_001851161.1| epoxide hydrolase EphB [Mycobacterium marinum M]
 gi|54289553|gb|AAV32086.1| putative epoxide hydrolase [Mycobacterium marinum]
 gi|183176196|gb|ACC41306.1| epoxide hydrolase EphB [Mycobacterium marinum M]
          Length = 352

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 3/107 (2%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           V D + P ++L+HG   S   +W     I  L   G+RV+A D  G+G+S K  ++  YR
Sbjct: 18  VEDGEGPLVILLHGFPES-WYSWRHQ--IPALAAAGYRVVAVDQRGYGRSSKYRVQKAYR 74

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           +  +  D + L++  G  K  V+G+  GA +A +    YP     V+
Sbjct: 75  IKELVGDVLGLVDAYGADKAFVIGHDWGAPVAWTFAWLYPQRCAGVV 121


>gi|320009244|gb|ADW04094.1| alpha/beta hydrolase fold protein [Streptomyces flavogriseus ATCC
           33331]
          Length = 298

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 104/243 (42%), Gaps = 38/243 (15%)

Query: 26  APTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKS----YIENDYR 80
           AP IL++HGL     T+W  +  W+     +  R +  D  GHG+SDK     Y  + Y 
Sbjct: 37  APGILMLHGLMGRA-THWASTARWLS----ERHRPVGLDQRGHGRSDKPAGGLYTRDAY- 90

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSD 139
                ADA + +E L ++ V ++G+SMGA  A  +    P  V+++I+  +  S +  + 
Sbjct: 91  ----VADAETAIEQLDLAPVTLVGHSMGALTAWQLAAKRPDLVKALIICDMRASAIGAAS 146

Query: 140 VVDWQSLIDSFLLP--SIDEVQNPLGKKFRKFADLDPGND---LKALASCLSMIRKPFCQ 194
             +W     ++ LP  ++ +V+   G+        +P       + +A      R  F Q
Sbjct: 147 QREWADWFTTWPLPFATLADVRKWFGEDDPWVERPNPSRGEFFAEVMAESADGWRPVFSQ 206

Query: 195 ----------------DDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRD 237
                           ++L ++  P L+  G   +L     QE++  +P  QY  +    
Sbjct: 207 EQMLASRATWVYDAHWEELAQVRCPTLVLRGIDGELGRAEAQEMVRVLPRGQYAEVEDAG 266

Query: 238 HLL 240
           HL+
Sbjct: 267 HLV 269


>gi|222150705|ref|YP_002559858.1| hypothetical protein MCCL_0455 [Macrococcus caseolyticus JCSC5402]
 gi|222119827|dbj|BAH17162.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 260

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (52%), Gaps = 8/112 (7%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFRVIAFDNLGHGKSDKSYIEND 78
           + DKDAP I  IHG   S         W + +    + F ++  D  GHG+S +   + +
Sbjct: 8   IKDKDAPWITFIHGAGGSSTI------WFKQIRYFRKDFNILLVDLRGHGRSSEVIWKKE 61

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
                +A++ V +L+ LGI K H++G S+G  ++ ++   YP  V S++LGG
Sbjct: 62  DSFKTLASEVVEVLDELGIQKTHIIGMSLGTIVSQTVANKYPERVISLVLGG 113


>gi|326529269|dbj|BAK01028.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 324

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 9/113 (7%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           G    P +LL+HG         L+  W   +  L  +G+R +A D  G G S        
Sbjct: 25  GPAAGPAVLLLHGFPE------LWMSWRHQMAALAARGYRALAPDLRGFGDSSAPADPAA 78

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
           Y ++ +  D V+LL+HL ++KV V+G+ +GA+ A  + LF P  VR+V+  GV
Sbjct: 79  YTVLHVVGDLVALLDHLRLTKVVVVGHDLGAQAAWHLCLFRPDRVRAVVALGV 131


>gi|291562902|emb|CBL41718.1| Predicted hydrolases or acyltransferases (alpha/beta hydrolase
           superfamily) [butyrate-producing bacterium SS3/4]
          Length = 261

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 116/258 (44%), Gaps = 29/258 (11%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS--DKSYI 75
           +Y    +  P IL++HG   + +T+ +F  + + L    +RVI  D+  HG+S     Y 
Sbjct: 19  YYKESGRGTP-ILMLHG---NAETHLIFDYYEKKL-SMKYRVILMDSRAHGRSRIKPEYA 73

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
           E+++    MA DA +LL+ L I    + G+S GA IA      +P   ++VI    G+V 
Sbjct: 74  ESEFTTTDMARDAAALLDILHIRSCILFGFSDGANIALEFASLFPERTQAVI-AISGNVS 132

Query: 136 YDSDVVDWQSLI--DSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCL---SMIRK 190
            D  ++  ++      F L +   +       FR   + +P      + SCL     +  
Sbjct: 133 PDGLILPVRAFCVGKYFCLKAATSL-------FRGICEKNPAA--APILSCLFRHQQLAS 183

Query: 191 PFC------QDDLYRIDVPVLIAVGSQDDLAGSPQELMS-FIPSSQYLNICRRDHLLAVG 243
             C      ++ L  +  PVL+  G++D +  S   LM+  IP +Q + I    H    G
Sbjct: 184 LLCNSPMMSREQLENVQAPVLLIAGTRDLVKVSHSRLMARLIPRAQLVLIKGATHTSMFG 243

Query: 244 DKQFKQGVVNFYANELRA 261
            K F   +++ + ++ +A
Sbjct: 244 RKAFYLKIIHDFLDKSQA 261


>gi|282883390|ref|ZP_06291983.1| hydrolase, alpha/beta hydrolase fold family [Peptoniphilus
           lacrimalis 315-B]
 gi|281296801|gb|EFA89304.1| hydrolase, alpha/beta hydrolase fold family [Peptoniphilus
           lacrimalis 315-B]
          Length = 238

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 87/187 (46%), Gaps = 19/187 (10%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
              ++L+HG   + + +  F   I+    + F+VIA D  GHGKSD   I+       ++
Sbjct: 21  GEALILLHG---NGENSHYFDKQIRDFA-KYFKVIAIDTRGHGKSDP--IKEKLTFEDLS 74

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQS 145
            D + +L  L I K +++G+S GA IA   V  YPS ++ +IL        + D +    
Sbjct: 75  RDLLDILNFLKIEKANILGFSDGANIALVFVKNYPSRIKKLILNSPNK---NVDQIKLLP 131

Query: 146 LIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVL 205
            I SF+   + ++ + L K+FR        N     +     I+      D  +ID PVL
Sbjct: 132 RIFSFIFYYLLKIVSNLCKRFR--------NYFSVYSLIFDTIK--IKDSDFKKIDFPVL 181

Query: 206 IAVGSQD 212
           I  G++D
Sbjct: 182 IIAGAKD 188


>gi|302527609|ref|ZP_07279951.1| predicted protein [Streptomyces sp. AA4]
 gi|302436504|gb|EFL08320.1| predicted protein [Streptomyces sp. AA4]
          Length = 298

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 6/122 (4%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           F    ++  +  Y  GD+    ++L+HG+   + T  + +   + L   GFRV+  D LG
Sbjct: 31  FRHEGQRLCYTEYGSGDR---VVVLMHGI---MFTRRMHAPLARRLARAGFRVVTLDLLG 84

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HG SD+      Y +      AV+LL+HL I    V G S+GA +A  + +  PS VR +
Sbjct: 85  HGDSDRPTQSWRYSMPAFGEQAVALLDHLEIDDAVVGGTSLGANVALEVAVAAPSRVRGL 144

Query: 127 IL 128
           ++
Sbjct: 145 MV 146


>gi|116511634|ref|YP_808850.1| alpha/beta fold family hydrolase [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116107288|gb|ABJ72428.1| Alpha/beta superfamily hydrolase [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 267

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 112/277 (40%), Gaps = 44/277 (15%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
           + FF +       F+D G    P I+LI G +SS +  W     I+   + G+RVI +D+
Sbjct: 1   MSFFTTNDLVNINFHDYGSSMNPPIILIGGYSSS-EVTWF--AQIEAFVNAGYRVITYDH 57

Query: 65  LGHGKSDKSYIENDYRLVF--MAADAVSLLEHLGISKVHVMGYSMG-ARIACSMVLFYPS 121
             HG S K     DY L    +A D   L++HL +  V ++G+SMG A I     LF   
Sbjct: 58  RSHGDSQKV----DYGLTLHRLAMDLKELIDHLQLKNVILIGHSMGAATIMAYEELFTDE 113

Query: 122 YVRSVILGGVGSVLYDSDVVDW------------QSLIDSFLLPSI------DEVQNPLG 163
            VR+VI        + S   DW             S ID F    +      D V+  LG
Sbjct: 114 NVRAVITEDQAPTFFKS--ADWLNGQYGKTLTELSSFIDDFPKTRLTQKKLSDTVKRTLG 171

Query: 164 KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL-----AGSP 218
                F       D K     L  +     +  L +   P L   G Q  +     A + 
Sbjct: 172 HGMTPF-------DFKRFRPLLQNVILQDWRAQLTQEQKPHLFFSGGQSPIFPAIHAQAA 224

Query: 219 QELMSFIPSSQYLNICRRDHLLAVGD-KQFKQGVVNF 254
           +EL    P S++       H+L + + ++F Q V++F
Sbjct: 225 RELQK-NPDSEFQIFEGCGHILHLEEIEKFNQAVIDF 260


>gi|33599399|ref|NP_886959.1| 3-oxoadipate enol-lactone hydrolase [Bordetella bronchiseptica
           RB50]
 gi|33566995|emb|CAE30908.1| 3-oxoadipate enol-lactone hydrolase [Bordetella bronchiseptica
           RB50]
          Length = 274

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 104/229 (45%), Gaps = 27/229 (11%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  DAP ++L + L +      +++  I  L  + FRV+ +D  GHGKS  S  + +Y  
Sbjct: 32  GPADAPVLVLSNSLGTCAD---MWARQIPELSRR-FRVLRYDTRGHGKS--SVPDGEYSF 85

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +  D   LLEHL I + H  G SMG      + L  P  +  ++L    + +  ++  
Sbjct: 86  AQLGGDVAELLEHLRIERAHFCGLSMGGPTGMWLALERPELIDRLVLCNTAARIGSAE-- 143

Query: 142 DWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPG------------NDLKALASCLSM 187
            W + I +     ++ +   L +++   ++   +PG             D   +A+C + 
Sbjct: 144 GWSARIAAVRQDGLETMAPGLVERWLTPQYRAAEPGLVQLLVDMLRRIPDAGYMANC-AA 202

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNI 233
           +R    ++ +  I    L+ + S  DLA +PQ+   L + IP ++Y+ +
Sbjct: 203 LRDADLRERVAAIRARTLV-ISSTHDLAATPQDGKALAAAIPGARYVEL 250


>gi|189192128|ref|XP_001932403.1| 3-oxoadipate enol-lactone hydrolase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187974009|gb|EDU41508.1| 3-oxoadipate enol-lactone hydrolase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 265

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 94/207 (45%), Gaps = 27/207 (13%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           K+  T + +HGL SS   N+ + G  Q+L   GFR I FDN G G+S  +++E    +  
Sbjct: 22  KERETFVFMHGLGSS--QNY-YHGVTQVLVASGFRCITFDNTGAGRSPYTFVEQS--IES 76

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD- 142
           M+ D + +L+ L + K   +G+SMG  +   +       + + IL  VG V  ++ ++  
Sbjct: 77  MSNDVIGILDALEVEKAVFVGHSMGGIVGAHVAAERSDRIVAAIL--VGPVYPNTGLIPV 134

Query: 143 ------------WQSLIDSFLLPSIDEVQNPLGKKFRK--FADLDPGNDLKALASCLSMI 188
                        Q L DS    ++ +  +PL K   +      DP      +++C  ++
Sbjct: 135 FQKRIETVEKDGMQPLADSIPDAAVGKKASPLAKGMIRELLLSQDPAG---YVSNCRVIL 191

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLA 215
                     +I VP+LI  G++D  A
Sbjct: 192 NA--SPPHYSKISVPILILAGAEDKSA 216


>gi|289770037|ref|ZP_06529415.1| hydrolase [Streptomyces lividans TK24]
 gi|289700236|gb|EFD67665.1| hydrolase [Streptomyces lividans TK24]
          Length = 310

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 104/262 (39%), Gaps = 30/262 (11%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           G  D P +LL+HGL     ++W  +  W+        R +A D  GHG+SDK       R
Sbjct: 52  GAGDLPGVLLLHGLMGRA-SHWAPTARWLSAR----HRAVALDQRGHGRSDKPPRAAYTR 106

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSD 139
             ++  D  + LE LG+    ++G++MGA  A  +    P  VR +I+  +  S L  + 
Sbjct: 107 EAYVE-DVEAALEQLGLGPAVLIGHAMGALTAWQLAAKRPDLVRGLIICDMRASALGAAS 165

Query: 140 VVDWQSLIDSFLLPSID---------------EVQNPLGKKFRKFADLDPGNDLKALASC 184
              W     ++ +P                  E  NP   +F      +  +  + +   
Sbjct: 166 QHTWTEWFRAWPVPFATLADVRKWFGEDDPWVERPNPARGEFYAEVMAESPDGWRPVFEP 225

Query: 185 LSMIRKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRD 237
             M+R           ++L ++  P L+  G   +L     QE++  +PS QY  +    
Sbjct: 226 EQMLRSRETWVYDAHWEELAQVRCPTLVVRGLDGELGRAEAQEMVRVLPSGQYAEVADAG 285

Query: 238 HLLAVGDKQFKQGVVNFYANEL 259
           HL+     +  +  +  + N L
Sbjct: 286 HLVHYDQPEAWRTAIEPFLNAL 307


>gi|20807053|ref|NP_622224.1| alpha/beta superfamily hydrolase/acyltransferase
           [Thermoanaerobacter tengcongensis MB4]
 gi|254479271|ref|ZP_05092613.1| hydrolase, alpha/beta fold family, putative [Carboxydibrachium
           pacificum DSM 12653]
 gi|20515541|gb|AAM23828.1| predicted hydrolases or acyltransferases (alpha/beta hydrolase
           superfamily) [Thermoanaerobacter tengcongensis MB4]
 gi|214034777|gb|EEB75509.1| hydrolase, alpha/beta fold family, putative [Carboxydibrachium
           pacificum DSM 12653]
          Length = 279

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 61/111 (54%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y++    +P ++LI GL  S    W++   I  L  + F+VI FD  G G S+K  +E 
Sbjct: 12  YYEIHGNGSP-LVLIEGLGCS---KWMWFKQIDEL-KKHFKVIVFDLRGVGDSEKPDME- 65

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            Y +  +A D  +L+  LG  KVHV+G SMG  IA  + L YP  V  +IL
Sbjct: 66  -YSIKLLADDTAALVAELGFKKVHVLGVSMGGYIAQELALEYPDLVDRLIL 115


>gi|221068094|ref|ZP_03544199.1| alpha/beta hydrolase fold protein [Comamonas testosteroni KF-1]
 gi|220713117|gb|EED68485.1| alpha/beta hydrolase fold protein [Comamonas testosteroni KF-1]
          Length = 279

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 97/233 (41%), Gaps = 43/233 (18%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R  +  + D G    P ++LIHG   S +T   +   I  L D GFRVIA+D  G G S 
Sbjct: 12  RPLKLHYQDFGS--GPPVVLIHGWPLSGRT---WEPQIADLVDAGFRVIAYDRRGFGASS 66

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGA-RIACSMVLFYPSYVRSVILGG 130
           + +   DY    +A+D   L+  L + KV ++G+SMG   +A  +  +  +++R  +   
Sbjct: 67  QPWGGYDYDS--LASDLNELITELELEKVCLVGFSMGGGEVARYIGTYGTAFIRCAVFAA 124

Query: 131 V------------GSVLYDSDVV--------DWQSLIDSFL------LPS---IDEVQNP 161
                           + ++DV         D  S +D F        P    + E Q  
Sbjct: 125 AVPPFLLKCETNPQGAVSEADVAKKEQAVLQDRLSFLDEFTQKFFSNAPGSLLVSEAQRE 184

Query: 162 LGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL 214
             +    FA        KA  +C+    +   +DDL +IDVP LI  G  D +
Sbjct: 185 YARTIAAFASA------KATHACIGSFSRTDFRDDLQKIDVPTLIIHGDSDRI 231


>gi|260461510|ref|ZP_05809757.1| alpha/beta hydrolase fold protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032580|gb|EEW33844.1| alpha/beta hydrolase fold protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 278

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 56/108 (51%), Gaps = 3/108 (2%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK-SYIENDYR 80
           GD + P +LLI G  +S+   W      + L D G  VI +DN   G+S K    E  Y 
Sbjct: 15  GDPENPPLLLIMGAMASML--WWPEALCRKLADAGLYVIRYDNRDTGRSTKYPPGEPPYT 72

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
              M  DA+ +L+  GI K HV G SMG  IA  + L +P+ V S+I+
Sbjct: 73  FDDMTDDAIGVLDSHGIDKAHVAGMSMGGMIAQRVALRHPARVASLIV 120


>gi|169630117|ref|YP_001703766.1| hydrolase [Mycobacterium abscessus ATCC 19977]
 gi|169242084|emb|CAM63112.1| Probable hydrolase [Mycobacterium abscessus]
          Length = 359

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 65/136 (47%), Gaps = 12/136 (8%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGW--IQLLCDQGFRVIAFDNL 65
           FR+   Y+ A+   G    P +LLIHG+  +  T      W  +     + F VIA D L
Sbjct: 39  FRTIHGYRRAYRIAGS--GPVLLLIHGIGDNSAT------WDSVHAQLAEHFTVIAPDLL 90

Query: 66  GHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS 125
           GHG+SDK     DY +   A     LL  L I +V V+G+S+G  +A      +P  V  
Sbjct: 91  GHGQSDKP--RADYSVAAYANGMRDLLAVLDIERVTVVGHSLGGGVAMQFTYQFPHLVER 148

Query: 126 VILGGVGSVLYDSDVV 141
           +IL   G V  D ++V
Sbjct: 149 LILVAPGGVTKDVNIV 164


>gi|312137583|ref|YP_004004919.1| alpha/beta hydrolase [Rhodococcus equi 103S]
 gi|325677446|ref|ZP_08157110.1| 2-hydroxy-6-phenylhexa-2,4-dienoic acid hydrolase [Rhodococcus equi
           ATCC 33707]
 gi|311886922|emb|CBH46231.1| alpha/beta hydrolase [Rhodococcus equi 103S]
 gi|325551693|gb|EGD21391.1| 2-hydroxy-6-phenylhexa-2,4-dienoic acid hydrolase [Rhodococcus equi
           ATCC 33707]
          Length = 286

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 116/273 (42%), Gaps = 37/273 (13%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           ++  ++DVG      +LL+HG  + V     + G I +L +Q FRVIA D +G G +   
Sbjct: 18  FETNYHDVGIGTGSPVLLLHGSGAGVSAWANWRGLIPVLAEQ-FRVIAPDLVGFGYTS-- 74

Query: 74  YIENDYRLVFMAA---DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
            + +  R           +SLL+ LGI KVHV+G S G  +A  +   +P  +  ++L G
Sbjct: 75  -LPDPVRFEIFDTWIDQILSLLDGLGIEKVHVVGNSFGGGLALHLATRHPERLDRIVLMG 133

Query: 131 VGSVLYDSDVVDWQSLIDSF--LLPSIDEVQNPLG-------------KKFRKFADLDPG 175
            G V +     D+   +D+     PS+  ++  +               + R  A + PG
Sbjct: 134 AGGVKF-----DFTPELDALWGYTPSVGNMKKIMDIMAYDRSLVTDELAELRYRATIRPG 188

Query: 176 NDLKALASCLSMIRKPFC------QDDLYRIDVPVLIAVGSQDDLA--GSPQELMSFIPS 227
              +A        R+ +        +DL +I   VLI  G +D +    + Q +   IP+
Sbjct: 189 AQ-EAFEQVFPEPRQRWLDAQIVPDEDLAKIAHEVLILHGREDRVVPLAASQRMFDTIPN 247

Query: 228 SQYLNICRRDHLLAVGD-KQFKQGVVNFYANEL 259
           SQ     +  H   +    +F+Q V  F    L
Sbjct: 248 SQLHVFGKCGHWTQIEHAARFQQLVSQFLGESL 280


>gi|226503083|ref|NP_001148147.1| catalytic/ hydrolase [Zea mays]
 gi|195616118|gb|ACG29889.1| catalytic/ hydrolase [Zea mays]
          Length = 376

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V  FDN G G+S     ++ Y    MA DA++L++HLG  K HV G+SMGA IAC +
Sbjct: 77  GIEVCCFDNRGAGRSSVPPNKSYYSTAIMATDALALMDHLGWKKAHVFGHSMGAMIACKL 136

Query: 116 VLFYPSYVRSVIL 128
               P  + S+ L
Sbjct: 137 AAIAPHRLCSLAL 149


>gi|146341249|ref|YP_001206297.1| putative alpha/beta hydrolase prolyl aminopeptidase [Bradyrhizobium
           sp. ORS278]
 gi|146194055|emb|CAL78073.1| putative alpha/beta hydrolase; putative prolyl aminopeptidase
           [Bradyrhizobium sp. ORS278]
          Length = 334

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 13/122 (10%)

Query: 12  RKYQFAFYDVG--DKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLG 66
            + + A+ DV     +  T LL+HG       N+  S W   I+ L + GFRV+  D +G
Sbjct: 53  EQLRMAYMDVAPAQPNGRTALLLHG------RNFPASYWAPVIRTLTEAGFRVVVPDQVG 106

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            GKS K   E  +    +A + ++LL+HLGI++V ++ +SMG  +A  +   YP  V  +
Sbjct: 107 FGKSSKPAGELHFDT--LARNTIALLDHLGIARVEIVAHSMGGMLAVRIGRAYPDRVAHL 164

Query: 127 IL 128
           +L
Sbjct: 165 VL 166


>gi|226944002|ref|YP_002799075.1| alpha/beta fold family hydrolase [Azotobacter vinelandii DJ]
 gi|226718929|gb|ACO78100.1| hydrolase, alpha/beta fold family [Azotobacter vinelandii DJ]
          Length = 341

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 109/240 (45%), Gaps = 43/240 (17%)

Query: 15  QFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           + A+ DV   + +  T++L+HG      T   + G I  L   G+RV+A D +G  KS K
Sbjct: 58  KMAYMDVQPAEPNGHTLVLLHGKNFCAAT---WEGSIAALTKAGYRVVAPDQIGFCKSSK 114

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                 Y    +AA+   LLE +G+ +  +MG+SMG  +A    L YP  +  +IL  V 
Sbjct: 115 PQ-HYQYSFQQLAANTRELLESIGLERYSLMGHSMGGMLATRFALLYPGQLERLIL--VN 171

Query: 133 SVLYDSDVVDWQSL------IDSF----LLPSIDEVQN-PLG--------KKFRKFADLD 173
            +     + DW++L      +D +    L  S + ++N  LG         +F ++ ++ 
Sbjct: 172 PI----GLEDWKALGVPYRTVDQWYARELRTSAEGIRNYQLGTYYAGQWRPEFDRWVEMQ 227

Query: 174 P------GNDLKALASCLS--MIRKPFCQDDLYRIDVPVLIAVGSQDDLA----GSPQEL 221
                  G +  A  S L+  MI       +  ++ VP L+ +G +D+ A     +P EL
Sbjct: 228 AGLFQGRGKERVAWNSALTYDMIYTQPVYYEFEQLKVPTLLLIGEKDNTAIGKDAAPAEL 287


>gi|167758277|ref|ZP_02430404.1| hypothetical protein CLOSCI_00615 [Clostridium scindens ATCC 35704]
 gi|167664174|gb|EDS08304.1| hypothetical protein CLOSCI_00615 [Clostridium scindens ATCC 35704]
          Length = 232

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 103/236 (43%), Gaps = 24/236 (10%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D   ++++HG   + +    F   ++    + +RVIA D  GHGKS +   E  + +   
Sbjct: 13  DGEPLIMLHG---NGEDGTYFKHQMEYFS-KDYRVIAIDTRGHGKSPRG--EKPFTIRQF 66

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQ 144
           A D    +E  G+ K H++G+S G  IA +  L YP  V S+IL G              
Sbjct: 67  AEDLNGFMEEQGMEKAHLLGFSDGGNIALAFALRYPGKVESLILNGA------------- 113

Query: 145 SLIDSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVP 203
           +L  + + PS+ ++   LG K    F      +  KA    L   +       L  +   
Sbjct: 114 NLCPAGVKPSV-QIPIVLGYKITSFFGRFHHRSRQKAEMLGLMTTQPDLSPRQLKEVKAR 172

Query: 204 VLIAVGSQDDLAGSPQELM-SFIPSSQYLNICRRDHLLAVGD-KQFKQGVVNFYAN 257
            L+ VG  D +  S   L+   +P+++ + I + DH +A  + ++F + V  F  N
Sbjct: 173 TLVIVGENDMIKDSHSLLICESLPNARLVRI-KGDHFIAAKNPEEFNRAVSRFLRN 227


>gi|119475636|ref|ZP_01615989.1| 3-oxoadipate enol-lactone hydrolase [marine gamma proteobacterium
           HTCC2143]
 gi|119451839|gb|EAW33072.1| 3-oxoadipate enol-lactone hydrolase [marine gamma proteobacterium
           HTCC2143]
          Length = 256

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 103/218 (47%), Gaps = 13/218 (5%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           QF +   GD   P++ L++ +AS+  TNW  S  +  L    F+++ FD  G GKS    
Sbjct: 18  QFHYALDGDASKPSLALVN-MASANLTNWEHS--LPFLLTH-FQILRFDIRGTGKSGWGG 73

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
            ++++     A D V++++ L I K  V+G + GAR      + +P  + ++ L  V ++
Sbjct: 74  -DDEFTFSQYADDLVAIMDALQIPKAFVLGVAYGARTVAQFGIRHPDRLTALALFDV-AL 131

Query: 135 LYDSDVVDWQSLIDSF--LLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF 192
               +    + L      LL    E + P  K +R + + D      AL++  +  ++P 
Sbjct: 132 TPPVEQTGQRELGQQARQLLTEAGEPEYPTRKSWRFYENRD-----AALSAHTAHEKEPD 186

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQY 230
             + L  + VPVL+A G QD      Q +   IP S++
Sbjct: 187 TSNSLSHLRVPVLVACGRQDLNLQEAQRIAKAIPGSEF 224


>gi|326404094|ref|YP_004284176.1| putative hydrolase [Acidiphilium multivorum AIU301]
 gi|325050956|dbj|BAJ81294.1| putative hydrolase [Acidiphilium multivorum AIU301]
          Length = 308

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 16/116 (13%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI--------- 75
           + P ILLI GL   + + W  +     L ++GF VI FDN   G+S +  I         
Sbjct: 24  NGPPILLIAGLQLQLHS-WPVA-MADGLVERGFSVITFDNRDVGRSSRIGIAPPSKLQLL 81

Query: 76  -----ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
                  DY L  MAADA  LLE+L +   HV+G SMG  IA ++    P  VRS+
Sbjct: 82  LRRARTQDYDLTDMAADAAGLLEYLRLGPAHVVGMSMGGMIAQTLAATRPDLVRSL 137


>gi|254562302|ref|YP_003069397.1| alpha/beta hydrolase [Methylobacterium extorquens DM4]
 gi|254269580|emb|CAX25550.1| putative alpha/beta hydrolase precursor [Methylobacterium
           extorquens DM4]
          Length = 339

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 14/126 (11%)

Query: 9   RSWRKYQFAFYDVGDKD---APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAF 62
           R     + A+ DV   D     T+LL+HG       N+  S W   I+ L + G+RV+  
Sbjct: 53  RDGEAQRLAYMDVPAADNANGRTVLLLHG------RNFPSSYWEPVIRTLSNAGYRVVVP 106

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D LG GKS K      Y    MAAD ++L++ L I +  ++ +SMG  +A  M   YP  
Sbjct: 107 DQLGFGKSSKPI--GSYTFDRMAADTLALVDSLKIQRFDIVAHSMGGMLAVRMARNYPQR 164

Query: 123 VRSVIL 128
           V S++L
Sbjct: 165 VNSLVL 170


>gi|254448873|ref|ZP_05062329.1| hydrolase, alpha/beta fold family protein [gamma proteobacterium
           HTCC5015]
 gi|198261563|gb|EDY85852.1| hydrolase, alpha/beta fold family protein [gamma proteobacterium
           HTCC5015]
          Length = 302

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (49%), Gaps = 20/139 (14%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           + +S    Q  +   G  D P +L+I GL + + T W     ++ L + G  V+ FDN  
Sbjct: 7   YAQSEANIQLYYECWGHSDHPALLMIMGLGAQM-TVWP-QRLLEALVEAGHYVVLFDNRD 64

Query: 67  HG----------KSDKSYIEND--------YRLVFMAADAVSLLEHLGISKVHVMGYSMG 108
            G          ++ ++YI +         Y L  MA DAV++L HLGI K HV+G SMG
Sbjct: 65  IGLSTATPEVQSRTMRNYIRSKLGCRVKAPYNLSDMAGDAVAVLNHLGIEKAHVVGASMG 124

Query: 109 ARIACSMVLFYPSYVRSVI 127
             IA  + + +PS V S++
Sbjct: 125 GMIAQLLAVEHPSRVASIV 143


>gi|194703938|gb|ACF86053.1| unknown [Zea mays]
          Length = 399

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V  FDN G G+S     ++ Y    MA DA++L++HLG  K HV G+SMGA IAC +
Sbjct: 77  GIEVCCFDNRGAGRSSVPPNKSYYSTAIMATDALALMDHLGWKKAHVFGHSMGAMIACKL 136

Query: 116 VLFYPSYVRSVIL 128
               P  + S+ L
Sbjct: 137 AAIAPHRLCSLAL 149


>gi|320532134|ref|ZP_08033008.1| hydrolase, alpha/beta fold family protein [Actinomyces sp. oral
           taxon 171 str. F0337]
 gi|320135647|gb|EFW27721.1| hydrolase, alpha/beta fold family protein [Actinomyces sp. oral
           taxon 171 str. F0337]
          Length = 292

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 107/250 (42%), Gaps = 48/250 (19%)

Query: 12  RKYQFAFYDVG-DKDAPTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGH 67
           R   FA+ D+G D   P +LL H L +++        W   + D   +G RVIA D  G 
Sbjct: 28  RGESFAYRDLGIDGGTPIVLLAH-LGATLDE------WDPRVVDALAEGRRVIAVDLPGI 80

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G S  S       +  MA  A + +  LG++++ +MG+S+G  +A  + L  P+ VR ++
Sbjct: 81  GSSTGSVPRT---IKGMAGAARAFISELGLTRIDLMGFSLGGFVAQQVALDAPNLVRRLV 137

Query: 128 LGGVG----------------------SVLYDSDVVDWQSLIDSFLLPSID---EVQNPL 162
           L G G                       VL  +D  ++      F   + D     ++ L
Sbjct: 138 LAGTGPAGGKGIDRPTGAAYVYLDILRGVLARTDAKEFL-----FFPRTCDGKAAARDYL 192

Query: 163 GKKFRKFADLDPGNDLKALASCLSMIRKPFCQ--DDLYRIDVPVLIAVGSQDDLAGSP-- 218
            +   +  D D    LKA  + ++ I+    Q   DL RI  P LIA G  D +  +P  
Sbjct: 193 ARIHERVMDRDSPISLKAFRTQIAAIKAWGRQWPQDLSRIAAPTLIANGDHDRMVPTPLS 252

Query: 219 QELMSFIPSS 228
           Q++   IP S
Sbjct: 253 QDMHRRIPGS 262


>gi|116750396|ref|YP_847083.1| 3-oxoadipate enol-lactonase [Syntrophobacter fumaroxidans MPOB]
 gi|116750438|ref|YP_847125.1| 3-oxoadipate enol-lactonase [Syntrophobacter fumaroxidans MPOB]
 gi|116699460|gb|ABK18648.1| 3-oxoadipate enol-lactonase [Syntrophobacter fumaroxidans MPOB]
 gi|116699502|gb|ABK18690.1| 3-oxoadipate enol-lactonase [Syntrophobacter fumaroxidans MPOB]
          Length = 260

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 109/253 (43%), Gaps = 26/253 (10%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G   AP +   H LA+++++ W     +  L D  +RV+  D  GHG S  S     Y +
Sbjct: 16  GPPGAPVVTFSHSLAAALES-WDLQ--LPPLRD-AYRVLRMDTRGHGGS--SAPPGPYTM 69

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +++D + LL+HL I++ H +G S+G  I   + + YP  +  ++L    + +      
Sbjct: 70  EMLSSDVIGLLDHLDIARTHFVGLSLGGMIGQVLAVGYPERLDRLVLCDTSNRMPSETAP 129

Query: 142 DWQSLIDSFLLPSI-----DEVQNPLGKKFR--------KFADLDPGNDLKALASCLSMI 188
            W+  I +     +     + ++    + FR        +  ++     +     C   I
Sbjct: 130 VWEERIRTAETQGMTALARETLERWFSEAFRRDQPQATERIRNMIVRTPVAGYTGCCRAI 189

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRDHLLAV-G 243
            +     +L R+ VP LI VG +D+  G+P    + +   I  S+   I    HL  + G
Sbjct: 190 SRFDLSGELSRVKVPTLIMVGEKDE--GTPVSAAETIQRQIEGSELFVIPGALHLSNIEG 247

Query: 244 DKQFKQGVVNFYA 256
              F + +++F +
Sbjct: 248 AAHFNRRLLSFLS 260


>gi|115359069|ref|YP_776207.1| alpha/beta hydrolase fold [Burkholderia ambifaria AMMD]
 gi|115284357|gb|ABI89873.1| 3-oxoadipate enol-lactonase [Burkholderia ambifaria AMMD]
          Length = 280

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 110/245 (44%), Gaps = 57/245 (23%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++ IHG+ S ++    + G I  L  +GFRV++FD  GHG+S++  ++  Y +     D 
Sbjct: 36  LVCIHGVGSYLEA---WQGAINAL-GRGFRVLSFDLRGHGRSER--VKGRYEIDDFVGDV 89

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL------------GGVGSVL- 135
           ++L +H G S+  + G+S+G  IA  + L  P+ +R ++L             GV   L 
Sbjct: 90  LALADHAGFSRFDLAGFSLGGLIAQRLALTRPARLRRLVLLATVAGRTAEERAGVAERLA 149

Query: 136 ----------YDSDVVDWQSLIDSFLLPSIDEVQNP--LGKKFRKFADLDPGNDLKALAS 183
                     YD+ +  W  L + F      + ++P  + +  R+ A  DP         
Sbjct: 150 ALQAGERGAHYDASLSRW--LTEDF------QARHPALVAELRRRNAQNDP--------D 193

Query: 184 CLSMIRKPFCQDD----LYRIDVPVLIAVGSQDDLAGSPQELMSF----IPSSQYLNICR 235
           C +   +   Q D    + +I +P LIA G  D  AGS   +  +    IP S+ + + +
Sbjct: 194 CYAAAYRVLAQTDFGGLIDQIAMPTLIATGEHD--AGSNPRMARYMHERIPDSRLVILPK 251

Query: 236 RDHLL 240
             H L
Sbjct: 252 LRHSL 256


>gi|296284384|ref|ZP_06862382.1| hydrolase, alpha/beta hydrolase fold family protein [Citromicrobium
           bathyomarinum JL354]
          Length = 329

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 96/213 (45%), Gaps = 28/213 (13%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           +DAP I+L+HG  + + T   +  W+  L  + +RVI FD +GHG +     ++DY +  
Sbjct: 64  RDAPAIILLHGSNADLHT---WQPWVDALKGR-YRVIRFDQIGHGLTGPD-PDSDYSIPN 118

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-------------GG 130
             +D   + + LG+ +  + G SMG   A +  L +P  V  +IL             G 
Sbjct: 119 FVSDIDEVADSLGLDRFVIGGNSMGGSHAVAYALAHPERVEGLILVDAAGAPIRKEGRGN 178

Query: 131 VGSVLYDSDVVDW-------QSLIDSFLLPSIDEVQNPLGKKFRKFADL--DPGNDLKAL 181
           +G  +  + VV+        +S+I+  L  ++            ++ +L   PGN   A 
Sbjct: 179 IGFAIARTPVVNRIMNHITPRSMIEQSLRETVSNQAIVTDAMVDRYWELLRYPGN-RDAT 237

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL 214
               S     F Q+D+ +I+ P LI  G +D L
Sbjct: 238 RIRFSGEWNSFSQEDVAQIEAPALIIWGEEDGL 270


>gi|294814246|ref|ZP_06772889.1| hydrolase [Streptomyces clavuligerus ATCC 27064]
 gi|326442637|ref|ZP_08217371.1| putative hydrolase [Streptomyces clavuligerus ATCC 27064]
 gi|294326845|gb|EFG08488.1| hydrolase [Streptomyces clavuligerus ATCC 27064]
          Length = 343

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 109/245 (44%), Gaps = 34/245 (13%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           G    P +LL+HGL     ++W  +  W+        RV+A D  GHG SDK   E    
Sbjct: 81  GAGAVPGVLLLHGLMGRA-SHWAATARWL----SGAHRVVALDQRGHGHSDKP-AEGPRA 134

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSD 139
              +AADA + +E LG+    V+G++MGA  A  +    P  VR+++L  +  S L  + 
Sbjct: 135 GEVLAADAAAAIEGLGLGPAVVIGHAMGALTAWRLAAARPELVRALVLCEMRASALGAAS 194

Query: 140 VVDWQSLIDSFLLP---------------SIDEVQNPLGKKFRKFADL--DPGNDLKALA 182
             +W++  DS+ LP                + E  NP   +F  FA++  +  +  + + 
Sbjct: 195 QREWEAWFDSWPLPFTTLADVRRWFGGEDPVLERPNPARGEF--FAEVMAEREDGWRPVF 252

Query: 183 SCLSMI--RKPFCQD----DLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICR 235
           S   M+  R  +  D    +L ++  P L+  G   +L      E++  +P  QY  +  
Sbjct: 253 SRRQMLAARSGWAHDAHWEELAQVRCPALVLRGLDGELGRAEATEMVRVLPRGQYAEVDG 312

Query: 236 RDHLL 240
             HL+
Sbjct: 313 AGHLV 317


>gi|125901810|gb|ABN58716.1| esterase [uncultured organism]
          Length = 270

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 114/256 (44%), Gaps = 28/256 (10%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + +V    +P +LL+HGL S+   +W F    + L   GFRV+A D  G G+S       
Sbjct: 20  YEEVNPAGSPPVLLLHGLGSA-GADWFFQ--FEALSGAGFRVLAPDLRGFGRSSAP---P 73

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
              +  MA D    L+ L     HV+G SMG  +A  + L +P  V  ++L    + L  
Sbjct: 74  KITVKAMADDTAIFLKKLNAHPAHVVGISMGGTVALQLALDHPELVSKLVLVNTFARLKF 133

Query: 138 SDVVDWQSLIDSFLLPSI--DEVQNPLGKKFRKFADLDPG-----NDLK---------AL 181
           +   +   L+   L+ S+   E Q  +  + R F    PG     N+L+         + 
Sbjct: 134 TSPKEVLYLLTRLLVASLMGPEKQAEMVAR-RVFP--HPGQETLRNNLRQRILHTNPYSY 190

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDH- 238
            S L  ++K      L  + +PVL+  G++D        +E+   IP+++++ +    H 
Sbjct: 191 RSALQSLQKFDVSHRLKELKMPVLVITGAEDTTVPPKVQEEMAKAIPNARHVVVEGSGHG 250

Query: 239 LLAVGDKQFKQGVVNF 254
           ++A   + F + ++ F
Sbjct: 251 IIADNPQTFNRILIEF 266


>gi|1864009|dbj|BAA12909.1| homlogue of rdmC protein of Streptomyces purpuras [Escherichia
           coli]
 gi|4218052|dbj|BAA74571.1| homologue of RdmC protein of Streptomyces purpurascens [Escherichia
           coli]
 gi|9909134|dbj|BAB12021.1| RdmC protein homolog [Escherichia coli]
 gi|190411128|gb|ACE78319.1| RdmC [Streptococcus uberis]
 gi|312949097|gb|ADR29923.1| conserved hypothetical protein [Escherichia coli O83:H1 str. NRG
           857C]
          Length = 279

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 98/227 (43%), Gaps = 37/227 (16%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS-DKSYIENDYR 80
           GD + PTILLI G  SS+   W    + + L +QGF VI +DN   G+S    Y   +Y 
Sbjct: 19  GDTNDPTILLIMGATSSMI--WWEEDFCRKLSNQGFHVIRYDNRDVGRSITYEYGHPEYT 76

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL------------ 128
              +A DA+ +L+   + K H++G SMG  I   + L +P  V ++ L            
Sbjct: 77  FEDLADDAIQVLDAYRVDKAHIVGMSMGGIITQIVALKHPDRVLTISLVMTSNYDSSLPK 136

Query: 129 --GGVGSVLYDSDVVDWQSLIDSFLLPSIDE------VQNPLG-KKFRKFADLDPGNDLK 179
               V  V    ++ +W+   +  +   +D        ++P   +K RK A    G D  
Sbjct: 137 KDSKVTEVFAKININNWEDK-EEVIKYVMDRSKVLVGTKHPFNEEKIRKLA----GKDFD 191

Query: 180 ALASCLSMIRKPFCQ------DDLYRIDVPVLIAVGSQDDLAGSPQE 220
             ++  SM    + +         + I+VP L+  G+ D +   P E
Sbjct: 192 RASNMESMENHEYVKGWGLYLSRTHEINVPTLVIHGTDDPII--PHE 236


>gi|260429159|ref|ZP_05783136.1| putative hydrolase [Citreicella sp. SE45]
 gi|260419782|gb|EEX13035.1| putative hydrolase [Citreicella sp. SE45]
          Length = 224

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 92/228 (40%), Gaps = 12/228 (5%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           + L+HG   S    W   GW   L D GF  +  D  GHG +  S+   DY    +A+D 
Sbjct: 4   VALVHGWGGSYAATWQADGWDAALRDAGFEPVGVDIAGHGPTGGSHDPADY--ADLASDL 61

Query: 89  VSLLEHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLI 147
            + L       +H  +G+S+G ++   +    P     ++LGG+G  L+  +V    +++
Sbjct: 62  AAKLPQ----GLHGAIGFSLGTKLLLELEARAPGGNGRLVLGGIGDNLFAPEVAG-PAIV 116

Query: 148 DSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP-FCQDDLYRIDVPVLI 206
            +      D    P       +A    G+D   LA+ L     P   +  L     P+LI
Sbjct: 117 AALRGAGGD--HPPQVAALLAYA-AKSGSDPACLAAVLERPGNPVLTESRLAAATAPILI 173

Query: 207 AVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
                D +A     L+S +P + +  I    H+    D  F+   + F
Sbjct: 174 FNSRADAVAQPDARLVSALPGATHQLIDGPGHVGLTADAGFRDAAIAF 221


>gi|110598851|ref|ZP_01387105.1| Alpha/beta hydrolase fold [Chlorobium ferrooxidans DSM 13031]
 gi|110339532|gb|EAT58053.1| Alpha/beta hydrolase fold [Chlorobium ferrooxidans DSM 13031]
          Length = 320

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 72/153 (47%), Gaps = 18/153 (11%)

Query: 18  FYDVGDKDAP-TILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKS 73
           ++D G KDA  T++LIHG        W++  W   I  L  QG R IA+D  GHG SD  
Sbjct: 56  YHDSGPKDAAQTVILIHGW----DCWWMW--WHHQIAALNKQGIRTIAYDMRGHGWSDND 109

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
              N Y + F A D   L+  LG+ K H+  +S G  +A      +P  +RS+     G 
Sbjct: 110 -PRNHYHIDFFAHDLHELVTKLGLGKFHIAAFSFGPFVALDYARSHPGLIRSMTFFNFG- 167

Query: 134 VLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF 166
            L +S      + I +F   +I  V N L +K 
Sbjct: 168 YLPNS------AFIQAFATSTITFVFNNLLRKL 194


>gi|229488732|ref|ZP_04382598.1| hydrolase, alpha/beta fold family domain protein [Rhodococcus
           erythropolis SK121]
 gi|229324236|gb|EEN89991.1| hydrolase, alpha/beta fold family domain protein [Rhodococcus
           erythropolis SK121]
          Length = 305

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 102/251 (40%), Gaps = 38/251 (15%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSD 71
           ++A+ ++G      ++ +H  A+      +   W   + D   +   VIAFDN G G +D
Sbjct: 28  KYAYRELGTPGGVPVVFLHHFAA------VLDDWDPRIIDGIAENHHVIAFDNRGVGATD 81

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            +   +   L  M  DA + +  LG   V ++G+S+G  +A  + L  P+ VR ++L G 
Sbjct: 82  TAVPAD---LEQMGQDAAAFIRALGHGTVDLIGFSLGGAVAQMIALHDPTLVRRIVLAGT 138

Query: 132 GSVLYDSDVVDWQSLIDSF----------------LLPSIDEVQNPLGKKFRKFA----D 171
           G     +  VD    I  F                  P  DE ++     F + A    D
Sbjct: 139 GP--RGAGGVDQMGKIVGFAYLKAALARNDARHFLFFPRTDEGKSAADDYFARLAERTVD 196

Query: 172 LDPGNDLKALASCLSMI--RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ--ELMSFIPS 227
            D    ++A  + L  I        DDL RI  PV +A G  D +  S    +L   IP+
Sbjct: 197 RDTRISMQARVAQLKAIVGGGKAAPDDLARITQPVFVANGDNDLMVASDHSADLARRIPN 256

Query: 228 SQYLNICRRDH 238
           S+     R  H
Sbjct: 257 SKLTIYPRSGH 267


>gi|293396016|ref|ZP_06640297.1| carboxyl esterase [Serratia odorifera DSM 4582]
 gi|291421514|gb|EFE94762.1| carboxyl esterase [Serratia odorifera DSM 4582]
          Length = 304

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 21/132 (15%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY- 74
            A+ D GD   P +LLI G+ +  Q       + + L ++GFRVI FDN   G S K+  
Sbjct: 18  IAYEDWGDPSHPPLLLIMGIGA--QMLLWPDAFCRDLVEKGFRVIRFDNRDVGLSGKTQQ 75

Query: 75  ------------------IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                              E  Y L  MAADAVSLL++L I++ HV+G SMG  IA  + 
Sbjct: 76  RRRQPLWWLMIRAQLGWQSEVPYCLEDMAADAVSLLDYLQIAQAHVVGGSMGGMIAQVLA 135

Query: 117 LFYPSYVRSVIL 128
             +P  ++++ +
Sbjct: 136 AEHPDRIQTLTI 147


>gi|257057557|ref|YP_003135389.1| putative hydrolase or acyltransferase of alpha/beta superfamily
           [Saccharomonospora viridis DSM 43017]
 gi|256587429|gb|ACU98562.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Saccharomonospora viridis DSM 43017]
          Length = 313

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           P +LL+HG A      W +   ++ L D GFRV+A D  G+G SDK      Y    +A 
Sbjct: 39  PLVLLLHGFAG---FWWAWHHQLRTLADAGFRVVAADLRGYGDSDKP--PRGYDGWTLAG 93

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV-ILGGV 131
           D   L+  LG  K H++G++ G  +A S+   +P  V SV +LGG 
Sbjct: 94  DVAGLVRALGERKAHLVGHAWGGLLAWSVAALHPRVVASVSVLGGA 139


>gi|170721439|ref|YP_001749127.1| alpha/beta hydrolase fold family protein [Pseudomonas putida W619]
 gi|169759442|gb|ACA72758.1| alpha/beta hydrolase fold [Pseudomonas putida W619]
          Length = 277

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 107/236 (45%), Gaps = 33/236 (13%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++LIHG+  + +   ++ G    L +  +RVIA+D LGHG+S  +    D  L   AA  
Sbjct: 24  VVLIHGVGLNKE---MWGGQFVGLAND-YRVIAYDMLGHGQS--ALPAADTGLEGYAAQL 77

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS-VILGGVGSVLYDSDVVDWQSLI 147
             LL+HL I++  V+G+SMG  +A +  L YP  + + V+L  V +   +          
Sbjct: 78  AELLDHLQIAQATVIGFSMGGLVARAFALNYPQRLSALVVLNSVFNRTPEQSAGVIARAA 137

Query: 148 DSFLLPSIDEVQNPLGKKF-RKFADLDPG-----------NDLKALASCLSMIRKPFCQD 195
            +        V   L + F R++   +P            ND +   +  S+    F   
Sbjct: 138 QAAQQGPDANVDAALDRWFSREYKAANPAQVAAIRQVLASNDPQGYHTTYSL----FATQ 193

Query: 196 DLYR------IDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRDHLLAV 242
           D+YR      I VP LIA G  D    +P   ++L + IP +Q + +  + H++ V
Sbjct: 194 DMYRASDLGSIQVPTLIATGELDS-GSTPAMTRQLAASIPGAQSVVLAEQRHMMPV 248


>gi|313125684|ref|YP_004035954.1| hydrolase or acyltransferase of alpha/beta superfamily
           [Halogeometricum borinquense DSM 11551]
 gi|312292049|gb|ADQ66509.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Halogeometricum borinquense DSM 11551]
          Length = 305

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 106/259 (40%), Gaps = 52/259 (20%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLL---CDQGFRVIAFDNLGHGKSDKSYIEN 77
            G KD   ++L+HG          +  W + L    D+G+RVI  D  G+  SDK    +
Sbjct: 38  AGPKDGEPVVLLHGFPE------FWYAWHEFLGPLADEGYRVIVPDQRGYHLSDKPEAVD 91

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV--GSVL 135
            Y    +A D + LL+ L +S  H++G+  GA +A  + L  P  +R++ +  V   +  
Sbjct: 92  AYHPDELADDVLGLLDALDLSDAHLVGHDWGAFVAWWVGLHAPDRLRTLSVLNVPHPTAF 151

Query: 136 YDSDVVDWQSLIDS-----FLLPSIDEVQNPLGKKFRKFADL-----DPGN--------- 176
             +   DW+  + S     F LP I E    +G ++R   DL      PG          
Sbjct: 152 RHALSNDWEQRLKSWYVLFFQLPKIPEALAKMG-EYRTLCDLMRRSSQPGTFNEADFDCY 210

Query: 177 --------DLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSS 228
                     +++ +    I +   +    R+ VP L+  G++D          +F+  S
Sbjct: 211 RAAWSRPGAYRSMVNWYRAIARANPRPKTERVGVPTLVLWGAKD----------AFLTRS 260

Query: 229 ---QYLNICRRDHLLAVGD 244
              Q +  C   HL+ + D
Sbjct: 261 LALQSVEYCENSHLVVLDD 279


>gi|311031163|ref|ZP_07709253.1| alpha/beta hydrolase fold protein [Bacillus sp. m3-13]
          Length = 245

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 98/221 (44%), Gaps = 38/221 (17%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDY 79
           +GD  A  +L++HG   + ++   F   I+   + + +  I  D LGHGK+D       Y
Sbjct: 13  IGD-GAHHVLMLHGFTGNGRS---FEDVIEGFENREDYTFILVDQLGHGKTDAPAHHERY 68

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG------- 132
           ++  M  D  S+L+ L IS V + GYSMG R+A S  + YP  V  ++L           
Sbjct: 69  KMEKMLVDLKSILDRLSISSVSIYGYSMGGRVALSFAVAYPELVSKLVLESASPGLEKLE 128

Query: 133 --SVLYDSD--------------VVDWQSLIDSFL----LPSIDEVQNPLGKKFRKFADL 172
             S   ++D               VD+ + I  F     LP++   Q  + K+    + L
Sbjct: 129 DRSARKEADEKLAERIEKDGVKSFVDFWTDIPLFQSQKSLPAVK--QESIYKQRLNNSPL 186

Query: 173 DPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD 213
              N L+ L + +    +P     L +I+ PVL+A G  D+
Sbjct: 187 GLANSLRGLGTGV----QPSNWSYLDKIECPVLLAAGEWDE 223


>gi|119356747|ref|YP_911391.1| alpha/beta hydrolase fold [Chlorobium phaeobacteroides DSM 266]
 gi|119354096|gb|ABL64967.1| alpha/beta hydrolase fold protein [Chlorobium phaeobacteroides DSM
           266]
          Length = 320

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 109/257 (42%), Gaps = 44/257 (17%)

Query: 18  FYDVGDKDAP-TILLIHGLASSVQTNWLFSGW-IQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           ++D G KDA  T+LLIHG        W++  + I  L ++G R IA+D  GHG SD    
Sbjct: 56  YHDSGPKDAARTVLLIHGW----DCWWMWWHYVINYLNERGIRTIAYDMRGHGWSDND-P 110

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
           +N Y + F A D   L+  L + K H+  +S G  +A     F+P  ++S+     G  L
Sbjct: 111 DNHYHIDFFAHDLHDLVIKLQLGKFHIAAFSFGPFVALDYARFHPELIQSMTFFNFG-YL 169

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFR------KFADLDPGND----------LK 179
            +S      + I +F   +I  V N L +K         FA L    +           K
Sbjct: 170 PNS------AFIQAFATNTITFVFNNLLRKLTWWLPAYMFARLVLAKNTILLHDILIGFK 223

Query: 180 ALASC-----------LSMIRKPFCQDDLYR-IDVPVLIAVGSQDDL--AGSPQELMSFI 225
           +L  C           ++ I       ++ + +D+P+L   G  D +    + ++L+   
Sbjct: 224 SLGLCAPEAIDQTTRQITAIETTESVPEMVKAVDIPILFVAGEGDAIMTCENTKKLVELT 283

Query: 226 PSSQYLNICRRDHLLAV 242
               Y+ +    HL+ V
Sbjct: 284 HRGNYVEVPECGHLITV 300


>gi|169795812|ref|YP_001713605.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter baumannii AYE]
 gi|169148739|emb|CAM86605.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter baumannii AYE]
          Length = 270

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 107/259 (41%), Gaps = 40/259 (15%)

Query: 2   MNEVKFFRSWRKYQFAFYDV-------GDKDAPTILLIHGLASSVQTNW-LFSGWIQLLC 53
           MN +K F+  +   F   D        G+  +P ++     ++S+ TN+ ++      L 
Sbjct: 1   MNVLKHFKEKQMPSFQSADAQINYQTFGEPSSPALVF----SNSLGTNYGMWQKQFNELK 56

Query: 54  DQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIAC 113
           DQ F VI +DN GHG S  S  +  Y +  +  D V LL+HL ISK    G SMG     
Sbjct: 57  DQ-FFVICYDNRGHGSS--STPDGPYTVEQLGEDVVRLLDHLNISKAAFCGISMGGLTGQ 113

Query: 114 SMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLD 173
            + + YP+    V++    + +        Q+ +D   L     +Q P+          D
Sbjct: 114 WLAIHYPNRFSHVVVANTAAKIGQE-----QAWLDRAKLVREQGLQ-PIAATAASRWFTD 167

Query: 174 P------------GNDLKA-----LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA- 215
           P             NDL A      A+C   + K   ++ L  I +PVL+  G+QD +  
Sbjct: 168 PFIQSHPSIVNNLCNDLSAGSAIGYANCCEALAKADVREQLKDIKIPVLVVAGTQDPITT 227

Query: 216 -GSPQELMSFIPSSQYLNI 233
               + +   IP S+   I
Sbjct: 228 VADGEFMQQRIPQSKLTEI 246


>gi|254491250|ref|ZP_05104431.1| hydrolase, alpha/beta fold family, putative [Methylophaga
           thiooxidans DMS010]
 gi|224463763|gb|EEF80031.1| hydrolase, alpha/beta fold family, putative [Methylophaga
           thiooxydans DMS010]
          Length = 334

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 8/129 (6%)

Query: 4   EVKFFRSWRK-YQFAFYDVG---DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRV 59
           E+  F S ++  + A+ DV    + +  T++L+HG      T   ++  IQ L   G+RV
Sbjct: 39  EIMTFESQQQQLEMAYMDVSPVTEANGQTVVLLHGKNFCAAT---WANLIQALTQHGYRV 95

Query: 60  IAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
           IA D +G  KS K  ++  Y    +A +   LL+ LG+    +MG+SMG  +A    L Y
Sbjct: 96  IAVDQIGFCKSSKP-LDYQYSFHQLATNTRLLLDKLGVETSFIMGHSMGGMLASRYALLY 154

Query: 120 PSYVRSVIL 128
           P +V  +++
Sbjct: 155 PEHVTGLMM 163


>gi|108761042|ref|YP_628502.1| alpha/beta fold family hydrolase [Myxococcus xanthus DK 1622]
 gi|108464922|gb|ABF90107.1| hydrolase, alpha/beta fold family [Myxococcus xanthus DK 1622]
          Length = 396

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 31/229 (13%)

Query: 15  QFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           Q A+ D+     DA  ++ IHGL S ++    +   +     QG+RVIA D  G+GKSDK
Sbjct: 68  QIAYVDMPGSGPDAKAVVFIHGLGSYLK---FWRAQLDAFQKQGYRVIAVDLPGYGKSDK 124

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                 Y +  MA   + L++ LG+ K  + G+SMG + + S  + YP  +  ++L    
Sbjct: 125 PGT-FPYTMEAMADAVLELVDGLGLDKPVLAGHSMGGQTSLSFAIRYPESLSGLVLASPA 183

Query: 133 S--------------------VLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADL 172
                                +    +   W S+  +  +    E++  + ++ R     
Sbjct: 184 GFEKFSWREKEWFARAMSSEFIKSAPEASIWGSVRQANFMHWRPELEWLIEERVRLAK-- 241

Query: 173 DPGNDLKALASCLS---MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP 218
            P  D  A A+  +   +    F +D+L+R+ VP +I  G+ D L  SP
Sbjct: 242 SPEFDAYAYANVRTVRGLSHNDFVRDNLHRVTVPTVIIYGTDDRLIPSP 290


>gi|170750451|ref|YP_001756711.1| alpha/beta hydrolase fold [Methylobacterium radiotolerans JCM 2831]
 gi|170656973|gb|ACB26028.1| alpha/beta hydrolase fold [Methylobacterium radiotolerans JCM 2831]
          Length = 319

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 76/163 (46%), Gaps = 25/163 (15%)

Query: 19  YDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN---------LGHG 68
           YD  GD  A TILLI GL + +   W    + + L ++GFRV+ FDN           HG
Sbjct: 19  YDCFGDAAAETILLIAGLGTQM-IRWT-EAFCRALAERGFRVVRFDNRDSGRSTAFTAHG 76

Query: 69  KSDKSYIEND----------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
            +D + +             Y L  MA DAV LL+ L + + HV+G SMG  IA  +   
Sbjct: 77  ATDFAALSAALAEGRRPDLAYTLADMAQDAVGLLDALSVRRAHVVGRSMGGMIAQILASE 136

Query: 119 YPSYVRSV--ILGGVGSVLYDSDVVDWQSL-IDSFLLPSIDEV 158
           +P+ V S+  I+   G+        D  +L +     PS+DE 
Sbjct: 137 HPARVGSLTAIMSSTGNPGLPPAAPDAMALMMRPAPDPSLDEA 179


>gi|239930605|ref|ZP_04687558.1| hydrolase [Streptomyces ghanaensis ATCC 14672]
 gi|291438970|ref|ZP_06578360.1| hydrolase [Streptomyces ghanaensis ATCC 14672]
 gi|291341865|gb|EFE68821.1| hydrolase [Streptomyces ghanaensis ATCC 14672]
          Length = 292

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 105/247 (42%), Gaps = 42/247 (17%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           + AP +LL+HGL     ++W  +  W+     +  R +A D  GHG+SDK       R  
Sbjct: 36  QGAPGVLLLHGLMGRA-SHWAPTARWLS----ERHRAVALDQRGHGRSDKPPQAAFTRDA 90

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVV 141
           ++  DA + LE LG+    ++G++MGA  A  +    P  VR +I+  +  S L  +   
Sbjct: 91  YVD-DAEAALEQLGLGPAVLIGHAMGALTAWQLAAKRPDLVRGLIICDMRASALGGASQH 149

Query: 142 DWQSLIDSFLLPSID---------------EVQNPLGKKFRKFADL------------DP 174
           +W     ++ +P                  E  NP   +F  +A++            DP
Sbjct: 150 EWAEWFKAWPVPFATLADVRKWFGEDDPWVERPNPARGEF--YAEVMAESPDGWRPVFDP 207

Query: 175 GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNI 233
              L++  + +S        D+L ++  P L+  G   +L     QE++  +P  +Y  +
Sbjct: 208 EQMLRSRETWVSDAH----WDELAQVRCPALVVRGLDGELGRAEAQEMVRVLPHGRYAEV 263

Query: 234 CRRDHLL 240
               HL+
Sbjct: 264 ADAGHLV 270


>gi|323528852|ref|YP_004231004.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1001]
 gi|323385854|gb|ADX57944.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1001]
          Length = 276

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 104/248 (41%), Gaps = 21/248 (8%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +A Y  G   AP ILL  GL  S   NW +   +  L D G R +  D+ GHG+S +   
Sbjct: 45  YASYGTG---APVILLHGGLGHS--GNWGYQ--VPALLDAGHRAVVIDSRGHGRSTRDAR 97

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              Y L  MA+D +++++ L +++  ++G+S GA +A  + +  P  V  V   G     
Sbjct: 98  PYQYEL--MASDVLAVMDRLSLARAAMVGWSDGACVAMVLGMVAPERVAGVFFFGCN--- 152

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP-FCQ 194
                +D     +    P I+   N   + + + +      D   +A    M  +P +  
Sbjct: 153 -----MDPGGTKEFVATPVIERCFNRHRRDYVRLSATPDDFDPFVVAVSEMMRTEPNYAA 207

Query: 195 DDLYRIDVPVLIAVGSQDDLAG--SPQELMSFIPSSQYLNICRRDHLLAVG-DKQFKQGV 251
            DL RI VPVLI     D+       + L   IP +Q   +    H   +     F + +
Sbjct: 208 RDLARIRVPVLIVQSEHDEFIKLEHAEYLARSIPGAQLRMLPGVSHFAPLQRPASFNRTM 267

Query: 252 VNFYANEL 259
           V F A  L
Sbjct: 268 VAFTARVL 275


>gi|229489961|ref|ZP_04383814.1| hydrolase, alpha/beta fold family [Rhodococcus erythropolis SK121]
 gi|229323062|gb|EEN88830.1| hydrolase, alpha/beta fold family [Rhodococcus erythropolis SK121]
          Length = 281

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 81/186 (43%), Gaps = 18/186 (9%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQL---LCDQGFRVIAFDNLGHGKSDK 72
           F   D G  D P ++L+HG           S W QL   L  +GFR +A D  G+    +
Sbjct: 18  FDVRDEGPADGPVVVLLHGFPQDS------SSWDQLAPLLHTRGFRTVAPDQRGYSPGAR 71

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                 YR   +AAD V+L++ L + KVH++G+  GA +A  +    P  + +V    V 
Sbjct: 72  PKARWAYRGSELAADTVALIDALAVGKVHLVGHDWGAAVAWQVAAERPDLLNTVTAVSVP 131

Query: 133 SVL--YDSDVVDWQSL----IDSFLLPSIDE---VQNPLGKKFRKFADLDPGNDLKALAS 183
             L    + V   Q L    + +F LP + E        G+KF   +   P N  + L +
Sbjct: 132 HPLAFVKAMVTSTQGLKSWYMGAFQLPFVPEKVLSSTSAGEKFLISSGQTPENARRDLNA 191

Query: 184 CLSMIR 189
            L+  R
Sbjct: 192 MLAPGR 197


>gi|143185|gb|AAC37015.1| unknown [Bacillus subtilis]
 gi|557491|gb|AAA50400.1| Unknown [Bacillus subtilis]
          Length = 195

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 5/114 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           ++A  D G   +  ++ +HG   S Q+ W F    ++L D   R+I  D LGHG++D   
Sbjct: 13  RYAVADEGPNASEAVVCLHGFTGSKQS-WTF--LDEMLPDS--RLIKIDCLGHGETDAPL 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
               Y      +D   + + L + KV ++GYSMG R+A S  + YPS  R + L
Sbjct: 68  NGKRYSTTRQVSDLAEIFDQLKLHKVKLIGYSMGGRLAYSFAMTYPSGYRHLCL 121


>gi|329895878|ref|ZP_08271206.1| hydrolase protein [gamma proteobacterium IMCC3088]
 gi|328922096|gb|EGG29455.1| hydrolase protein [gamma proteobacterium IMCC3088]
          Length = 239

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 99/227 (43%), Gaps = 29/227 (12%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           +RVIA D  G G+SD     ++Y+      D  +LL+ LGI +V V+G SMG  ++  M 
Sbjct: 6   YRVIAVDQRGRGRSDYDPNSDNYQPAIYCQDMFTLLDSLGIDEVSVIGTSMGGLMSFIMT 65

Query: 117 LFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLP-----SIDEVQNPLGKKFRKFAD 171
              P+ ++S+++  +G  +    +   QS +     P     ++ +V++  G  F  F D
Sbjct: 66  TLAPTRIKSLVINDIGPEVDPVGLARIQSYVGKLAPPETWDAAVAQVKSINGPAFPDFGD 125

Query: 172 LD----------------PGNDLKA-LASCLSMIRKPFCQDDLYR-----IDVPVLIAVG 209
            +                P  D  A ++  +   +      DL++     +  P+L+  G
Sbjct: 126 AEWISFTRNLYIESVEGKPKLDYDASISKPMDASQTAAVPPDLWQFFDATLSKPMLLVHG 185

Query: 210 SQDDLAGSP--QELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
           +  D+       ++ +  P+ QYL +  R H   + + + +  + NF
Sbjct: 186 ALSDILADDCVAKMQAKHPTMQYLRLENRGHAPTLDEPESRLAITNF 232


>gi|327481653|gb|AEA84963.1| alpha/beta fold family hydrolase [Pseudomonas stutzeri DSM 4166]
          Length = 335

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (49%), Gaps = 17/135 (12%)

Query: 2   MNEVKFFRSWRKYQFAFYDV---GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQ 55
           +   +F    +  Q A+ DV   G  +  T LL+HG       N+  + W   I++L + 
Sbjct: 41  LKHYRFESQGKPMQMAYMDVAPTGKANGRTALLLHG------KNFCGATWERTIEVLSEA 94

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVF--MAADAVSLLEHLGISKVHVMGYSMGARIAC 113
           G+RVIA D +G   S K      Y+  F  +A +  +LL+  GI +V V+G+SMG  +A 
Sbjct: 95  GYRVIAPDQVGFCSSSKP---EGYQFSFAQLAHNTQALLQQEGIDQVSVIGHSMGGMLAA 151

Query: 114 SMVLFYPSYVRSVIL 128
            + L YP     ++L
Sbjct: 152 RLALSYPQLAEQLVL 166


>gi|283798474|ref|ZP_06347627.1| hydrolase, alpha/beta hydrolase fold family [Clostridium sp. M62/1]
 gi|291073732|gb|EFE11096.1| hydrolase, alpha/beta hydrolase fold family [Clostridium sp. M62/1]
 gi|295090748|emb|CBK76855.1| Predicted hydrolases or acyltransferases (alpha/beta hydrolase
           superfamily) [Clostridium cf. saccharolyticum K10]
          Length = 249

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 112/245 (45%), Gaps = 18/245 (7%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+      P +LL HG   + + +  F   ++    + +RVIA D  GHGKS++     
Sbjct: 4   YYEETGNGEPMVLL-HG---NGEDSSYFKNQVEYFS-KNYRVIAVDTRGHGKSERGTA-- 56

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            + L   A D    L+ + +  + ++G+S G  IA    + YP YV+ +IL G       
Sbjct: 57  PFTLKQFAWDLKKFLDRMQLRDIILLGFSDGGNIALIFTILYPGYVKKLILNGANLNPSG 116

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKF-AD----LDPGNDLKALASCLSMIRKPF 192
             +   +S+  S+L       +    +K  K  AD    L+     K L     MI++P 
Sbjct: 117 MKMGIRKSIAVSYLKTMWRVKRGTCREKRGKLTADQKYLLERARRKKELLEL--MIKEPH 174

Query: 193 CQDD-LYRIDVPVLIAVGSQDDL-AGSPQELMSFIPSSQYLNICRRDHLLAVGDK-QFKQ 249
                L +++VP L+  G++D +  G  +++ S IP+S+ L +    H +A  +  +F Q
Sbjct: 175 ISGAYLKQLNVPTLVIAGTRDMIKTGHTKKIHSLIPASR-LCLVEGTHFIASENSLEFNQ 233

Query: 250 GVVNF 254
            V  F
Sbjct: 234 AVERF 238


>gi|149277261|ref|ZP_01883403.1| hydrolase, alpha/beta fold family protein [Pedobacter sp. BAL39]
 gi|149232138|gb|EDM37515.1| hydrolase, alpha/beta fold family protein [Pedobacter sp. BAL39]
          Length = 329

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 5/101 (4%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T++L HG        + ++  I+ L  +GFRVI  D +G GKS K++I   Y    MA  
Sbjct: 69  TVILFHGKNFG---GYYWTEVIKALTSRGFRVIVPDQIGFGKSSKAFIH--YSFHQMARW 123

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             +LL+ LGI+K +V+G+SMG  +A    L YP     ++L
Sbjct: 124 NKALLDTLGIAKANVLGHSMGGMLAMRFALMYPQTTEKLLL 164


>gi|119475649|ref|ZP_01616002.1| putative hydrolase [marine gamma proteobacterium HTCC2143]
 gi|119451852|gb|EAW33085.1| putative hydrolase [marine gamma proteobacterium HTCC2143]
          Length = 308

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (51%), Gaps = 8/128 (6%)

Query: 6   KFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNL 65
           +F+ +    Q +F D G  D P ++L+HG+     +  L +    L  D  F V+A D  
Sbjct: 15  RFYFTHSNCQLSFVDFGSPDKPALILLHGMRDHALS--LLNVAQALKND--FHVVALDMR 70

Query: 66  GHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-R 124
           GHG+SD   I   Y ++   AD  +L+++ G+ K  ++ +SMG  IA      +P  V R
Sbjct: 71  GHGRSDNPGI---YTMIHYVADVRALVQYCGLDKPVIVAHSMGGHIASRYSAAFPDEVDR 127

Query: 125 SVILGGVG 132
            ++L G+G
Sbjct: 128 LILLDGMG 135


>gi|110634867|ref|YP_675075.1| alpha/beta hydrolase fold [Mesorhizobium sp. BNC1]
 gi|110285851|gb|ABG63910.1| 3-oxoadipate enol-lactonase [Chelativorans sp. BNC1]
          Length = 275

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 101/225 (44%), Gaps = 42/225 (18%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y +    +  ++ IHG+ S ++    +SG ++ L D+ F V  FD  GHG+S +  I+  
Sbjct: 17  YRIDGVGSEPLVCIHGVGSYLEA---WSGVVEQLADR-FTVATFDLRGHGRSTR--IKGR 70

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---------- 128
           Y +     + +++ E  G  + H+ G+S+G  IA  + L +P  +R ++L          
Sbjct: 71  YEIDDFVRETLAIAELAGFDRFHLAGFSLGGLIAQRLALTHPERLRRLVLLSTVAGRSAE 130

Query: 129 --------------GGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDP 174
                         G  GS  YDS +  W  L + F      +  NP  +  R+  + + 
Sbjct: 131 EQQRVRARLAALQTGDRGS-HYDSSLSRW--LTEEF------QAANP--ELIRRMRERNA 179

Query: 175 GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ 219
            ND    A+   ++ +      L +I VP LIA G +DD+  +P+
Sbjct: 180 ENDPDCYAAAYRVLAETDFGGFLDQIRVPTLIATG-EDDMGSNPR 223


>gi|149185926|ref|ZP_01864241.1| hydrolase, alpha/beta hydrolase fold family protein [Erythrobacter
           sp. SD-21]
 gi|148830487|gb|EDL48923.1| hydrolase, alpha/beta hydrolase fold family protein [Erythrobacter
           sp. SD-21]
          Length = 337

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 100/220 (45%), Gaps = 34/220 (15%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           D G +DAP I+L+HG  + + T   +  W ++L +  +RVI FD  GHG +  +  ++DY
Sbjct: 56  DEGPRDAPVIVLLHGSNADLHT---WQEWAEILRED-YRVIRFDQRGHGLTGPAP-DDDY 110

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GG------ 130
                 AD  ++ + LG+    + G SMG  IA +  L  P  + +++L   GG      
Sbjct: 111 SAQGFGADIDAVTDKLGVDTFTLAGNSMGGGIAMAYALDKPWRLDALVLVDAGGAPVKRE 170

Query: 131 --------------VGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLD--P 174
                         VG VL  S ++  +SL+   L  S+   Q    +   ++ +L   P
Sbjct: 171 GGGNLAFTLAGMPVVGDVL--SQLLP-RSLVAKSLSQSVSNQQAVTDEAIDRYWELARYP 227

Query: 175 GNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL 214
           GN   A     S  R  F   ++ R+ VP L+  G +D L
Sbjct: 228 GNR-GATRKRFSAPRTAFDAAEIGRVKVPTLVMWGKEDAL 266


>gi|91779555|ref|YP_554763.1| putative peroxidase [Burkholderia xenovorans LB400]
 gi|91692215|gb|ABE35413.1| putative peroxidase [Burkholderia xenovorans LB400]
          Length = 281

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 111/246 (45%), Gaps = 27/246 (10%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +A Y  G    P ILL  GL  S   NW +   +  L   G RV+  D+ GHG+S +   
Sbjct: 50  YASYGAG---VPVILLHGGLGHS--GNWGYQ--LPALLGAGRRVVVVDSRGHGRSTRD-- 100

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              YR   MA+D +++++ L + +  ++G+S GA +A  MVL   +  R      V  V 
Sbjct: 101 ARPYRYELMASDVLAVMDTLQLERAALVGWSDGACVA--MVLGITAAER------VAGVF 152

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP---F 192
           +    +D          P+++   +   K + + +     +D +A    +S + K    +
Sbjct: 153 FFGCNMDPSGTKTFAPTPTVERCFSRHAKDYAQLSATP--DDFEAFVGAVSTMMKTEPNY 210

Query: 193 CQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNICRRDHLLAVG-DKQFK 248
           C DDL R+ VPV I V S+ D    P+    L   IP ++ + +    H   +    QF 
Sbjct: 211 CADDLARVRVPVAI-VHSEHDEFIEPEHADYLARTIPGAELILLSGVSHFAPLQRPAQFN 269

Query: 249 QGVVNF 254
           Q +++F
Sbjct: 270 QVMLDF 275


>gi|146343234|ref|YP_001208282.1| alpha/beta superfamily hydrolase [Bradyrhizobium sp. ORS278]
 gi|146196040|emb|CAL80067.1| putative alpha/beta-Hydrolases superfamily; putative 3-oxoadipate
           enol-lactonase [Bradyrhizobium sp. ORS278]
          Length = 287

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 107/252 (42%), Gaps = 28/252 (11%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +L +H  A+   TNW     ++    +  R IA+   G+  SD     + Y  V    DA
Sbjct: 23  LLFLHEFAAD-HTNW--EPQLRYFARR-HRCIAYAARGYTPSDVPVSPDVYSYVHFYTDA 78

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV--GSVLYDSDVVDWQSL 146
           +++L+HLGI   H +G SMG+  +  + L  P  +RS++L GV  GS L   D    Q  
Sbjct: 79  LAVLDHLGIDSAHFVGLSMGSYSSLQVALNAPDRIRSMVLAGVGSGSSLEHLDAFRAQCR 138

Query: 147 IDSFLLPSIDEVQNP------------LGKKFRKFADLDPG---NDLKALASCLSMIR-- 189
             +    ++  V+              L K  R  AD       +D K  A+ +   +  
Sbjct: 139 ATAEQFETLGSVETAKVTREAPGRIPFLVKDPRGHADFYAALARHDAKGSANTMRGFQGG 198

Query: 190 KP---FCQDDLYRIDVPVLIAVGSQDDLAGSPQE-LMSFIPSSQYLNICRRDHLLAVGDK 245
           +P      D + R+  P LI  G +DD   +P   L   +P+S  +   +  H+L + + 
Sbjct: 199 RPSIYTMTDAICRVATPALIICGDEDDACVAPSLFLKQHLPASGLMVFPKSGHVLNLEEP 258

Query: 246 Q-FKQGVVNFYA 256
             F + V  F A
Sbjct: 259 ALFNEAVERFIA 270


>gi|260550300|ref|ZP_05824512.1| 3-oxoadipate enol-lactonase I [Acinetobacter sp. RUH2624]
 gi|260406612|gb|EEX00093.1| 3-oxoadipate enol-lactonase I [Acinetobacter sp. RUH2624]
          Length = 261

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 112/269 (41%), Gaps = 34/269 (12%)

Query: 6   KFFRSWRKYQFAFYDVGDKDAPTILLIHGLAS-----SVQTNWLFSGWIQLLCDQGFRVI 60
           +  R+ +  Q A Y  G KDAP ++  + L +       Q N L S          F VI
Sbjct: 3   QTIRNRQGKQLAVYTDGLKDAPVLVFSNSLGTDHGMWQPQLNELKSH---------FNVI 53

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
            +D  GHG+SD   + +D  L  +A D V +L+ L I K H  G SMG      + + + 
Sbjct: 54  TYDTRGHGESD---VISDTTLQNLAEDVVDILDALNIEKAHFCGISMGGITGLWLAIHHQ 110

Query: 121 SYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-----LGKKFRKFADLDPG 175
           +   S+ +    + +  ++   W S  +S     + E+          +KF    ++   
Sbjct: 111 NRFNSITVANSAAKIGQTEA--WLSRAESVEQNGLAELVKTTHTRWFSEKFDYQHNIVAQ 168

Query: 176 NDLKALASCLSMIRKPFC--------QDDLYRIDVPVLIAVGSQDDLAG-SPQELMSFIP 226
             +++LA+  +      C        +D++ +I +PVL+  G++D +   +  E M    
Sbjct: 169 TTIQSLANTPAQGYANACRALAYADLRDEIAQIQIPVLLIAGTEDPVTTVADAEFMQKAI 228

Query: 227 SSQYLNICRRDHLLAVGDKQ-FKQGVVNF 254
            +  L      HL ++   Q F Q +  F
Sbjct: 229 KNSQLAKLEASHLSSIEQPQRFTQELTRF 257


>gi|120401989|ref|YP_951818.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119954807|gb|ABM11812.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
          Length = 260

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 114/269 (42%), Gaps = 34/269 (12%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
             AF D G  D   +L I G   + +T  L    + +    G+R + FDN G G ++ + 
Sbjct: 2   NLAFDDRGSGDP--VLFIAGRGGAGRTWHLHQ--VPVFTRAGYRCVTFDNRGIGATENA- 56

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
             + +    M  D  +L+EHLG++ V ++  SMG+ IA  +++  P  V+S +L      
Sbjct: 57  --SGFTTETMVGDTAALIEHLGLAPVRIVALSMGSYIAQELMVARPELVKSAVLMATRGR 114

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG--NDLKALASCLSMI---- 188
              +    WQ   +  L  S  E+      K R      P   ND  A+   + M     
Sbjct: 115 HDRTRDFFWQG--ERALAESGIELPIEFEAKVRLLESFSPNTLNDDNAVRDWIDMFTMWP 172

Query: 189 RKPF----CQDDL----------YRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYL 231
           +KP      Q D+            +  PVL+ +G  DD+       +E+ + +P+ ++L
Sbjct: 173 QKPTPGMRTQLDIAPQGSRLSAYQSVTTPVLV-IGFADDVVLPSYLGREVANALPNGRFL 231

Query: 232 NICRRDHLLAVGDKQ-FKQGVVNFYANEL 259
            I    HL  +   Q     ++NF+A+ L
Sbjct: 232 EIPGTGHLGFIEKPQVVNTAILNFFADTL 260


>gi|332034863|gb|EGI71394.1| esterase YbfF [Pseudoalteromonas haloplanktis ANT/505]
          Length = 255

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 21/146 (14%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           P ++LIHGL  S++   + +  +     + F VI  D   HG S  S   ++     MA 
Sbjct: 12  PNVILIHGLFGSLENLNVIAKPL----SEHFNVINVDLRNHGLSPHS---DEMNYPAMAQ 64

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY---------- 136
           D V LL HL I K H++G+SMG ++A  + L +P  V  +++  +  V Y          
Sbjct: 65  DIVELLAHLNIDKAHLVGHSMGGKVAMELALTHPELVNKLVVLDIAPVSYPARHTKILQA 124

Query: 137 ----DSDVVDWQSLIDSFLLPSIDEV 158
                +  +D +   D+ + P I+E+
Sbjct: 125 LKAVSTQSIDDRKQADAIMQPYIEEL 150


>gi|313498414|gb|ADR59780.1| Alpha/beta hydrolase fold project [Pseudomonas putida BIRD-1]
          Length = 277

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 115/249 (46%), Gaps = 37/249 (14%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           ++ DVG      ++LIHG+  + +   ++ G    L +  +RVIA+D LGHG+S      
Sbjct: 14  SYLDVGQGQ--PVVLIHGVGLNKE---MWGGQFVGLAND-YRVIAYDMLGHGQS--RVPA 65

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS-VILGGV-GSV 134
            D  L   A     LL+HL I++  V+G+SMG  +A +  L YP  + + V+L  V    
Sbjct: 66  TDTPLEGYADQLAELLDHLQIAQATVIGFSMGGLVARAFALNYPQRLAALVVLNSVFNRT 125

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF-RKFADLDPG-----------NDLKALA 182
              S  V  ++   + L P  + V   L + F R++   +P            ND +   
Sbjct: 126 PEQSAGVIARAAQAAELGPDAN-VDAALDRWFSREYKAANPAQVAAIRQVLASNDPQGYH 184

Query: 183 SCLSMIRKPFCQDDLYRID------VPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNI 233
           +  S+    F   D+YR D      VP LIA G  D    +P   ++L + IP ++ + +
Sbjct: 185 TTYSL----FATQDMYRADDLGSIQVPTLIATGELDS-GSTPAMTRQLAASIPGARSVVL 239

Query: 234 CRRDHLLAV 242
             + H++ V
Sbjct: 240 AEQRHMMPV 248


>gi|289642917|ref|ZP_06475052.1| alpha/beta hydrolase fold protein [Frankia symbiont of Datisca
           glomerata]
 gi|289507300|gb|EFD28264.1| alpha/beta hydrolase fold protein [Frankia symbiont of Datisca
           glomerata]
          Length = 356

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 62/124 (50%), Gaps = 8/124 (6%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Y+ A+   G    P +LLIHG+  + Q+   + G + LL  +G  VI  D LGHG+SDK 
Sbjct: 54  YRRAYIRAGR--GPALLLIHGVGDNSQS---WRGLVPLLA-RGRTVIVPDLLGHGESDKP 107

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
               DY +   A     LL  LGI +V V+G+S+G  IA      +P     V+L   G 
Sbjct: 108 --RGDYSIGGYACGMRDLLTVLGIDRVTVVGHSLGGGIAMQFAYQFPERCERVVLVATGG 165

Query: 134 VLYD 137
           V  D
Sbjct: 166 VCPD 169


>gi|301060167|ref|ZP_07201034.1| putative 3-oxoadipate enol-lactonase [delta proteobacterium NaphS2]
 gi|300445679|gb|EFK09577.1| putative 3-oxoadipate enol-lactonase [delta proteobacterium NaphS2]
          Length = 265

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 112/244 (45%), Gaps = 43/244 (17%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G +DA  ++L H L S +    +++  +Q L +  FRV+ +D  GHG+SD    E  Y L
Sbjct: 16  GKEDASVVVLSHSLGSGMA---MWNPQLQAL-EPYFRVLRYDMRGHGQSDAP--EGAYNL 69

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD-- 139
             +AAD + LL+ LG++ VH +G S+G  I   + L Y S ++S++L     V+      
Sbjct: 70  DQLAADVIGLLDALGMNAVHFVGLSIGGMIGQCLGLNYASRLKSLVLCDTAPVIPKEARP 129

Query: 140 -VVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPF------ 192
              + +       +P++  V+  L + F         + LKA +  + +IRK F      
Sbjct: 130 MFKEREQTAREKGMPAL--VEGTLQRWFTL-------SYLKANSPAIDLIRKQFLATPVT 180

Query: 193 ----CQ---------DDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICR 235
               C          D L  I +P LI VG  D   G+P    + + + IP+++   +  
Sbjct: 181 GYIGCSEAILGLDYVDRLSEIKLPSLILVGEDD--TGTPVAASEAIHARIPNAKLEILPS 238

Query: 236 RDHL 239
             HL
Sbjct: 239 AAHL 242


>gi|300783783|ref|YP_003764074.1| 3-oxoadipate enol-lactonase [Amycolatopsis mediterranei U32]
 gi|299793297|gb|ADJ43672.1| 3-oxoadipate enol-lactonase [Amycolatopsis mediterranei U32]
          Length = 260

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 100/236 (42%), Gaps = 27/236 (11%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  D P ++    L S ++   ++   +  L ++GFRV+ +D  GHG S        Y L
Sbjct: 14  GPGDGPVVVFGGSLGSDLR---MWEPQVAPLVERGFRVVRYDARGHGAS--PVPPGPYEL 68

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL----GGVG----- 132
             + AD ++LL+ LG+ + H++G S+G      + +  P  + S++L      +G     
Sbjct: 69  EDLGADVLALLDELGVERAHLVGLSLGGMTGMWLGVHAPDRIASLVLCCTSAKLGPPSMW 128

Query: 133 -----SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
                +V  +      ++ +  +L P   E      +  R      P    +  A+C  +
Sbjct: 129 AERARTVRAEGTAAVAEAAVKRWLTPGFIERHPDRAEFLRAMIAAVPA---EGYAACCGV 185

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE----LMSFIPSSQYLNICRRDHL 239
           I +    + L +I  P L+  G+ DD A SP E    +   IP ++   +    HL
Sbjct: 186 IERMDLLELLPKITAPTLVIAGA-DDPATSPDEHARPIAEGIPGARLEVVANAAHL 240


>gi|118616520|ref|YP_904852.1| lipase/esterase LipG1 [Mycobacterium ulcerans Agy99]
 gi|118568630|gb|ABL03381.1| lipase/esterase LipG1 [Mycobacterium ulcerans Agy99]
          Length = 314

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 60/115 (52%), Gaps = 22/115 (19%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK----- 72
           + D+GD +AP +LLI GL + +   W  +G+ Q   DQG RVI +DN   G S K     
Sbjct: 30  YEDMGDINAPPVLLIMGLGAQLLL-WR-TGFCQKPVDQGLRVIRYDNRDVGLSTKMEQPS 87

Query: 73  -----------SYI----ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
                      S++    +  Y L  MA DA +LL+HL I + H++G SMG  IA
Sbjct: 88  ARQPLMPQLIRSWLGRRSQTPYTLEDMADDAAALLDHLDIERAHIVGASMGGMIA 142


>gi|311743118|ref|ZP_07716926.1| carboxyl esterase [Aeromicrobium marinum DSM 15272]
 gi|311313798|gb|EFQ83707.1| carboxyl esterase [Aeromicrobium marinum DSM 15272]
          Length = 308

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 96/236 (40%), Gaps = 50/236 (21%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN---- 77
           GD   P +LL+ GL   +   W      +++  +G  V+ +DN   G+S K         
Sbjct: 33  GDPGDPAVLLVMGLGGPM--GWWDEELCRMIAARGHFVVRYDNRDTGRSTKLRQHRVGRT 90

Query: 78  --------------DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
                          Y +  +A DA+ LL+HLGI + HV G SMG  IA +M + +P+ V
Sbjct: 91  DLLRALVPKLGGAAPYSIGDLAEDAIGLLDHLGIDRAHVTGVSMGGMIAQTMAIAHPARV 150

Query: 124 RSVILGGVGSVLYDSD--VVDWQ--SLIDSFLLPSIDEVQNPLGKKFRKFADL------- 172
            S++     S++  +    V WQ  SL+ + L  S     + +    R    +       
Sbjct: 151 ASLV-----SIMSTTGRRTVGWQQPSLVPNLLGRSGPTRDDYIAAAIRSGELIGSPGYPP 205

Query: 173 DPGNDLK--------------ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL 214
           DPG   +               L   L+++ +P    DL R+ VP  +  G  D L
Sbjct: 206 DPGAARRRAEVTYDRGWIASGVLRHMLAVLTQPDRTADLARVTVPTTVIHGLADKL 261


>gi|218531383|ref|YP_002422199.1| alpha/beta hydrolase fold protein [Methylobacterium
           chloromethanicum CM4]
 gi|218523686|gb|ACK84271.1| alpha/beta hydrolase fold protein [Methylobacterium
           chloromethanicum CM4]
          Length = 340

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 14/126 (11%)

Query: 9   RSWRKYQFAFYDVGDKD---APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAF 62
           R     + A+ DV   D     T+LL+HG       N+  S W   I+ L + G+RV+  
Sbjct: 54  RDGEAQRLAYMDVPAADNANGRTVLLLHG------RNFPSSYWEPVIRTLSNAGYRVVVP 107

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D LG GKS K      Y    MAAD ++L + L I +  ++ +SMG  +A  M   YP  
Sbjct: 108 DQLGFGKSSKPI--GSYTFDRMAADTLALTDSLKIQRFDIVAHSMGGMLAVRMARNYPQR 165

Query: 123 VRSVIL 128
           V S++L
Sbjct: 166 VNSLVL 171


>gi|126664721|ref|ZP_01735705.1| predicted Hydrolase or acyltransferase (alpha/beta hydrolase
           superfamily) protein [Marinobacter sp. ELB17]
 gi|126631047|gb|EBA01661.1| predicted Hydrolase or acyltransferase (alpha/beta hydrolase
           superfamily) protein [Marinobacter sp. ELB17]
          Length = 315

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 70/128 (54%), Gaps = 6/128 (4%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           TI+++HG  ++ + NW  +   + L D+ F V A D  GHG+S K  ++  YRL    A 
Sbjct: 66  TIVMVHGFGAN-KDNW--TRMARELTDK-FNVYAIDLPGHGESSKP-LDLGYRLDQQVAH 120

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL-YDSDVVDWQSL 146
              +L+ L I+++H+MG SMG  I       YP  +++ +L     +L Y+S++ D    
Sbjct: 121 LARILQALDIAEMHIMGNSMGGAITALYAAAYPEQIKTAVLFDPAGILEYESELFDLVVA 180

Query: 147 IDSFLLPS 154
            D+ L+PS
Sbjct: 181 GDNPLIPS 188


>gi|46109668|ref|XP_381892.1| hypothetical protein FG01716.1 [Gibberella zeae PH-1]
          Length = 310

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T+L +HG  S++  +WL    I+    QG+ V+A D LG+G++ K      YRL  M+ +
Sbjct: 32  TLLFLHGFPSTLN-DWLHQ--IRHFSSQGYGVVALDMLGYGETSKPDHVAQYRLKPMSDE 88

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS----VLYDSDVVD 142
            + LL+HL +  V  +G+  GA +   +  ++PS   S++   VG       +D D+++
Sbjct: 89  VIELLDHLELKTVVGVGHDFGATLLSRIAAYHPSRWESLVFIAVGPPPLGTPFDVDLIN 147


>gi|311696120|gb|ADP98993.1| abhydrolase domain-containing protein 6 [marine bacterium HP15]
          Length = 312

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 8/131 (6%)

Query: 25  DAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           D  TI++IHG  ++ + NW   +G    L D  F V A D  GHG+S K  ++  YRL  
Sbjct: 63  DGDTIVMIHGFGAN-KDNWTRLAGH---LTDD-FNVYAIDLPGHGESSKP-LDIGYRLED 116

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL-YDSDVVD 142
            A     ++E L +   H+MG SMG  I       YP  V+S +L     +L Y+S++VD
Sbjct: 117 QAGYVARIMETLSVGNAHIMGNSMGGAITALYAASYPERVKSAVLFDPAGILEYESELVD 176

Query: 143 WQSLIDSFLLP 153
                D+ L+P
Sbjct: 177 LVMDGDNPLIP 187


>gi|296139538|ref|YP_003646781.1| alpha/beta hydrolase fold protein [Tsukamurella paurometabola DSM
           20162]
 gi|296027672|gb|ADG78442.1| alpha/beta hydrolase fold protein [Tsukamurella paurometabola DSM
           20162]
          Length = 309

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 100/242 (41%), Gaps = 39/242 (16%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           +   V     +R+     Y +G  D P +LLIHG+A +  T   F   ++ L ++ + VI
Sbjct: 4   VQRRVALIHGYRRA----YRIG-GDGPALLLIHGMADNSST---FEPILERLAER-YTVI 54

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           A D LGHG SD+     DY L         LL +LGI +  V+G+S+G  IA      YP
Sbjct: 55  APDLLGHGDSDRP--RADYSLPAFTNAMRDLLLYLGIDRATVVGHSLGGGIAGQFTYQYP 112

Query: 121 SYVRSVIL---GG----VGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP----LGK-KFRK 168
             V  ++    GG    V  VL  + V   +  I +  +P    V N     LGK   R 
Sbjct: 113 EVVERLVFVNTGGVTRSVSPVLRAASVPLSEIAIRAMAIPGALPVANAALTMLGKVPHRA 172

Query: 169 FAD----------LDPGNDLKALASCLSMIRKPFCQ-----DDLY-RIDVPVLIAVGSQD 212
           F D          L      +A    L  +  P  Q     D  Y   DVP L+  G+ D
Sbjct: 173 FVDNAECARVLAGLPHAGTPRAFTRTLRAVVDPRGQVVTMLDRSYLGADVPALVVWGADD 232

Query: 213 DL 214
            +
Sbjct: 233 PI 234


>gi|163841277|ref|YP_001625682.1| putative hydrolase [Renibacterium salmoninarum ATCC 33209]
 gi|162954753|gb|ABY24268.1| putative hydrolase [Renibacterium salmoninarum ATCC 33209]
          Length = 281

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 94/205 (45%), Gaps = 36/205 (17%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T++LIHG+     +++ F+       + GF VI FD+ GHGKS K  IE+ Y+L  +  D
Sbjct: 29  TLVLIHGMLFDNLSSFYFT-VAPAFAEAGFDVIMFDHRGHGKSKK--IESGYQLHNVVDD 85

Query: 88  AVSLLE--HLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQS 145
             +LL+  H G + VHV+G S G  +A S  L YP  V ++      S+  +     W  
Sbjct: 86  LAALLDEIHDG-TPVHVIGNSYGGTLAFSFALRYPERVATMT-----SIDAEPPTKSWLK 139

Query: 146 LIDSFLLPSIDEVQNP----------------LGKKFRKFADLDPGNDLKALASCLSMIR 189
           +ID  +  ++  +  P                LG+  +K  D     D + +     M  
Sbjct: 140 MIDDGMAEAMRVIDKPEVQSDFQAQWGQQGMRLGRAAKKILD-----DTRFM---YEMTD 191

Query: 190 KPFCQDD-LYRIDVPVLIAVGSQDD 213
            P   DD +  +D+PVL   GS+ +
Sbjct: 192 TPAVADDAIANLDMPVLAFYGSESE 216


>gi|326389665|ref|ZP_08211231.1| alpha/beta hydrolase fold protein [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325994380|gb|EGD52806.1| alpha/beta hydrolase fold protein [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 279

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 60/111 (54%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y++     P ++LI GL  S    W++   I  L  + F+VI FD  G G SDK  +E 
Sbjct: 12  YYEIHGNGQP-LVLIEGLGCS---KWMWFKQIYEL-KKYFKVIVFDLRGVGDSDKPDME- 65

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            Y +   A D  +L+  LG  KVH++G SMG  IA  + L YP+ V  +IL
Sbjct: 66  -YSIKLFADDTAALVTELGFKKVHILGVSMGGYIAQELALEYPALVDRLIL 115


>gi|302542939|ref|ZP_07295281.1| esterase [Streptomyces hygroscopicus ATCC 53653]
 gi|302460557|gb|EFL23650.1| esterase [Streptomyces himastatinicus ATCC 53653]
          Length = 297

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 62/115 (53%), Gaps = 9/115 (7%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSDKSYIEND 78
           GD  AP +LL+ G     Q   L  GW + L D   +  RVI +D+   G+S  SY +  
Sbjct: 25  GDAGAPALLLVMG----AQAAGL--GWPEPLVDALAEHHRVIRYDHRDTGRSTWSYEQAP 78

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
           YR+  +A D V++L+ LG+ + H++G S+G  +   ++  +P  V S  L G G+
Sbjct: 79  YRIADLAGDVVAVLDGLGVERAHLVGMSLGGILTQLVLADHPERVLSATLLGTGA 133


>gi|302809039|ref|XP_002986213.1| hypothetical protein SELMODRAFT_157803 [Selaginella moellendorffii]
 gi|300146072|gb|EFJ12744.1| hypothetical protein SELMODRAFT_157803 [Selaginella moellendorffii]
          Length = 1298

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 101/228 (44%), Gaps = 33/228 (14%)

Query: 14   YQFAFYDVGD--KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
            + F   +V    ++  T++ +HG   S + +WL    +       FR +A D  GHG++ 
Sbjct: 1020 FTFRVVEVASMLQEKQTVVFLHGFLGSAE-DWL---PVMHSLASSFRCLAVDLPGHGRAS 1075

Query: 72   --KSYIENDYRLVFMAADAVSLLEHLGI-SKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
                 +E ++ L  ++A    LLE L   S++ + GYSMGARIA  M L     +R+ ++
Sbjct: 1076 SVTGNLEAEWGLDVLSAALSELLEQLSEGSEIVLAGYSMGARIALYMALHKHQKIRAAVI 1135

Query: 129  GGVGSVLYDSD-----VVDWQSLIDSFLLPSIDEV-----QNPLGKKFRKFAD------- 171
                  L D            SL  S  L  +D       + PL K  R+  D       
Sbjct: 1136 VSGSPGLRDKQARIIRATQDDSLALSLRLGGLDNFVVNWYKRPLWKSLRRHPDFKNLIAS 1195

Query: 172  ---LDPGNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
               +  GN++ ALA  LS +   R+P   + L+   +P+L+ VG  D+
Sbjct: 1196 RLAMHKGNEV-ALAGALSQLSVGRQPCLWEQLHTASIPLLVVVGKADE 1242


>gi|300770304|ref|ZP_07080183.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylante synthase
           [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762780|gb|EFK59597.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylante synthase
           [Sphingobacterium spiritivorum ATCC 33861]
          Length = 363

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           GD   P ++ +HG   S+   +        L D G+ VIA D  GHG++    I      
Sbjct: 65  GDPKNPAVVWLHG---SLTNAYELMSIAPQLADAGYFVIAIDYYGHGQTP---IPAHEVS 118

Query: 82  VFMAADAVS-LLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           ++ AAD V  LL  L ISK ++ G+S GA IA +    YPS VR +IL   G+V ++S
Sbjct: 119 LYHAADDVHFLLNELNISKAYIGGFSRGAYIATAFYDSYPSSVRGLILEEGGTVAFNS 176


>gi|163852546|ref|YP_001640589.1| alpha/beta hydrolase fold [Methylobacterium extorquens PA1]
 gi|163664151|gb|ABY31518.1| alpha/beta hydrolase fold [Methylobacterium extorquens PA1]
          Length = 343

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 14/126 (11%)

Query: 9   RSWRKYQFAFYDVGDKD---APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAF 62
           R     + A+ DV   D     T+LL+HG       N+  S W   I+ L + G+RV+  
Sbjct: 57  RDGEAQRLAYMDVPAADNANGRTVLLLHG------RNFPSSYWEPVIRTLSNAGYRVVVP 110

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D LG GKS K      Y    MAAD ++L + L I +  ++ +SMG  +A  M   YP  
Sbjct: 111 DQLGFGKSSKPI--GSYTFDRMAADTLALADSLKIQRFDIVAHSMGGMLAVRMARNYPQR 168

Query: 123 VRSVIL 128
           V S++L
Sbjct: 169 VNSLVL 174


>gi|27377995|ref|NP_769524.1| hydrolase [Bradyrhizobium japonicum USDA 110]
 gi|27351141|dbj|BAC48149.1| bll2884 [Bradyrhizobium japonicum USDA 110]
          Length = 304

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 63/132 (47%), Gaps = 30/132 (22%)

Query: 19  YDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ----GFRVIAFDNLGHGKSD-- 71
           Y++ G+ +A  +LLI GL + +        W    C+Q    GFRVI FDN   GKS   
Sbjct: 19  YEIFGNDNAEPLLLIMGLGAQMIH------WDDAFCEQLAVHGFRVIRFDNRDIGKSSHL 72

Query: 72  -----------------KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
                            +  +   Y+L+ MA D V L++ LGI   H++G SMG  IA  
Sbjct: 73  TGGKRLTPLELLKLRFLRIPVAATYKLIDMARDTVGLMDALGIKSAHLVGASMGGMIAQE 132

Query: 115 MVLFYPSYVRSV 126
           + L +P  VRS+
Sbjct: 133 VTLSFPERVRSL 144


>gi|312889998|ref|ZP_07749542.1| alpha/beta hydrolase fold protein [Mucilaginibacter paludis DSM
           18603]
 gi|311297530|gb|EFQ74655.1| alpha/beta hydrolase fold protein [Mucilaginibacter paludis DSM
           18603]
          Length = 319

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 97/224 (43%), Gaps = 35/224 (15%)

Query: 15  QFAFYDV---GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           + A+ DV   G  +   ++L HG        + ++  I+ L  +G+RVI  D +G GKS 
Sbjct: 43  RMAYMDVKPAGVANGRVVILFHGKNFG---GYYWTNVIKALTARGYRVIVPDQIGFGKSS 99

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG-G 130
           K +I   Y     A +   LL+ LGI KV V+G+SMG  +A    L YP  V  ++L   
Sbjct: 100 KPFIH--YSFHQFARNNHQLLDSLGIKKVTVLGHSMGGMLATRFTLMYPEMVEKLLLEDP 157

Query: 131 VGS------VLYDSDVVDWQSLIDSFLL---------------PSIDEVQNPLGKKFRKF 169
           +G       V Y S   D+Q+ + +                  P  DE+   +G      
Sbjct: 158 IGLEDYRTFVPYTSAEQDYQTELKTTYQSVKKYYQTSYFTQWKPQYDELVR-IGAGVTGS 216

Query: 170 ADLDPGNDLKALASCLSMI-RKPFCQDDLYRIDVPVLIAVGSQD 212
           AD      + AL     MI  +P C  +   I VP ++ +G QD
Sbjct: 217 ADFPRYAKVAAL--TFEMIYEQPVCY-EFGLIKVPTVLFIGKQD 257


>gi|301054679|ref|YP_003792890.1| putative hydrolase, alpha/beta fold family [Bacillus anthracis CI]
 gi|300376848|gb|ADK05752.1| putative hydrolase, alpha/beta fold family [Bacillus cereus biovar
           anthracis str. CI]
          Length = 294

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +Y+ +  + GDK  P I+  HGL S   T   F    + L D+ + +++FD  G
Sbjct: 4   FFVEFGEYKASVCEWGDKSNPQIICFHGLGS---TKLSFIEIAEFLKDK-YHIVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY  V +    V+LLE +G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFEKDEDYGAVHLTNWVVALLEQIGKETFHIVAHSWGASVALHYAAKRPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|240139880|ref|YP_002964357.1| putative alpha/beta hydrolase precursor [Methylobacterium
           extorquens AM1]
 gi|240009854|gb|ACS41080.1| putative alpha/beta hydrolase precursor [Methylobacterium
           extorquens AM1]
          Length = 343

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 14/126 (11%)

Query: 9   RSWRKYQFAFYDVGDKD---APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAF 62
           R     + A+ DV   D     T+LL+HG       N+  S W   I+ L + G+RV+  
Sbjct: 57  RDGEAQRLAYMDVPAADNANGRTVLLLHG------RNFPSSYWEPVIRTLSNAGYRVVVP 110

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D LG GKS K      Y    MAAD ++L + L I +  ++ +SMG  +A  M   YP  
Sbjct: 111 DQLGFGKSSKPI--GSYTFDRMAADTLALADSLKIQRFDIVAHSMGGMLAVRMARNYPQR 168

Query: 123 VRSVIL 128
           V S++L
Sbjct: 169 VNSLVL 174


>gi|111019762|ref|YP_702734.1| hydrolase [Rhodococcus jostii RHA1]
 gi|110819292|gb|ABG94576.1| probable hydrolase [Rhodococcus jostii RHA1]
          Length = 288

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 62/118 (52%), Gaps = 11/118 (9%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F DVG+   P ++L+HGL  S   +W  +  I  L  +  RV+A D  GHG+SDK     
Sbjct: 18  FVDVGE--GPPVVLVHGLLGS-HESW--APQISRLAKK-HRVVAPDLFGHGQSDKP--SG 69

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GGVG 132
           DY L   AA    L++HLGIS    +G+S+G  I   +   +P  V  + L   GG+G
Sbjct: 70  DYSLSAHAATLRDLMDHLGISSAAFVGHSLGGGIVMQLSYLFPERVDRLCLVSSGGLG 127


>gi|48675951|ref|NP_001001641.1| epoxide hydrolase 2 [Sus scrofa]
 gi|67460595|sp|Q6Q2C2|HYES_PIG RecName: Full=Epoxide hydrolase 2; AltName: Full=Cytosolic epoxide
           hydrolase; Short=CEH; AltName: Full=Epoxide hydratase;
           AltName: Full=Soluble epoxide hydrolase; Short=SEH
 gi|45551399|gb|AAS68016.1| soluble epoxide hydrolase [Sus scrofa]
          Length = 555

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           +  F ++G    P + L HG   S   +W +   I  L   GFRV+A D  G+G+S    
Sbjct: 249 RLHFVEMGS--GPAVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLAVDMKGYGESSAPP 303

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
              +Y L  +  D V+ L  LG+S+   +G+  G  +  +M LFYP  VR+V
Sbjct: 304 EIEEYSLEVLCKDMVTFLNKLGLSQAVFIGHDWGGVLVWNMALFYPERVRAV 355


>gi|332186520|ref|ZP_08388264.1| alpha/beta hydrolase fold family protein [Sphingomonas sp. S17]
 gi|332013503|gb|EGI55564.1| alpha/beta hydrolase fold family protein [Sphingomonas sp. S17]
          Length = 335

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 68/138 (49%), Gaps = 12/138 (8%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD--K 72
           + A+ D G ++ P +LL+HG      T   +   + +L   G RVI     G G+S   +
Sbjct: 7   EIAYTDTGPRNGPAVLLLHGWPDDAST---WEAIVPVLTGAGLRVIVPTLRGFGESRFRR 63

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI----- 127
           + I        +A DA++L++ LGI++  V G+  G+ IA ++ + +P+ V+ +      
Sbjct: 64  ADIPRTGDSAILALDAIALMDGLGITRFQVAGHDWGSNIAEALAVGWPTRVKRMAMLSTP 123

Query: 128 --LGGVGSVLYDSDVVDW 143
             LGG+ +  +D     W
Sbjct: 124 PRLGGMPTPPFDQAQRQW 141


>gi|324113192|gb|EGC07167.1| 3-oxoadipate enol-lactonase [Escherichia fergusonii B253]
          Length = 271

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 90/217 (41%), Gaps = 30/217 (13%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           K +  +   G ++AP I+L + L +++    ++   I  L    FRV+ +D  GHGK++K
Sbjct: 17  KMKINYQIEGPENAPVIVLSNSLGTTLS---MWQPQISALTSH-FRVLRYDTHGHGKTEK 72

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
           +       L  +  D V+LL+HL I K H  G SMG      +  + P    SV +  + 
Sbjct: 73  N---ETVTLAQLGEDVVALLDHLAIEKAHFCGISMGGLTGLWLARYKPQRFHSVTV--LN 127

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF-----------------RKFADLDPG 175
           S     +   W S   +     +  +     +++                 ++ A+  P 
Sbjct: 128 SAAKIGEATGWLSRAQAVREKGMQAIAATAPERWFSESYRLTAATHVAFLCQQLAESSP- 186

Query: 176 NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD 212
              +  ASC   +     + +L  ID+PVL+  G  D
Sbjct: 187 ---EGYASCCEALANADLRAELSAIDLPVLLIAGELD 220


>gi|325002980|ref|ZP_08124092.1| alpha/beta hydrolase fold protein [Pseudonocardia sp. P1]
          Length = 276

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFRVIAFDNLGHGKSDK 72
           + ++ + G +    +LL+HGLA S  T      W  +L    Q   VIA D LGHG S+ 
Sbjct: 17  RVSYRETGAEHRRAVLLVHGLAGSSST------WAPVLAPLGQHLHVIAPDLLGHGSSEA 70

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                DY L   A     LL  LGI +V ++G+S G  +A      +P YV  V+L   G
Sbjct: 71  PR-SGDYSLGGFATGLRDLLVALGIERVTIVGHSFGGGVAMQFAHQFPEYVERVVLVSSG 129

Query: 133 SVLYD 137
            + +D
Sbjct: 130 GLGHD 134


>gi|300790628|ref|YP_003770919.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
 gi|299800142|gb|ADJ50517.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
          Length = 308

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 5/111 (4%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           D P ++L+HG A   +  W +   ++ L D GFR +A D  G+G SDK      Y    +
Sbjct: 35  DGPVVVLLHGFA---EFWWTWHHQLRALADAGFRAVAVDLRGYGDSDKP--PRGYDAWTL 89

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
           A D   L++ LG  + H++G++ G  +A ++   +P  V SV   G    L
Sbjct: 90  AGDVGGLIKSLGARRAHLVGHAWGGMLAWTVAALHPRLVSSVTAIGAAHPL 140


>gi|218548984|ref|YP_002382775.1| 3-oxoadipate enol-lactonase I [Escherichia fergusonii ATCC 35469]
 gi|218356525|emb|CAQ89148.1| 3-oxoadipate enol-lactonase I [Escherichia fergusonii ATCC 35469]
          Length = 271

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 90/217 (41%), Gaps = 30/217 (13%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           K +  +   G ++AP I+L + L +++    ++   I  L    FRV+ +D  GHGK++K
Sbjct: 17  KMKINYQIEGPENAPVIVLSNSLGTTLS---MWQPQISALTSH-FRVLRYDTHGHGKTEK 72

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
           +       L  +  D V+LL+HL I K H  G SMG      +  + P    SV +  + 
Sbjct: 73  N---ETVTLAQLGEDVVALLDHLAIEKAHFCGISMGGLTGLWLARYKPQRFHSVTV--LN 127

Query: 133 SVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF-----------------RKFADLDPG 175
           S     +   W S   +     +  +     +++                 ++ A+  P 
Sbjct: 128 SAAKIGEATGWLSRAQAVREKGMQAIAATAPERWFSESYRLTAATHVAFLCQQLAESSP- 186

Query: 176 NDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD 212
              +  ASC   +     + +L  ID+PVL+  G  D
Sbjct: 187 ---EGYASCCEALANADLRAELSAIDLPVLLIAGELD 220


>gi|146307727|ref|YP_001188192.1| alpha/beta hydrolase fold [Pseudomonas mendocina ymp]
 gi|145575928|gb|ABP85460.1| alpha/beta hydrolase fold protein [Pseudomonas mendocina ymp]
          Length = 309

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 61/118 (51%), Gaps = 8/118 (6%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           R     +Y  G  D  T++LIHG A+  + NWL FS   + L D+ ++VIA D  G G S
Sbjct: 48  RDLNIHYYRGGPADGETLVLIHGFAAD-KDNWLRFS---RHLTDR-YQVIALDLPGFGDS 102

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D+      Y +   A    S+LE LGI + H++G SMG  IA      YP   +S+ L
Sbjct: 103 DRP--AGSYDVGTQAERLASILEALGIERAHLLGNSMGGHIAALYAARYPQRTQSLAL 158


>gi|294501626|ref|YP_003565326.1| alpha/beta fold family hydrolase [Bacillus megaterium QM B1551]
 gi|294351563|gb|ADE71892.1| hydrolase, alpha/beta fold family [Bacillus megaterium QM B1551]
          Length = 269

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 108/272 (39%), Gaps = 43/272 (15%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSY 74
           ++Y   +     +LL+HG   S QT      W   +    + ++VIA D +GHG+S    
Sbjct: 9   SYYVHTEGKGEPLLLLHGFTGSSQT------WRTFMKKFVKDYQVIAVDIIGHGQSAAPK 62

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
               Y +  +      LL+ L +S+V+V+GYSMG R+A S    YP  V+ ++L      
Sbjct: 63  EIKPYSMEAVVEALHELLQQLSLSQVNVIGYSMGGRLALSFAQRYPHLVKKLVLESASPG 122

Query: 135 LYDSDVVDWQSLIDSFL---------------------------LPSIDEVQNPLGKKFR 167
           L   +    +   D  L                           LPS   VQ  + K+  
Sbjct: 123 LKTREEQKLRKEKDEQLASRIMKNGIEEFVNFWEKIPLFSSQKQLPS--HVQEAVRKERL 180

Query: 168 KFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIP 226
              +    N LK + + +    +P   + L  + +PVL+  G  D       +E+ + IP
Sbjct: 181 SHTETGLSNSLKGMGTGV----QPSLWEKLDNLLMPVLLITGEVDQKFCLISKEMQTLIP 236

Query: 227 SSQYLNICRRDHLLAVGDKQ-FKQGVVNFYAN 257
           ++    I    H + V   + F + V  F A 
Sbjct: 237 NATSRIILGTGHAIHVEQPEIFGRIVSEFLAT 268


>gi|284043468|ref|YP_003393808.1| alpha/beta hydrolase fold protein [Conexibacter woesei DSM 14684]
 gi|283947689|gb|ADB50433.1| alpha/beta hydrolase fold protein [Conexibacter woesei DSM 14684]
          Length = 314

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 95/231 (41%), Gaps = 43/231 (18%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD---------- 71
           GD   P +LL+ GL   +Q     + +++ L D+G  VI FDN   G+S           
Sbjct: 20  GDPADPPLLLVMGLG--MQMIRWHASFVRELTDRGLYVIRFDNRDSGRSTFMKDVPLPTL 77

Query: 72  -----KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
                + +    Y L  MA D V+LL+ L + +VH+ G SMG  IA ++    P  VRS+
Sbjct: 78  RQLATRRFDPRQYLLADMARDTVALLDALNLDRVHIAGASMGGMIAQTIAAEQPRRVRSL 137

Query: 127 --ILGGVGSVLYDSDVVDWQSLIDSFLLPSID-------EVQNPLGKK--------FRKF 169
             I+   GS       +    L+     P  D        + + +G          FR+ 
Sbjct: 138 TSIMSNTGSRFSGQPALKTYPLLLRRAAPGRDGYIAHQVALHDAIGSPGSPADDPLFREI 197

Query: 170 ADL------DPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL 214
           A+       DP    + LA+ L+   +      L+R+  P L+  G  D +
Sbjct: 198 AECSYDRNPDPTGTPRQLAAVLASGDRTRA---LHRVSAPTLVIHGDADRM 245


>gi|262202490|ref|YP_003273698.1| alpha/beta hydrolase [Gordonia bronchialis DSM 43247]
 gi|262085837|gb|ACY21805.1| alpha/beta hydrolase fold protein [Gordonia bronchialis DSM 43247]
          Length = 287

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 65/131 (49%), Gaps = 15/131 (11%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQG--FRVIAFDNLGHGKSDK 72
           + A+ DVG  D  TILLIHG+A S  T      W  +L       RVIA D  GHG+SDK
Sbjct: 14  KVAYRDVGRGD--TILLIHGMAGSSAT------WDAVLPKLAAHHRVIAPDLPGHGESDK 65

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                DY L   AA    LL+ L + +V V+G S+G  +A      +P Y   ++L G G
Sbjct: 66  P--RGDYSLGAFAAFLRDLLDELRVEQVTVVGQSLGGGVAMQFTYQHPDYCSRLVLIGSG 123

Query: 133 SVLYDSDVVDW 143
            +  D   V W
Sbjct: 124 GLGPD---VSW 131


>gi|70728921|ref|YP_258670.1| alpha/beta fold family hydrolase [Pseudomonas fluorescens Pf-5]
 gi|68343220|gb|AAY90826.1| hydrolase, alpha/beta fold family [Pseudomonas fluorescens Pf-5]
          Length = 267

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 105/241 (43%), Gaps = 21/241 (8%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           +LL+HGL SS   +W     I  L  + +R+I  D  GHG+SDK      Y +    AD 
Sbjct: 22  LLLVHGLGSSA-LDW--EKQIPALSAR-YRLIVPDIRGHGRSDKP--RERYSIKGFTADI 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD-WQ--- 144
           V+L+EHL +   H +G SMG  I   + +  P  ++S+ +   G  +      D WQ   
Sbjct: 76  VALIEHLNLGPAHYVGLSMGGMIGFQLGVDQPQLLKSLCIVNSGPEVKLRSANDYWQWFK 135

Query: 145 --SLIDSFLLPSIDEVQNPL-------GKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
             SL       +I +   P        G+  +K A+    ND +A  +    I     Q+
Sbjct: 136 RWSLARVLSPSAIGKALGPRLFPKPEQGELRQKMAERWAKNDKRAYLASFDAIVGWGVQE 195

Query: 196 DLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLLAVGDKQ-FKQGVVN 253
            L RI  P L+    +D    + +E  +  +P ++ + I    H   +   Q F Q +++
Sbjct: 196 RLSRITCPTLVVSADRDYTPVALKEAYVKLLPDARLVVIEDSRHATPLDQPQRFNQTLLD 255

Query: 254 F 254
           F
Sbjct: 256 F 256


>gi|146283257|ref|YP_001173410.1| alpha/beta fold family hydrolase [Pseudomonas stutzeri A1501]
 gi|145571462|gb|ABP80568.1| hydrolase, alpha/beta fold family [Pseudomonas stutzeri A1501]
          Length = 351

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (49%), Gaps = 17/135 (12%)

Query: 2   MNEVKFFRSWRKYQFAFYDV---GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQ 55
           +   +F    +  Q A+ DV   G  +  T LL+HG       N+  + W   I++L + 
Sbjct: 57  LKHYRFESQGKPMQMAYMDVAPTGQANGRTALLLHG------KNFCGATWERTIEVLNEA 110

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVF--MAADAVSLLEHLGISKVHVMGYSMGARIAC 113
           G+RVIA D +G   S K      Y+  F  +A +  +LL+  GI +V V+G+SMG  +A 
Sbjct: 111 GYRVIAPDQVGFCSSSKP---EGYQFSFAQLAHNTQALLQQEGIDQVSVIGHSMGGMLAA 167

Query: 114 SMVLFYPSYVRSVIL 128
            + L YP     ++L
Sbjct: 168 RLALSYPQLAEQLVL 182


>gi|52081567|ref|YP_080358.1| o-succinylbenzoate synthase [Bacillus licheniformis ATCC 14580]
 gi|52004778|gb|AAU24720.1| o-succinylbenzoate synthase [Bacillus licheniformis ATCC 14580]
          Length = 270

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 5/113 (4%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +   D G     T + +HG   S  T     G+ Q     G R+I  + LGHG +D    
Sbjct: 11  YKIEDNGLSAEKTAVFLHGFTGSAATWDGIDGYFQ-----GMRLIKLNLLGHGGTDSPSD 65

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
              Y     AAD + + + L + + +++GYSMG R+A S+ + +P  V  ++L
Sbjct: 66  SRRYTTEKQAADLIEIFDRLNVKQAYLIGYSMGGRLALSLAMIHPERVSGLVL 118


>gi|21222785|ref|NP_628564.1| hydrolase [Streptomyces coelicolor A3(2)]
 gi|8894745|emb|CAB95906.1| putative hydrolase [Streptomyces coelicolor A3(2)]
          Length = 352

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 103/259 (39%), Gaps = 30/259 (11%)

Query: 25  DAPTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           D P +LL+HGL     ++W  +  W+        R +A D  GHG+SDK       R  +
Sbjct: 97  DLPGVLLLHGLMGRA-SHWAPTARWLSAR----HRAVALDQRGHGRSDKPPRAAYTREAY 151

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVD 142
           +  D  + LE LG+    ++G++MGA  A  +    P  VR +I+  +  S L  +    
Sbjct: 152 VE-DVEAALEQLGLGPAVLIGHAMGALTAWQLAAKRPDLVRGLIICDMRASALGAASQHT 210

Query: 143 WQSLIDSFLLPSID---------------EVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
           W     ++ +P                  E  NP   +F      +  +  + +     M
Sbjct: 211 WTEWFRAWPVPFATLADVRKWFGEDDPWVERPNPARGEFYAEVMAESPDGWRPVFEPEQM 270

Query: 188 IRKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLL 240
           +R           ++L ++  P L+  G   +L     QE++  +PS QY  +    HL+
Sbjct: 271 LRSRETWVYDAHWEELAQVRCPTLVVRGLDGELGRAEAQEMVRVLPSGQYAEVADAGHLV 330

Query: 241 AVGDKQFKQGVVNFYANEL 259
                +  +  +  + N L
Sbjct: 331 HYDQPEAWRTAIEPFLNAL 349


>gi|256376620|ref|YP_003100280.1| alpha/beta hydrolase fold protein [Actinosynnema mirum DSM 43827]
 gi|255920923|gb|ACU36434.1| alpha/beta hydrolase fold protein [Actinosynnema mirum DSM 43827]
          Length = 277

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 9/141 (6%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           GD  AP ++ +HGL +    ++ F+         G  V+ +D  GHG+SD+      YRL
Sbjct: 21  GDPGAPVVVFVHGLLTDSLASYYFT-LGPAFAAAGVDVVMYDLRGHGRSDRPA--TGYRL 77

Query: 82  VFMAADAVSLLEHLGISK-VHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV 140
                D V LL+ LG  + VHV+G S G  IAC++  ++P  V  + +     +  +   
Sbjct: 78  EDFTDDFVGLLDALGERRPVHVVGNSFGGTIACALAAWHPELVAGITM-----LESEPPT 132

Query: 141 VDWQSLIDSFLLPSIDEVQNP 161
             W   I   L  + D++++P
Sbjct: 133 RAWTGHIAEGLADAHDKLRHP 153


>gi|197123425|ref|YP_002135376.1| alpha/beta hydrolase fold [Anaeromyxobacter sp. K]
 gi|196173274|gb|ACG74247.1| alpha/beta hydrolase fold [Anaeromyxobacter sp. K]
          Length = 344

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 54/104 (51%), Gaps = 10/104 (9%)

Query: 28  TILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           T+LL+HG       N+    W   I  L   GFRVIA D LG GKS K      +  V +
Sbjct: 81  TVLLLHG------KNFHAGTWADTIAALNRAGFRVIAPDQLGFGKSSKPE-RYQFSFVQL 133

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           AA+  +LL  LG+++  V+G+SMG  +A    L YP     ++L
Sbjct: 134 AANTRALLASLGVARTAVVGHSMGGMLAVRYALEYPEATERLLL 177


>gi|145238718|ref|XP_001392006.1| alpha/beta hydrolase [Aspergillus niger CBS 513.88]
 gi|134076501|emb|CAK39697.1| unnamed protein product [Aspergillus niger]
          Length = 408

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (51%), Gaps = 9/128 (7%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD-KSYIEN 77
           Y+ G +D P +LL+HG+ +         G    L D+G RV+ FD  G G SD  S I  
Sbjct: 93  YEWGPEDGPKVLLVHGITTPCIA---LGGLAHALVDRGCRVMLFDLFGRGYSDCPSDIPQ 149

Query: 78  DYRL----VFMAADAVSL-LEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
           D RL    + +A ++ +L     G  +  ++GYS+G  IA S   ++P ++ S++L    
Sbjct: 150 DNRLFATQILLALNSSALSWTGAGSGRFCLVGYSLGGGIAASFASYFPQFLSSLVLLAPA 209

Query: 133 SVLYDSDV 140
            ++ DS +
Sbjct: 210 GLIRDSQI 217


>gi|331696006|ref|YP_004332245.1| alpha/beta hydrolase fold protein [Pseudonocardia dioxanivorans
           CB1190]
 gi|326950695|gb|AEA24392.1| alpha/beta hydrolase fold protein [Pseudonocardia dioxanivorans
           CB1190]
          Length = 274

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 65/112 (58%), Gaps = 9/112 (8%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           A +  GD+   TI+LIHG  S   T+W+        CD   RV+  D  GHG S+++   
Sbjct: 14  AEFGSGDR---TIVLIHGWCSD-STDWV-DQISAFACDA--RVVTLDLRGHGHSERT--A 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           + Y  V +A D +++L+HLG+S  H++G+S+G  IA  + +  P  VRSV+L
Sbjct: 65  SGYGSVDLAEDVIAVLDHLGLSDSHLVGHSLGGIIADLVAVRRPDLVRSVLL 116


>gi|193215690|ref|YP_001996889.1| alpha/beta hydrolase fold protein [Chloroherpeton thalassium ATCC
           35110]
 gi|193089167|gb|ACF14442.1| alpha/beta hydrolase fold [Chloroherpeton thalassium ATCC 35110]
          Length = 269

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 73/147 (49%), Gaps = 6/147 (4%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Y+F +  +G    P IL +HG   S + +WL    ++ +C Q F  +A D  GHGK+  S
Sbjct: 8   YRFHYQSLGTVGQPAILFLHGFLGSSE-DWL--EVMENIC-QDFHCLAIDLPGHGKTQVS 63

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
             +  +++   A      L  LGI+K +++GYSMG R+   + L YP+  +  ++     
Sbjct: 64  GDDEFFQMEKTAKGISDFLNQLGITKSNLVGYSMGGRLGLYLSLTYPNLFKKSLIESSSP 123

Query: 134 VLYDSDVVDWQSLIDSFLLPSIDEVQN 160
            L  ++    + L D  L  ++D VQ 
Sbjct: 124 GLKTAEERAARRLRDEKL--ALDMVQT 148


>gi|119387705|ref|YP_918739.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Paracoccus
           denitrificans PD1222]
 gi|119378280|gb|ABL73043.1| alpha/beta hydrolase fold protein [Paracoccus denitrificans PD1222]
          Length = 367

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 70/139 (50%), Gaps = 17/139 (12%)

Query: 14  YQFAFYDVG-------DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           YQFA    G         +   ++LIHG    +  NWLF+  I  L +    V A D  G
Sbjct: 111 YQFADLPAGRIRYAERPGEGMPLILIHGFGGDLD-NWLFN--IDALAENA-PVYALDLPG 166

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HG+S KS       L  M    ++ ++HLGI K H+ G+SMG  +A ++   +P+ V SV
Sbjct: 167 HGQSVKSA--RPAGLELMVQTVIAFMDHLGIDKAHLAGHSMGGLVAGTLAAQHPARVASV 224

Query: 127 IL---GGVGSVLYDSDVVD 142
            L    G+GS + +SD +D
Sbjct: 225 TLICSAGLGSEI-NSDYID 242


>gi|330808139|ref|YP_004352601.1| putative hydrolase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376247|gb|AEA67597.1| putative hydrolase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 267

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 106/245 (43%), Gaps = 29/245 (11%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL SS Q +W     I +L    + +I  D  GHG+SDK      Y +   +AD 
Sbjct: 22  LVLVHGLGSSTQ-DW--EKQIPVLSTH-YHLIVVDVRGHGRSDKP--RGRYSIEGFSADL 75

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG---SVLYDSDVVDWQS 145
            +L+EHLG+  VH++G+SMG  I   + +  P  ++S+ +        V    D   W  
Sbjct: 76  SALIEHLGLGPVHLVGWSMGGMICFQLAVDDPGRLKSLCIVNSAPEVKVRTPDDCWQWFK 135

Query: 146 LIDSFLLPSIDEVQNPLGKKF--------------RKFADLDPGNDLKALASCLSMIRKP 191
                 L S++ +   LG K               R++A     ND  A  +    I   
Sbjct: 136 RWSLMRLLSLETIGKALGAKLFPKPEQTELRLEMARRWAK----NDKHAYLASFDAIVGW 191

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLAGSPQEL-MSFIPSSQYLNICRRDHLLAVGD-KQFKQ 249
             Q+ L ++  P L+     D    + +E  +  +P ++ + I    H   +   ++F Q
Sbjct: 192 GVQERLSQVACPTLVICADHDYTPVALKEAYVKLLPDARLVVIADSRHATPLDQPERFNQ 251

Query: 250 GVVNF 254
            +++F
Sbjct: 252 TLLDF 256


>gi|222632416|gb|EEE64548.1| hypothetical protein OsJ_19400 [Oryza sativa Japonica Group]
          Length = 387

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V  FDN G G+S     ++ Y  V MA DA++L++HLG  K HV G+SMGA I+C +
Sbjct: 78  GIEVCCFDNRGVGRSSVLPHKSYYSTVIMARDALALMDHLGWKKAHVFGHSMGAMISCKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  + S+ L
Sbjct: 138 AAMAPHRICSLAL 150


>gi|118588540|ref|ZP_01545949.1| dihydrolipoamide S-acetyltransferase [Stappia aggregata IAM 12614]
 gi|118439246|gb|EAV45878.1| dihydrolipoamide S-acetyltransferase [Stappia aggregata IAM 12614]
          Length = 264

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 104/208 (50%), Gaps = 29/208 (13%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS-DKSYIENDYRL 81
           D+ AP +LL HG     QT WL    IQ       R IAFD  GHG++ D   + N    
Sbjct: 23  DEGAPVVLL-HGFGGDRQT-WLN---IQAALASRKRSIAFDLPGHGEALDWPRVGN---- 73

Query: 82  VFMAADAVSL-LEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GGVGSVLYD 137
             ++A AV   LE LG++KVH++G+SMG  +A  + L  P  V S+ L   GG GS +  
Sbjct: 74  AGVSAKAVGQSLEALGLTKVHLVGHSMGGAVAALIALRNPDLVASLTLLAPGGFGSEINH 133

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKFR--KF-------ADLDPG--NDLKALASCL- 185
             +  + +  D+  + ++  ++   G +F+  KF       +   PG    L+A+A  + 
Sbjct: 134 RLLRRYAAATDAETMETL--LEQFFGWEFKLPKFLARTAAESRARPGAAATLEAIADEII 191

Query: 186 -SMIRKPFCQDDLYRIDVPVLIAVGSQD 212
              ++K   +D+L  + +P+ +  G+QD
Sbjct: 192 DGSVQKTLPRDELAELPMPIKVLWGTQD 219


>gi|116695524|ref|YP_841100.1| 3-oxoadipate enol-lactone hydrolase [Ralstonia eutropha H16]
 gi|11967269|gb|AAG42026.1|AF042280_4 3-oxoadipate enol-lactone hydrolase [Cupriavidus necator]
 gi|113530023|emb|CAJ96370.1| 3-Oxoadipate enol-lactone hydrolase [Ralstonia eutropha H16]
          Length = 259

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 95/233 (40%), Gaps = 35/233 (15%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFRVIAFDNLGHGKSDKSYIENDY 79
           G +  P ++L + L +S      FS W   +    Q FRV+ +D  GHG+S  S     Y
Sbjct: 17  GAEHLPVLVLSNSLGTS------FSMWEPQVAAFSQHFRVLRYDTRGHGES--SVPAGPY 68

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +  +  D ++LL+HLGI +    G SMG      + L +   +R ++L    +  Y   
Sbjct: 69  SIAQLGGDVIALLDHLGIGEASFCGLSMGGITGMWLALNHGPRLRKLVL--CNTAAYIGP 126

Query: 140 VVDWQ----------------SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALAS 183
             +W                 +++D +L P        L    R      P       A+
Sbjct: 127 PENWTNRAAAVGRDGVASIAAAVVDKWLTPPYAAAHPGLVASLRAMLGATPAAGYA--AN 184

Query: 184 CLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNI 233
           CL+ +R    +  + +I  P L+  GS  DL   P++   L   IP + Y+ +
Sbjct: 185 CLA-VRDADLRAQIEKITTPTLVIAGS-GDLPTPPRDGVFLAQTIPGAHYVEL 235


>gi|262203535|ref|YP_003274743.1| alpha/beta hydrolase [Gordonia bronchialis DSM 43247]
 gi|262086882|gb|ACY22850.1| alpha/beta hydrolase fold protein [Gordonia bronchialis DSM 43247]
          Length = 350

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 66/130 (50%), Gaps = 8/130 (6%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           + +   Y+ A+   G    P +LLIHG+  +  T   ++  I +L  Q + VIA D LGH
Sbjct: 22  YHTIHGYRRAYRIAGS--GPALLLIHGIGDNSST---WNEVIPILA-QHYTVIAPDLLGH 75

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           GKSDK     DY +   A     LL  LG +KV V+G+S+G  +A      +P +V  ++
Sbjct: 76  GKSDKP--RADYSVPAFANGMRDLLVVLGHTKVTVVGHSLGGGVAMQFCYQFPRFVERLV 133

Query: 128 LGGVGSVLYD 137
           L   G V  D
Sbjct: 134 LVAAGGVTRD 143


>gi|169633611|ref|YP_001707347.1| 3-oxoadipate enol-lactonase [Acinetobacter baumannii SDF]
 gi|169152403|emb|CAP01352.1| 3-oxoadipate enol-lactonase I (Enol-lactone hydrolase I)
           (Beta-ketoadipate enol-lactone hydrolase I)
           [Acinetobacter baumannii]
          Length = 261

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 108/258 (41%), Gaps = 30/258 (11%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ---GFRVIAFDNLGHGKSD 71
           Q A Y  G KDAP ++  + L +         G  Q   D+    F VI +D  GHG+SD
Sbjct: 12  QLAVYTDGLKDAPVLVFSNSLGTD-------HGMWQPQVDELESHFNVITYDTRGHGESD 64

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
              + +D  L  +A D V +L+ L I K H  G SMG      + + +P+   S+ +   
Sbjct: 65  ---VISDTTLQNLAEDVVDILDALNIEKAHFCGISMGGITGLWLGIHHPNRFNSITVANS 121

Query: 132 GSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-----LGKKFRKFADLDPGNDLKALASCLS 186
            + +  ++   W S  +S     + E+          +KF    ++     +++LA+  +
Sbjct: 122 AAEIGQTEA--WLSRAESVEQNGLAELVKTTHTRWFSEKFDYQHNVVAQTTIQSLANTPA 179

Query: 187 MIRKPFC--------QDDLYRIDVPVLIAVGSQDDLAG-SPQELMSFIPSSQYLNICRRD 237
                 C        +D++ +I +P L+  G++D +   +  E M    ++  L      
Sbjct: 180 QGYANACRALAYADLRDEIAQIQIPTLLIAGTEDPVTTVADAEFMQKAINNSQLAKLEAS 239

Query: 238 HLLAVGDKQ-FKQGVVNF 254
           HL  +   Q F Q +  F
Sbjct: 240 HLSNIEQPQRFTQELTRF 257


>gi|52786945|ref|YP_092774.1| YtxM [Bacillus licheniformis ATCC 14580]
 gi|319647477|ref|ZP_08001698.1| YtxM protein [Bacillus sp. BT1B_CT2]
 gi|52349447|gb|AAU42081.1| YtxM [Bacillus licheniformis ATCC 14580]
 gi|317390523|gb|EFV71329.1| YtxM protein [Bacillus sp. BT1B_CT2]
          Length = 273

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 5/113 (4%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +   D G     T + +HG   S  T     G+ Q     G R+I  + LGHG +D    
Sbjct: 14  YKIEDNGLSAEKTAVFLHGFTGSAATWDGIDGYFQ-----GMRLIKLNLLGHGGTDSPSD 68

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
              Y     AAD + + + L + + +++GYSMG R+A S+ + +P  V  ++L
Sbjct: 69  SRRYTTEKQAADLIEIFDRLNVKQAYLIGYSMGGRLALSLAMIHPERVSGLVL 121


>gi|218780803|ref|YP_002432121.1| alpha/beta hydrolase fold protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762187|gb|ACL04653.1| alpha/beta hydrolase fold protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 297

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 64/129 (49%), Gaps = 22/129 (17%)

Query: 18  FYDV-GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD----- 71
           +Y+  GD   P ++LI GLAS +   W    + ++L  QG  VI FDN   G S      
Sbjct: 12  YYETHGDPKNPPLILIMGLASQL-VRWPLE-FCEMLTAQGLYVIRFDNRDIGLSTQCDET 69

Query: 72  ---------KSYIEND-----YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
                    K ++  +     Y L  MA DAV L++HLG++K H+ G SMG  IA +  +
Sbjct: 70  GAAEIAAITKKFLSGEPAKLPYSLSDMANDAVGLMDHLGLAKAHICGLSMGGMIAQATAI 129

Query: 118 FYPSYVRSV 126
            +P  + S+
Sbjct: 130 EHPDRILSL 138


>gi|302906991|ref|XP_003049548.1| hypothetical protein NECHADRAFT_30431 [Nectria haematococca mpVI
           77-13-4]
 gi|256730484|gb|EEU43835.1| hypothetical protein NECHADRAFT_30431 [Nectria haematococca mpVI
           77-13-4]
          Length = 307

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 9   RSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           RS   Y +       +D  T+LL+HG  S++ ++W+    I+    +G+ ++A D LG+G
Sbjct: 14  RSGNSYSYIHIQPTSRDT-TLLLLHGFPSTL-SDWIHQ--IRYFSSEGYGILAPDLLGYG 69

Query: 69  KSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            S K    + YRL  M  + + LL+HL + KV  +G+  GA +   + +++P     ++ 
Sbjct: 70  SSSKPSDVHQYRLKAMGDELIELLDHLNLQKVVGIGHDFGATLLSRLAVYHPDRWTCLVF 129

Query: 129 GGVG 132
             VG
Sbjct: 130 LAVG 133


>gi|298492201|ref|YP_003722378.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
           ['Nostoc azollae' 0708]
 gi|298234119|gb|ADI65255.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
           ['Nostoc azollae' 0708]
          Length = 274

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 105/249 (42%), Gaps = 31/249 (12%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           +  KY+F +   G+   P IL +HG   +++    F   I+LL  + F  +  D  GHGK
Sbjct: 2   NLEKYRFNYSLAGNLQKPLILFLHGFIGNIEE---FDEAIRLL-GEDFSYLILDLPGHGK 57

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           +     +  +++  +A   + LLE L I K  ++GYSMG R+A  + L  P     VIL 
Sbjct: 58  TQVLGNDKYHQIECIAKGIIHLLEELKIEKCFLVGYSMGGRLALYLTLHLPEKFIKVILE 117

Query: 130 G-----------VGSVLYDSDVVDWQSLIDS-----------FLLPSIDEVQNPLGKKFR 167
                       +  +  DS +    + I             +  P   +++N    K++
Sbjct: 118 SASPGLATNIERLARIKSDSQIARKLTTITEKSDFRIFLNNWYNQPIFSKIKN--HPKYQ 175

Query: 168 KFADLDPGNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSF 224
           K  +    N    LA  L  +    +P   +++    +P+L+ VG  D+   +   +MS+
Sbjct: 176 KMLESRLENKPLELAKSLQFMGTGYQPSLWENIKENKIPLLLLVGENDEKFININTVMSY 235

Query: 225 IPSSQYLNI 233
              +  L I
Sbjct: 236 RCKTAQLKI 244


>gi|188582568|ref|YP_001926013.1| alpha/beta hydrolase fold [Methylobacterium populi BJ001]
 gi|179346066|gb|ACB81478.1| alpha/beta hydrolase fold [Methylobacterium populi BJ001]
          Length = 340

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 62/126 (49%), Gaps = 14/126 (11%)

Query: 9   RSWRKYQFAFYDVGDKD---APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAF 62
           R     + A+ DV   D     T+LL+HG       N+  S W   I+ L + G+RV+  
Sbjct: 54  RDGEAQRLAYMDVPAADNANGRTVLLLHG------RNFPSSYWEPVIRALSNAGYRVVVP 107

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D LG GKS K      +    MAAD V+L + L I +  V+ +SMG  +A  M   YP  
Sbjct: 108 DQLGFGKSSKPV--GAFTFDRMAADTVALADSLKIQRFDVVAHSMGGMLAVRMARNYPQR 165

Query: 123 VRSVIL 128
           V S++L
Sbjct: 166 VNSLVL 171


>gi|147800083|emb|CAN77654.1| hypothetical protein VITISV_032325 [Vitis vinifera]
          Length = 317

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 26  APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
            P +LLIHG         L+S W   I  L   G+RV+A D  G+G SD       Y ++
Sbjct: 26  GPLVLLIHGFPE------LWSSWNYQITHLAKHGYRVVAPDMRGYGDSDSPPDPASYTIL 79

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            +  D + LL+ LG  K  V+G+  GA +   + L  P  V++++  GV
Sbjct: 80  HLVGDLIGLLDQLGEEKAFVVGHDWGAEVTWHLCLLRPDRVKALVNLGV 128


>gi|302806571|ref|XP_002985035.1| hypothetical protein SELMODRAFT_121498 [Selaginella moellendorffii]
 gi|300147245|gb|EFJ13910.1| hypothetical protein SELMODRAFT_121498 [Selaginella moellendorffii]
          Length = 1309

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 101/228 (44%), Gaps = 33/228 (14%)

Query: 14   YQFAFYDVGD--KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
            + F   +V    ++  T++ +HG   S + +WL    +       FR +A D  GHG++ 
Sbjct: 1031 FTFRVVEVASMRQEKQTVVFLHGFLGSAE-DWL---PVMHSLASSFRCLAVDLPGHGRAS 1086

Query: 72   --KSYIENDYRLVFMAADAVSLLEHLGI-SKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
                 +E ++ L  ++A    LLE L   S++ + GYSMGARIA  M L     +R+ ++
Sbjct: 1087 SVTGNLEAEWGLDVLSAALSELLEQLSEGSEIVLAGYSMGARIALYMALHKHQKIRAAVI 1146

Query: 129  GGVGSVLYDSD-----VVDWQSLIDSFLLPSIDEV-----QNPLGKKFRKFAD------- 171
                  L D            SL  S  L  +D       + PL K  R   D       
Sbjct: 1147 VSGSPGLRDKQARIIRATQDDSLALSLRLGGLDNFVVNWYKRPLWKSLRHHPDFKNLIAS 1206

Query: 172  ---LDPGNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQDD 213
               +  GN++ ALA  LS +   R+P   + L+  ++P+L+ VG  D+
Sbjct: 1207 RLEMHKGNEV-ALAGALSQLSVGRQPCLWEQLHTANIPLLVVVGKADE 1253


>gi|228934430|ref|ZP_04097265.1| hypothetical protein bthur0009_28860 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228825067|gb|EEM70864.1| hypothetical protein bthur0009_28860 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
          Length = 184

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +Y+ +  + GDK  P I+  HGL S   T        +LL D  + +++FD  G
Sbjct: 4   FFVEFGEYEASVCEWGDKSNPQIICFHGLGS---TKLSLIEIAELLKDN-YHIVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPSFGKDEDYGASHLTKWVVALLEHIGKETFHIVAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|169633598|ref|YP_001707334.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter baumannii SDF]
 gi|169152390|emb|CAP01332.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter baumannii]
          Length = 271

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 100/235 (42%), Gaps = 28/235 (11%)

Query: 1   MMNEVKFFRSWRKYQFAFYDV-------GDKDAPTILLIHGLASSVQTNW-LFSGWIQLL 52
           M+N +K F+  +   F   D        G+  +P ++     ++S+ TN+ ++      L
Sbjct: 1   MLNVLKHFKEKQMPSFQSADAQINYQTFGEPSSPALVF----SNSLGTNYGMWQKQFNEL 56

Query: 53  CDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
            DQ F VI +DN GHG S  S  +  Y +  +  D V LL+HL ISK    G SMG    
Sbjct: 57  KDQ-FFVICYDNRGHGSS--STPDGPYTVEQLGEDVVRLLDHLNISKAAFCGISMGGLTG 113

Query: 113 CSMVLFYPSYVRSVILGGVGSVLYDSDV-VDWQSLIDSFLLPSIDEV------QNPLGKK 165
             + + YP+    V++    + +      +D   L+    L  I          +P  + 
Sbjct: 114 QWLAIHYPNRFSHVVVANTAAKIGQEQAWLDRAKLVREQGLQPIATTAASRWFTDPFIQS 173

Query: 166 FRKFADLDPGNDLKA-----LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA 215
                + +  NDL A      A+C   + K   ++ L  I +PVL+  G QD + 
Sbjct: 174 HPSIVN-NLCNDLSAGSAMGYANCCEALAKADVREQLKDIKIPVLVIAGPQDPVT 227


>gi|260554839|ref|ZP_05827060.1| 3-oxoadipate enol-lactonase [Acinetobacter baumannii ATCC 19606]
 gi|260411381|gb|EEX04678.1| 3-oxoadipate enol-lactonase [Acinetobacter baumannii ATCC 19606]
          Length = 261

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 108/260 (41%), Gaps = 34/260 (13%)

Query: 15  QFAFYDVGDKDAPTILLIHGLAS-----SVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGK 69
           Q A Y  G KDAP ++  + L +       Q N L S          F VI +D  GHG+
Sbjct: 12  QLAVYTEGLKDAPVLMFSNSLGTDHGMWQPQLNELKSH---------FNVITYDTRGHGE 62

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           SD   + +D  L  +A D V +L+ L I K H  G SMG      + + +P+   S+ + 
Sbjct: 63  SD---VISDTTLQNLAEDVVDILDALNIEKAHFCGISMGGITGLWLGIHHPNRFNSITVA 119

Query: 130 GVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNP-----LGKKFRKFADLDPGNDLKALASC 184
              + +  ++   W S  +S     + E+          +KF    ++     +++LA+ 
Sbjct: 120 NSAAKIGQTEA--WLSRAESVEKNGLAELVKTTHTRWFSEKFDYQHNVVAQTTIQSLANT 177

Query: 185 LSMIRKPFC--------QDDLYRIDVPVLIAVGSQDDLAG-SPQELMSFIPSSQYLNICR 235
            +      C        +D++ +I +P L+  G++D +   +  E M    ++  L    
Sbjct: 178 PAQGYANACRALAYADLRDEIAQIQIPALLIAGTEDPVTTVADAEFMQKAINNSQLAKLE 237

Query: 236 RDHLLAVGDKQ-FKQGVVNF 254
             HL  +   Q F Q +  F
Sbjct: 238 ASHLSNIEQPQRFTQELTRF 257


>gi|108804415|ref|YP_644352.1| 3-oxoadipate enol-lactonase [Rubrobacter xylanophilus DSM 9941]
 gi|108765658|gb|ABG04540.1| 3-oxoadipate enol-lactonase [Rubrobacter xylanophilus DSM 9941]
          Length = 261

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 104/236 (44%), Gaps = 29/236 (12%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  DAP ++L   L +   T+ ++   +  L ++ FR++ +D+ GHG S        Y +
Sbjct: 11  GPADAPVLVLSSSLGT---THRMWDPQVPALRER-FRLVRYDHRGHGSS--PVPPGPYSI 64

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +  D +++L+ LG+ +    G S+G  +   +    P  V  ++L    ++L   ++ 
Sbjct: 65  AELGQDVLAMLDGLGVERFSFCGLSLGGMVGMWVASEVPERVERLVLCCTSALLGPRELW 124

Query: 142 DWQS--------------LIDSFLLPSI-DEVQNPLGKKFRKFADLDPGNDLKALASCLS 186
           D ++              +++ +  P++  E    + +  R  A   P    +  A C  
Sbjct: 125 DERARVARSEGMEALVEGVVERWFTPALHQERPEDVERAKRMLAATPP----EGYAGCCE 180

Query: 187 MIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNICRRDHL 239
            IR+   +D L RI  P L+  GS DD A  P   + L   IP ++ + I R  HL
Sbjct: 181 AIREMDLRDRLGRIQAPTLVISGS-DDPATPPEHGERLREAIPEARTVVIERAAHL 235


>gi|296447628|ref|ZP_06889547.1| alpha/beta hydrolase fold protein [Methylosinus trichosporium OB3b]
 gi|296254834|gb|EFH01942.1| alpha/beta hydrolase fold protein [Methylosinus trichosporium OB3b]
          Length = 269

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 89/192 (46%), Gaps = 22/192 (11%)

Query: 28  TILLIHG-LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           T++L+HG L +S   NW +   +  L   G+R +  D+ G G+S +   +  Y    MAA
Sbjct: 45  TVILLHGGLGNS--GNWSYQ--VPALLAAGYRTVVVDSRGQGRSGRD--DRPYSYYRMAA 98

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSL 146
           D  ++++ L I +   +G+S GA  A ++    P  V  ++          +   ++  +
Sbjct: 99  DVRAVMDRLEIDRAVFIGWSDGADTALALAEGTPDRVNGILFFACNVDSSGTKPFEFTPV 158

Query: 147 IDSFLLPSIDEVQNPLGKKFRKFADLDPGND-LKALASCLSMIRKP---FCQDDLYRIDV 202
           I       +D+           +  L P  D  KA++  L  +++    +  DDL RI+V
Sbjct: 159 IGRIFQRHVDD-----------YTALSPTPDGFKAMSEALEAMQRTQPEYTADDLGRINV 207

Query: 203 PVLIAVGSQDDL 214
           PVL+ +G +D+ 
Sbjct: 208 PVLVVIGERDEF 219


>gi|152988476|ref|YP_001350036.1| hydrolase [Pseudomonas aeruginosa PA7]
 gi|150963634|gb|ABR85659.1| probable hydrolase [Pseudomonas aeruginosa PA7]
          Length = 313

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 68/141 (48%), Gaps = 9/141 (6%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +   + D G +D P +++IHG+ +S+ T   +  W++ +    FR++ FD  G G +   
Sbjct: 48  FPLHYRDEGTRDKPVLVMIHGVVASLHT---WDDWVKAMSPY-FRIVRFDVPGFGLTGPG 103

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
             + DY    M A    LL+HLGI K  + G S+G  IA +  L  P  V  ++L  +  
Sbjct: 104 R-DTDYSGERMVAILGQLLDHLGIDKASIAGNSLGGYIAWNFALAQPQRVERLVL--IDP 160

Query: 134 VLYDSDVVDWQSLIDSFLLPS 154
             Y    V W  +I +  LP 
Sbjct: 161 AGYQMRKVPW--MIAAAALPG 179


>gi|218197195|gb|EEC79622.1| hypothetical protein OsI_20833 [Oryza sativa Indica Group]
          Length = 429

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V  FDN G G+S     ++ Y  V MA DA++L++HLG  K HV G+SMGA I+C +
Sbjct: 78  GIEVCCFDNRGVGRSSVLPHKSYYSTVIMARDALALMDHLGWKKAHVFGHSMGAMISCKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  + S+ L
Sbjct: 138 AAMAPHRICSLAL 150


>gi|169763034|ref|XP_001727417.1| epoxide hydrolase [Aspergillus oryzae RIB40]
 gi|83770445|dbj|BAE60578.1| unnamed protein product [Aspergillus oryzae]
          Length = 329

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 9   RSWRKYQFAFYDVGDKD-----APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD 63
           ++  KY +  Y    ++      PTILL+HG  S   T++ +   I  L   G+ VIA D
Sbjct: 10  KTQHKYTYTHYPPSPQENRNNPKPTILLLHGFPS---TSYDWRHQIPYLSSLGYGVIAPD 66

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
            LG+G + K      Y+   MAA+ +S+L+  GI KVH +G+  G  +   +  ++P  +
Sbjct: 67  LLGYGGTSKPTNLAAYKSKSMAAEIISILDAEGIDKVHAVGHDTGCTLLSRLADYFPERL 126

Query: 124 RSVIL 128
            S + 
Sbjct: 127 LSCVF 131


>gi|260550682|ref|ZP_05824890.1| alpha/beta hydrolase fold protein EstB [Acinetobacter sp. RUH2624]
 gi|260406188|gb|EEW99672.1| alpha/beta hydrolase fold protein EstB [Acinetobacter sp. RUH2624]
          Length = 314

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 58/132 (43%), Gaps = 31/132 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKSDKSYIEN 77
           G  + PTILLI GL + +    LF  W    C    DQGFRVI FDN   G S K   + 
Sbjct: 35  GKAEHPTILLIMGLGAQM----LF--WPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHQG 88

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MA D   LL+ LGISK HV+G SMG  IA  + 
Sbjct: 89  KRLNTMKLMGRFALGLSNQGAPYTLYDMADDVSMLLDRLGISKAHVIGASMGGMIAQILA 148

Query: 117 LFYPSYVRSVIL 128
             YP  V  + L
Sbjct: 149 AKYPEKVEKLGL 160


>gi|146339524|ref|YP_001204572.1| putative epoxide hydrolase [Bradyrhizobium sp. ORS278]
 gi|146192330|emb|CAL76335.1| putative epoxide hydrolase [Bradyrhizobium sp. ORS278]
          Length = 334

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 15  QFAFYDVGD-KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +  +Y+ G   D P ++L HG    +  +W     I+ L + G RVIA D  G+G +D+ 
Sbjct: 19  RMGYYEAGPATDHPPMILCHGW-PELAFSWRHQ--IKALAEAGIRVIAPDQRGYGATDRP 75

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
                Y L  + AD V LL+HL I K   +G+  G  +   M L +P  V  V+
Sbjct: 76  EPVESYDLEHLTADLVGLLDHLEIDKAIFVGHDWGGFVVWQMPLRHPDRVAGVV 129


>gi|156743086|ref|YP_001433215.1| alpha/beta hydrolase fold protein [Roseiflexus castenholzii DSM
           13941]
 gi|156234414|gb|ABU59197.1| alpha/beta hydrolase fold [Roseiflexus castenholzii DSM 13941]
          Length = 309

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 61/132 (46%), Gaps = 16/132 (12%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQ--LLCDQGFRV 59
           +  V+ F     Y   + D G +DAP +LLIHG A+     W F+   Q   L   G R 
Sbjct: 33  LPGVQHFVRVGGYDLHYTDEGPRDAPVVLLIHGFAA-----WAFAWRSQRAALVAAGRRA 87

Query: 60  IAFDNLGHGKSDKS----YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           +  D  G+G S +     Y  +D  L  + A     L+ LGI    V+G+S G R+A  +
Sbjct: 88  VTIDLPGYGASPRPVAPVYSTHDQALTLLQA-----LDALGIGTFDVVGHSFGGRVAFQI 142

Query: 116 VLFYPSYVRSVI 127
            L  P  VR ++
Sbjct: 143 ALLAPQRVRRIV 154


>gi|257094041|ref|YP_003167682.1| alpha/beta hydrolase fold protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046565|gb|ACV35753.1| alpha/beta hydrolase fold protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 295

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 63/134 (47%), Gaps = 19/134 (14%)

Query: 10  SWRKYQFAFYDVGD-KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG 68
           +  + Q  +   GD   AP ILLI GL + + + W      + L D+G+RVI FDN   G
Sbjct: 5   TANQLQIEYEIFGDGPSAPAILLIMGLGAQL-SRWNVE-LCEALVDRGYRVIRFDNRDCG 62

Query: 69  KSDK----------------SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
            S K                  +   Y L  MAAD+V LL+ L I + H++G SMG  IA
Sbjct: 63  LSSKLDEAGVPDVGKSLRTGQPLLAPYTLEDMAADSVGLLDALAIEQAHIVGASMGGAIA 122

Query: 113 CSMVLFYPSYVRSV 126
             +   YP  V S+
Sbjct: 123 QIVAALYPQRVLSL 136


>gi|311748460|ref|ZP_07722245.1| alpha/beta hydrolase [Algoriphagus sp. PR1]
 gi|126576975|gb|EAZ81223.1| alpha/beta hydrolase [Algoriphagus sp. PR1]
          Length = 267

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 109/236 (46%), Gaps = 35/236 (14%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIA 61
           +N+VK +       +    VG++   TI+  HGL   + ++ +F   I  L  + FRVIA
Sbjct: 6   INQVKIY-------YTEQGVGEE---TIIFSHGL---LWSHRMFQEQIDFLSPR-FRVIA 51

Query: 62  FDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS 121
           FD+ G GKS+   ++  + +  +  DA++L++ L    VH  G SMG  +   +   +P 
Sbjct: 52  FDHRGQGKSE---VKAPFDMDTLTEDALALIKELCPGPVHFAGLSMGGFVGIRLAARHPE 108

Query: 122 YVRSVIL----------GGVGSVLYDSDVVDW---QSLIDSFLLPSI---DEVQNPLGK- 164
            ++S+IL            +      +++V W     L+ + ++P +     + NPL K 
Sbjct: 109 ILKSLILLETSANSEPVENIPKYRTLNNIVKWFGVIGLVANKVMPIMFAESWLNNPLNKE 168

Query: 165 KFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQE 220
           K   +     GN          +I +   +D+L  I  P +I VG  +D+A  P++
Sbjct: 169 KVELWKKEMMGNKKSVTGPVNGVINRTGVEDELKFISCPTMIIVGD-EDVATKPEK 223


>gi|27377992|ref|NP_769521.1| epoxide hydrolase [Bradyrhizobium japonicum USDA 110]
 gi|27351138|dbj|BAC48146.1| epoxide hydrolase [Bradyrhizobium japonicum USDA 110]
          Length = 348

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGD-KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           M  +KF ++    +  +Y+ G   D P ++L HG    +  +W     I+ L + G RVI
Sbjct: 21  MPPLKFVQT-NGIRMGYYEAGPVSDTPPMVLCHGWPE-LAFSWRHQ--IKALSEAGIRVI 76

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           A D  G+G +D+     DY +  +  D V LL+HLGI K   +G+  G  I   M L + 
Sbjct: 77  APDQRGYGATDRPEPVEDYDIEHLTGDLVGLLDHLGIDKAIFVGHDWGGFIVWQMPLRHI 136

Query: 121 SYVRSVI 127
             V  V+
Sbjct: 137 GRVAGVV 143


>gi|332186586|ref|ZP_08388329.1| 3-oxoadipate enol-lactonase [Sphingomonas sp. S17]
 gi|332013238|gb|EGI55300.1| 3-oxoadipate enol-lactonase [Sphingomonas sp. S17]
          Length = 393

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 99/235 (42%), Gaps = 39/235 (16%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  D P ++L++ + + +    L+   + LL    FR++  D  GHG SD    + DY L
Sbjct: 17  GAADRPVLVLLNSIGTDMG---LWDRTVPLLL-PAFRLLRIDARGHGGSDAP--DGDYSL 70

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +AAD V++++  G+    V G S+G  +A  + L +P+ V ++ L    + +   D  
Sbjct: 71  AMLAADVVAIMDDAGLPHAAVAGVSLGGMVAMQIALNHPARVTALALICTSATM---DPA 127

Query: 142 DWQSLIDS----------------FLLPSIDEVQNPLGKKFR----KFADLDPGNDLKAL 181
            W + ID+                FL P   E    +    R    + AD          
Sbjct: 128 AWTARIDTVRQQGTAAIADMAVGRFLSPGFAEGHPEVADSLRDGIVRQAD-------TGY 180

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD---DLAGSPQELMSFIPSSQYLNI 233
           A   + IR     D +  I VP L+     D     AG  + L++ IP ++++ I
Sbjct: 181 AGAGAAIRDMGLVDRIVAIAVPTLVVTAMLDVSTPYAGHGEHLIAAIPGARHVGI 235


>gi|260550265|ref|ZP_05824477.1| 3-oxoadipate enol-lactonase II [Acinetobacter sp. RUH2624]
 gi|260406577|gb|EEX00058.1| 3-oxoadipate enol-lactonase II [Acinetobacter sp. RUH2624]
          Length = 270

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 106/254 (41%), Gaps = 30/254 (11%)

Query: 2   MNEVKFFRSWRKYQFAFYDV-------GDKDAPTILLIHGLASSVQTNW-LFSGWIQLLC 53
           MN +K F+  +   F   D        G+  +P ++     ++S+ TN+ ++      L 
Sbjct: 1   MNVLKHFKEKQMPSFQSADAQINYQTFGEPSSPALVF----SNSLGTNYGMWQKQFNELK 56

Query: 54  DQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIAC 113
           DQ F VI +D  GHG S  S  +  Y +  +  D V LL+HL ISK    G SMG     
Sbjct: 57  DQ-FFVICYDTRGHGSS--STPDGPYTVEQLGEDVVRLLDHLNISKAAFCGISMGGLTGQ 113

Query: 114 SMVLFYPSYVRSVILGGVGSVLYDSDV-VDWQSLIDSFLLPSIDEV------QNPLGKKF 166
            + + YP+    VI+    + +      +D   L+    L  I          +P  +  
Sbjct: 114 WLAIHYPNRFSHVIVANTAAKIGQEQAWLDRAKLVREQGLQPIAATAASRWFTDPFIQSH 173

Query: 167 RKFADLDPGNDLKA-----LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA--GSPQ 219
               + +  NDL A      A+C   + K   ++ L  I +PVL+  G+QD +      +
Sbjct: 174 ASIVN-NLCNDLSAGSAIGYANCCEALAKADVREQLNDIKIPVLVIAGTQDPVTTVADGE 232

Query: 220 ELMSFIPSSQYLNI 233
            +   IP SQ   I
Sbjct: 233 FMQQRIPQSQLAEI 246


>gi|302560071|ref|ZP_07312413.1| hydrolase [Streptomyces griseoflavus Tu4000]
 gi|302477689|gb|EFL40782.1| hydrolase [Streptomyces griseoflavus Tu4000]
          Length = 292

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 101/240 (42%), Gaps = 28/240 (11%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           + AP + L+HGL     ++W  +   + L  + +R +A D  GHG+SDK    +  R  +
Sbjct: 36  QHAPGVFLLHGLMGRA-SHWASTA--RRLSGR-YRAVALDQRGHGRSDKPPQASFTRGAY 91

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVD 142
           +  DA + LE LG+    ++G++MGA  A  +    P  VR +I+  +  S L  +   +
Sbjct: 92  VD-DAEAALEQLGLGPTVLIGHAMGALTAWQLAAKRPDLVRGLIVCDMRASALGAASQRE 150

Query: 143 WQSLIDSFLLPSID---------------EVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
           W     ++ +P                  E  NP   +F      +  +  + +     M
Sbjct: 151 WAEWFKAWPVPFATLADVRKWFGEDDPWVERPNPARGEFYAEVMAESPDGWRPVFDPEQM 210

Query: 188 IRKPFC------QDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDHLL 240
           +R           ++L ++  P L+  G   +L     QE++  +P  QY  +    HL+
Sbjct: 211 LRSRETWVFDAHWEELAQVRCPALVVRGLDGELGRAEAQEMVRVLPRGQYAEVADAGHLV 270


>gi|193077460|gb|ABO12277.2| esterase [Acinetobacter baumannii ATCC 17978]
          Length = 259

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 99/234 (42%), Gaps = 23/234 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNW-LFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Q  +   G+  +P ++     ++S+ TN+ ++      L DQ F VI +D LGHG S  S
Sbjct: 10  QINYQTFGEPSSPALVF----SNSLGTNYGMWQKQFNELKDQ-FFVICYDTLGHGSS--S 62

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
             +  Y +  +  D V LL+HL ISK    G SMG      + + YP+    VI+    +
Sbjct: 63  TPDGPYTVEQLGEDVVRLLDHLNISKAAFCGISMGGLTGQWLAIHYPNRFSHVIVANTAA 122

Query: 134 VLYDSDV-VDWQSLIDSFLLPSIDEV------QNPLGKKFRKFADLDPGNDLKA-----L 181
            +      +D   L+    L  I          +P  +      + +  NDL A      
Sbjct: 123 KIGQEQAWLDRAKLVREQGLQPIAATAASRWFTDPFIQSHPSIVN-NLCNDLSAGSAIGY 181

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA--GSPQELMSFIPSSQYLNI 233
           A+C   + K   ++ L  I +PVL+  G+QD +      Q +   IP S    I
Sbjct: 182 ANCCEALAKADVREQLKDIKIPVLVIAGTQDPVTTVADSQFMQQRIPQSHLEEI 235


>gi|215701213|dbj|BAG92637.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 358

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V  FDN G G+S     ++ Y  V MA DA++L++HLG  K HV G+SMGA I+C +
Sbjct: 78  GIEVCCFDNRGVGRSSVLPHKSYYSTVIMARDALALMDHLGWKKAHVFGHSMGAMISCKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  + S+ L
Sbjct: 138 AAMAPHRICSLAL 150


>gi|148547307|ref|YP_001267409.1| alpha/beta hydrolase fold family protein [Pseudomonas putida F1]
 gi|148511365|gb|ABQ78225.1| 3-oxoadipate enol-lactonase [Pseudomonas putida F1]
          Length = 277

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 115/249 (46%), Gaps = 37/249 (14%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           ++ DVG      ++LIHG+  + +   ++ G    L +  +RVIA+D LGHG+S      
Sbjct: 14  SYLDVGQGQ--PVVLIHGVGLNKE---MWGGQFVGLAND-YRVIAYDMLGHGQS--RVPA 65

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS-VILGGV-GSV 134
            D  L   A     LL+HL I++  V+G+SMG  +A +  L YP  + + V+L  V    
Sbjct: 66  ADTPLEGYADQLAELLDHLQIAQATVIGFSMGGLVARAFALNYPQRLAALVVLNSVFNRT 125

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF-RKFADLDPG-----------NDLKALA 182
              S  V  ++   + L P  + V   L + F R++   +P            ND +   
Sbjct: 126 PEQSAGVIARAAQAAELGPDAN-VDAALDRWFSREYKAANPAQVAAIRQVLASNDPQGYH 184

Query: 183 SCLSMIRKPFCQDDLYRID------VPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNI 233
           +  S+    F   D+YR D      VP LIA G  D    +P   ++L + IP ++ + +
Sbjct: 185 TTYSL----FATQDMYRADDLGSIQVPTLIATGELDS-GSTPAMTRQLAASIPGARSVVL 239

Query: 234 CRRDHLLAV 242
             + H++ V
Sbjct: 240 AEQRHMMPV 248


>gi|215404271|ref|ZP_03416452.1| epoxide hydrolase ephB [Mycobacterium tuberculosis 02_1987]
 gi|215446138|ref|ZP_03432890.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T85]
 gi|289746124|ref|ZP_06505502.1| epoxide hydrolase ephB [Mycobacterium tuberculosis 02_1987]
 gi|289758047|ref|ZP_06517425.1| epoxide hydrolase EphB [Mycobacterium tuberculosis T85]
 gi|294996857|ref|ZP_06802548.1| epoxide hydrolase ephB [Mycobacterium tuberculosis 210]
 gi|289686652|gb|EFD54140.1| epoxide hydrolase ephB [Mycobacterium tuberculosis 02_1987]
 gi|289713611|gb|EFD77623.1| epoxide hydrolase EphB [Mycobacterium tuberculosis T85]
 gi|326903544|gb|EGE50477.1| epoxide hydrolase ephB [Mycobacterium tuberculosis W-148]
          Length = 356

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D+  P ++L+HG   S   +W     I  L   G+RV+A D  G+G+S K  ++  YR+ 
Sbjct: 24  DQQGPLVVLLHGFPES-WYSWRHQ--IPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIK 80

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
            +  D V +L+  G  +  V+G+  GA +A +    +P     V+
Sbjct: 81  ELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVV 125


>gi|258593647|emb|CBE69988.1| putative esterase/lipase [NC10 bacterium 'Dutch sediment']
          Length = 270

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 95/218 (43%), Gaps = 31/218 (14%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           FY+      P ++ IHGL    +  W   G    L  + FR +AFDN   G+S++S   N
Sbjct: 12  FYEEDGCGEP-VVWIHGLGIDHRI-W---GLQMPLFTRHFRCLAFDNRDAGQSNRS--PN 64

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y +  MA DAV L++ L I K H++G SMG  +A  + + +P+ V+ ++L       Y 
Sbjct: 65  SYTIKTMADDAVRLMDALAIDKAHIVGLSMGGAVAQELAIAHPARVQRLVLVST----YT 120

Query: 138 SDVVDWQSLIDSFLLP----SIDEVQNPLGKKFRKFAD-LDPGNDLKALASCLS------ 186
           S       ++ SF L     S +E           + D L PG    A+A  L       
Sbjct: 121 SSDRRGADVLSSFALMRGRFSREEYARATSPWVFTYQDYLIPGFVDLAIARFLEDPYFVP 180

Query: 187 ---MIRK------PFCQDDLYRIDVPVLIAVGSQDDLA 215
               IR+       F +D L RI  P LI  G  D L 
Sbjct: 181 ADVYIRQVEAALSHFTEDRLSRITAPTLIVAGDDDLLT 218


>gi|171848969|pdb|2ZJF|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Epoxide
           Hydrolase B Complexed With An Inhibitor
          Length = 362

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D+  P ++L+HG   S   +W     I  L   G+RV+A D  G+G+S K  ++  YR+ 
Sbjct: 30  DQQGPLVVLLHGFPES-WYSWRHQ--IPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIK 86

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
            +  D V +L+  G  +  V+G+  GA +A +    +P     V+
Sbjct: 87  ELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVV 131


>gi|161760896|pdb|2E3J|A Chain A, The Crystal Structure Of Epoxide Hydrolase B (Rv1938) From
           Mycobacterium Tuberculosis At 2.1 Angstrom
          Length = 356

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D+  P ++L+HG   S   +W     I  L   G+RV+A D  G+G+S K  ++  YR+ 
Sbjct: 24  DQQGPLVVLLHGFPES-WYSWRHQ--IPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIK 80

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
            +  D V +L+  G  +  V+G+  GA +A +    +P     V+
Sbjct: 81  ELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVV 125


>gi|317404585|gb|EFV84990.1| beta-ketoadipate enol-lactone hydrolase [Achromobacter xylosoxidans
           C54]
          Length = 266

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 115/280 (41%), Gaps = 44/280 (15%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLL--CDQGFR 58
           M +++ F  +    + A+   GD   P + L + + +++        W  L     + FR
Sbjct: 1   MQDDIPFITTGDGARIAYRWDGDAGLPVLALSNSIGTTLHM------WDDLAPALARHFR 54

Query: 59  VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
           V+ FD  GHG S  S     Y L  +  D + L + LG+++ H +G S+G  +   + + 
Sbjct: 55  VLRFDTRGHGAS--SVPAGPYSLDRLGRDVLELFDALGVARAHFLGLSLGGIMGQWLGVH 112

Query: 119 YPSYVRSVILGGVGSVL-----YDSDVV------DWQSLIDSFL---LPSIDEVQNPLGK 164
            P  +  +IL      L     +D  +       D +   ++FL    P+  E+    G 
Sbjct: 113 APERIDRLILANTSPYLGPAPQWDERIATTLRAPDMKDTAETFLANWFPA--EMLRAGGP 170

Query: 165 KFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL--AGSPQELM 222
               F D+    D + LA   + +R    +  +  I  P L+  G  D +  A   +++ 
Sbjct: 171 VIDTFRDMLLNTDRQGLAGAFAAVRDTDLRRTIALIPRPTLVIAGRDDTVTAASHGEQIA 230

Query: 223 SFIPSSQYL--------NICRRDHLLAVGDKQFKQGVVNF 254
           + +P +Q+L        NI R D        +F++ V+ F
Sbjct: 231 ATVPGAQWLLLDAVHLSNIERPD--------EFREAVLGF 262


>gi|258404249|ref|YP_003196991.1| alpha/beta hydrolase fold protein [Desulfohalobium retbaense DSM
           5692]
 gi|257796476|gb|ACV67413.1| alpha/beta hydrolase fold protein [Desulfohalobium retbaense DSM
           5692]
          Length = 263

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 103/241 (42%), Gaps = 27/241 (11%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           A++  G   AP ++  H LA +     L++  +  L  + +RV+++D  GHG+S+   + 
Sbjct: 11  AYHLEGPATAPVVVFSHCLAGN---RTLWAPQMDAL-KKDYRVVSYDIRGHGESE--VVP 64

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
             Y +  +A D ++LL+ L + +VH +G S+G  I   +   YP    S+ L      + 
Sbjct: 65  GPYSMSELAQDTIALLDALDLDRVHFVGLSLGGMIGQVLGAMYPERFVSLALCDTTEAIP 124

Query: 137 DSDVVDW----------------QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180
            S   +W                ++ ++ +L P+    +    ++ R      P   ++ 
Sbjct: 125 ASGAQEWDKRAEIARRQGMAPLAEANLERWLSPAFRAERPEETQRIRDMVQTTP---VEG 181

Query: 181 LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAG--SPQELMSFIPSSQYLNICRRDH 238
            A C + I+     + L  + VP L+  G QD L      + +   +P ++   +    H
Sbjct: 182 FAGCCAAIKGFDFSERLSSVTVPSLLLHGEQDGLMPRDKAEAMARMMPRARVATLTEALH 241

Query: 239 L 239
           L
Sbjct: 242 L 242


>gi|218674986|ref|ZP_03524655.1| putative peroxidase protein [Rhizobium etli GR56]
          Length = 267

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 108/253 (42%), Gaps = 27/253 (10%)

Query: 9   RSWRKYQFAFYDVGDKDAPTILLIHG-LASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           R   +  +A Y  G    P ++L+HG L  S   NW +   +  L   G RV+  D+ GH
Sbjct: 30  REGARIWYASYGAG----PAVILLHGGLGHS--GNWGYQ--VPALLQSGRRVVLIDSRGH 81

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           G+S +      Y L  MAAD +++++ L + +   +G+S GA IA  +    PS V  V 
Sbjct: 82  GRSTRDARPYTYEL--MAADVLAVMDELSLEQAAFVGWSDGACIALILAAAAPSRVEGVF 139

Query: 128 LGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
                        +D     +    P ID       K +   +     +D  A    +S+
Sbjct: 140 FFACN--------MDPSGTREFVPTPVIDRCFRRHAKDYAALSATP--DDFNAFVEAVSL 189

Query: 188 IRKP---FCQDDLYRIDVPVLIAVGSQDDL--AGSPQELMSFIPSSQYLNICRRDHLLAV 242
           + +    +   DL RI VPV I +G  D+   A   + L S IP++Q + +    H   +
Sbjct: 190 MMRTEPNYQAADLGRIGVPVAIVLGEHDEFIKAEHAEYLASSIPNAQMIYLPGVSHFAPL 249

Query: 243 G-DKQFKQGVVNF 254
               QF   +++F
Sbjct: 250 QRPAQFNAAILSF 262


>gi|119470337|ref|ZP_01613096.1| putative hydrolase [Alteromonadales bacterium TW-7]
 gi|119446509|gb|EAW27784.1| putative hydrolase [Alteromonadales bacterium TW-7]
          Length = 255

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 23/158 (14%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  +  +G    P ++LIHGL  S++   + +  +     + F V   D   HG S  S 
Sbjct: 2   QLNYKQLGQ--GPDVILIHGLFGSLENLNVIAKPLS----EHFTVTNVDLRNHGLSPHS- 54

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSV 134
             ++     MA D V LL HL I K H++G+SMG ++A  + L  P  +  +I+  +  V
Sbjct: 55  --DEMSYPAMAKDIVELLRHLNIKKAHIIGHSMGGKVAMELALTQPELIEKLIVLDIAPV 112

Query: 135 LYD--------------SDVVDWQSLIDSFLLPSIDEV 158
            Y               S+ ++ +   D  + P IDE+
Sbjct: 113 TYPPRHTKILQALNAVASEHIEDRKHADDLMQPYIDEL 150


>gi|77360577|ref|YP_340152.1| hydrolase [Pseudoalteromonas haloplanktis TAC125]
 gi|76875488|emb|CAI86709.1| putative hydrolase [Pseudoalteromonas haloplanktis TAC125]
          Length = 255

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           P ++LIHGL  S++   + +  +     + + V   D   HGKS  S   +      MA 
Sbjct: 12  PHVILIHGLFGSLENLNVIAKPLS----EFYTVTNVDLRNHGKSPHS---DTMTYAAMAQ 64

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY 136
           D + LL HL I K H++G+SMG ++A  + L +P +V  +I+  +  V Y
Sbjct: 65  DIIELLTHLNIDKAHIIGHSMGGKVAMELALTHPEHVNKLIVLDIAPVSY 114


>gi|15609075|ref|NP_216454.1| epoxide hydrolase EphB [Mycobacterium tuberculosis H37Rv]
 gi|15841409|ref|NP_336446.1| epoxide hydrolase [Mycobacterium tuberculosis CDC1551]
 gi|31793130|ref|NP_855623.1| epoxide hydrolase EphB [Mycobacterium bovis AF2122/97]
 gi|121637843|ref|YP_978066.1| putative epoxide hydrolase ephB [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148661746|ref|YP_001283269.1| epoxide hydrolase EphB [Mycobacterium tuberculosis H37Ra]
 gi|148823150|ref|YP_001287904.1| epoxide hydrolase ephB [Mycobacterium tuberculosis F11]
 gi|167970547|ref|ZP_02552824.1| epoxide hydrolase ephB [Mycobacterium tuberculosis H37Ra]
 gi|215411617|ref|ZP_03420413.1| epoxide hydrolase ephB [Mycobacterium tuberculosis 94_M4241A]
 gi|215427294|ref|ZP_03425213.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T92]
 gi|215430845|ref|ZP_03428764.1| epoxide hydrolase ephB [Mycobacterium tuberculosis EAS054]
 gi|218753649|ref|ZP_03532445.1| epoxide hydrolase ephB [Mycobacterium tuberculosis GM 1503]
 gi|224990327|ref|YP_002645014.1| putative epoxide hydrolase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253799015|ref|YP_003032016.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN 1435]
 gi|254232109|ref|ZP_04925436.1| epoxide hydrolase ephB [Mycobacterium tuberculosis C]
 gi|254364758|ref|ZP_04980804.1| epoxide hydrolase ephB [Mycobacterium tuberculosis str. Haarlem]
 gi|254550955|ref|ZP_05141402.1| epoxide hydrolase ephB [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260186906|ref|ZP_05764380.1| epoxide hydrolase ephB [Mycobacterium tuberculosis CPHL_A]
 gi|260201028|ref|ZP_05768519.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T46]
 gi|289443419|ref|ZP_06433163.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T46]
 gi|289447554|ref|ZP_06437298.1| epoxide hydrolase ephB [Mycobacterium tuberculosis CPHL_A]
 gi|289554286|ref|ZP_06443496.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN 605]
 gi|289750521|ref|ZP_06509899.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T92]
 gi|289754034|ref|ZP_06513412.1| epoxide hydrolase [Mycobacterium tuberculosis EAS054]
 gi|289762092|ref|ZP_06521470.1| epoxide hydrolase ephB [Mycobacterium tuberculosis GM 1503]
 gi|297634504|ref|ZP_06952284.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN 4207]
 gi|297731492|ref|ZP_06960610.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN R506]
 gi|298525432|ref|ZP_07012841.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306776165|ref|ZP_07414502.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu001]
 gi|306779947|ref|ZP_07418284.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu002]
 gi|306784697|ref|ZP_07423019.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu003]
 gi|306789054|ref|ZP_07427376.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu004]
 gi|306793389|ref|ZP_07431691.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu005]
 gi|306797770|ref|ZP_07436072.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu006]
 gi|306803653|ref|ZP_07440321.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu008]
 gi|306808227|ref|ZP_07444895.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu007]
 gi|306968050|ref|ZP_07480711.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu009]
 gi|306972273|ref|ZP_07484934.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu010]
 gi|307079984|ref|ZP_07489154.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu011]
 gi|307084560|ref|ZP_07493673.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu012]
 gi|313658825|ref|ZP_07815705.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN V2475]
 gi|1806224|emb|CAB06523.1| PROBABLE EPOXIDE HYDROLASE EPHB (EPOXIDE HYDRATASE) [Mycobacterium
           tuberculosis H37Rv]
 gi|13881646|gb|AAK46260.1| epoxide hydrolase [Mycobacterium tuberculosis CDC1551]
 gi|31618721|emb|CAD94675.1| PROBABLE EPOXIDE HYDROLASE EPHB (EPOXIDE HYDRATASE) [Mycobacterium
           bovis AF2122/97]
 gi|121493490|emb|CAL71964.1| Probable epoxide hydrolase ephB [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124601168|gb|EAY60178.1| epoxide hydrolase ephB [Mycobacterium tuberculosis C]
 gi|134150272|gb|EBA42317.1| epoxide hydrolase ephB [Mycobacterium tuberculosis str. Haarlem]
 gi|148505898|gb|ABQ73707.1| epoxide hydrolase EphB [Mycobacterium tuberculosis H37Ra]
 gi|148721677|gb|ABR06302.1| epoxide hydrolase ephB [Mycobacterium tuberculosis F11]
 gi|224773440|dbj|BAH26246.1| putative epoxide hydrolase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253320518|gb|ACT25121.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN 1435]
 gi|289416338|gb|EFD13578.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T46]
 gi|289420512|gb|EFD17713.1| epoxide hydrolase ephB [Mycobacterium tuberculosis CPHL_A]
 gi|289438918|gb|EFD21411.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN 605]
 gi|289691108|gb|EFD58537.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T92]
 gi|289694621|gb|EFD62050.1| epoxide hydrolase [Mycobacterium tuberculosis EAS054]
 gi|289709598|gb|EFD73614.1| epoxide hydrolase ephB [Mycobacterium tuberculosis GM 1503]
 gi|298495226|gb|EFI30520.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215405|gb|EFO74804.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu001]
 gi|308327158|gb|EFP16009.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu002]
 gi|308330594|gb|EFP19445.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu003]
 gi|308334428|gb|EFP23279.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu004]
 gi|308338223|gb|EFP27074.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu005]
 gi|308341912|gb|EFP30763.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu006]
 gi|308345408|gb|EFP34259.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu007]
 gi|308349711|gb|EFP38562.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu008]
 gi|308354341|gb|EFP43192.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu009]
 gi|308358285|gb|EFP47136.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu010]
 gi|308362212|gb|EFP51063.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu011]
 gi|308365864|gb|EFP54715.1| epoxide hydrolase ephB [Mycobacterium tuberculosis SUMu012]
 gi|323719555|gb|EGB28680.1| epoxide hydrolase ephB [Mycobacterium tuberculosis CDC1551A]
 gi|328458770|gb|AEB04193.1| epoxide hydrolase ephB [Mycobacterium tuberculosis KZN 4207]
          Length = 356

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D+  P ++L+HG   S   +W     I  L   G+RV+A D  G+G+S K  ++  YR+ 
Sbjct: 24  DQQGPLVVLLHGFPES-WYSWRHQ--IPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIK 80

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
            +  D V +L+  G  +  V+G+  GA +A +    +P     V+
Sbjct: 81  ELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVV 125


>gi|88706855|ref|ZP_01104555.1| Carboxyl esterase, a/b hydrolase [Congregibacter litoralis KT71]
 gi|88698905|gb|EAQ96024.1| Carboxyl esterase, a/b hydrolase [Congregibacter litoralis KT71]
          Length = 296

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 60/140 (42%), Gaps = 29/140 (20%)

Query: 10  SWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD----QGFRVIAFDN- 64
           S       +   G+ + PT+LLI GL +        +GW    CD     G+ V+ FDN 
Sbjct: 5   SVNTINLEYESHGNPENPTVLLIMGLGTQ------LTGWPPAFCDYLVDHGYHVLRFDNR 58

Query: 65  -------LGHGKSD-----------KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYS 106
                  L H ++            K      Y L  MAADA+ LL+ L I K HV+G S
Sbjct: 59  DIGLSSRLDHERTPNIPGLVILKTLKMPAPAPYTLEDMAADAIGLLDALKIDKAHVVGAS 118

Query: 107 MGARIACSMVLFYPSYVRSV 126
           MG  IA  + + YP    S+
Sbjct: 119 MGGMIAQLIAVHYPERTLSL 138


>gi|90415782|ref|ZP_01223715.1| probable hydrolase [marine gamma proteobacterium HTCC2207]
 gi|90332156|gb|EAS47353.1| probable hydrolase [marine gamma proteobacterium HTCC2207]
          Length = 299

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 63/131 (48%), Gaps = 21/131 (16%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK-- 72
           + A+   G  + P I+L+ GL + +   W      QLL D+GFRVI FDN   G SDK  
Sbjct: 16  KIAYESFGKPEDPAIVLVAGLYNQL-VRWPLE-LCQLLVDRGFRVIRFDNRDIGLSDKFD 73

Query: 73  -------------SY----IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
                        SY    +   Y L  MAAD V LL+ L +S  H++G SMG  I+  +
Sbjct: 74  GVRAPGYFRLLLRSYFGIPVSAPYNLDDMAADTVGLLDALELSAAHLVGMSMGGMISQIV 133

Query: 116 VLFYPSYVRSV 126
              YP  V S+
Sbjct: 134 AGRYPDRVLSL 144


>gi|213157496|ref|YP_002319541.1| 3-oxoadipate enol-lactonase [Acinetobacter baumannii AB0057]
 gi|215483298|ref|YP_002325505.1| 3-oxoadipate enol-lactonase [Acinetobacter baumannii AB307-0294]
 gi|294839458|ref|ZP_06784141.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter sp. 6013113]
 gi|294859288|ref|ZP_06797057.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter sp. 6013150]
 gi|301346147|ref|ZP_07226888.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter baumannii AB056]
 gi|301510653|ref|ZP_07235890.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter baumannii AB058]
 gi|301594864|ref|ZP_07239872.1| 3-oxoadipate enol-lactonase II (Beta-ketoadipate enol-lactone
           hydrolase II) [Acinetobacter baumannii AB059]
 gi|213056656|gb|ACJ41558.1| 3-oxoadipate enol-lactonase [Acinetobacter baumannii AB0057]
 gi|213986982|gb|ACJ57281.1| 3-oxoadipate enol-lactonase [Acinetobacter baumannii AB307-0294]
          Length = 259

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 100/239 (41%), Gaps = 33/239 (13%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNW-LFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Q  +   G+  +P ++     ++S+ TN+ ++      L DQ F VI +DN GHG S  S
Sbjct: 10  QINYQTFGEPSSPALVF----SNSLGTNYGMWQKQFNELKDQ-FFVICYDNRGHGSS--S 62

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
             +  Y +  +  D V LL+HL ISK    G SMG      + + YP+    V++    +
Sbjct: 63  TPDGPYTVEQLGEDVVRLLDHLNISKAAFCGISMGGLTGQWLAIHYPNRFSHVVVANTAA 122

Query: 134 VLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDP------------GNDLKA- 180
            +        Q+ +D   L     +Q P+          DP             NDL A 
Sbjct: 123 KIGQE-----QAWLDRAKLVREQGLQ-PIAATAASRWFTDPFIQSHPSIVNNLCNDLSAG 176

Query: 181 ----LASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA--GSPQELMSFIPSSQYLNI 233
                A+C   + K   ++ L  I +PVL+  G+QD +      + +   IP S+   I
Sbjct: 177 SAIGYANCCEALAKADVREQLKDIKIPVLVVAGTQDPITTVADGEFMQQRIPQSKLTEI 235


>gi|86158673|ref|YP_465458.1| Alpha/beta hydrolase fold-1 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775184|gb|ABC82021.1| Alpha/beta hydrolase fold-1 [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 284

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 4/103 (3%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           P ++L+HG  SS++T+  F+  +  L     RVIAFD  GHG++     +  +     A 
Sbjct: 57  PPLVLLHGGGSSIETS--FASLLPALARH-RRVIAFDQQGHGRT-ADLPDRPFTFEQSAD 112

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           D  +LL HLG+++  + G+S G  IA  + + +P+ VR +++ 
Sbjct: 113 DTAALLRHLGVARADLFGFSNGGTIALQVAVRHPALVRRLVVA 155


>gi|298249265|ref|ZP_06973069.1| alpha/beta hydrolase fold protein [Ktedonobacter racemifer DSM
           44963]
 gi|297547269|gb|EFH81136.1| alpha/beta hydrolase fold protein [Ktedonobacter racemifer DSM
           44963]
          Length = 266

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 57  FRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
           +RVI FD+ G G+SD+      Y     A DA++LL+HLGI++VHV GYSMG R++  + 
Sbjct: 47  YRVIVFDHRGTGQSDQP-TAPPYSTRGFAQDAIALLDHLGIARVHVYGYSMGGRVSQWLG 105

Query: 117 LFYPSYVRSVILGGV 131
           + +   V +++LG  
Sbjct: 106 IDHGQRVGALVLGAT 120


>gi|290509086|ref|ZP_06548457.1| 2-hydroxy-6-oxononadienedioate [Klebsiella sp. 1_1_55]
 gi|289778480|gb|EFD86477.1| 2-hydroxy-6-oxononadienedioate [Klebsiella sp. 1_1_55]
          Length = 295

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           R  +    D GD    T++++HG      T W  FS  I  L + G+RV+  D  G GKS
Sbjct: 29  RTLRIHINDCGDGKE-TVVMLHGSGPGA-TGWANFSRNIDPLVEAGYRVLLLDCPGWGKS 86

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D + + +  R    A    S+++ LGI KVH++G SMG   A +  L +P  V  ++L G
Sbjct: 87  D-AIVNSGSRSDLNARILKSVVDQLGIDKVHLLGNSMGGHSAVAFTLSWPERVAKLVLMG 145

Query: 131 VGS 133
            G+
Sbjct: 146 GGT 148


>gi|115465185|ref|NP_001056192.1| Os05g0542200 [Oryza sativa Japonica Group]
 gi|55908884|gb|AAV67827.1| unknown protein [Oryza sativa Japonica Group]
 gi|113579743|dbj|BAF18106.1| Os05g0542200 [Oryza sativa Japonica Group]
          Length = 400

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
           G  V  FDN G G+S     ++ Y  V MA DA++L++HLG  K HV G+SMGA I+C +
Sbjct: 78  GIEVCCFDNRGVGRSSVLPHKSYYSTVIMARDALALMDHLGWKKAHVFGHSMGAMISCKL 137

Query: 116 VLFYPSYVRSVIL 128
               P  + S+ L
Sbjct: 138 AAMAPHRICSLAL 150


>gi|21221992|ref|NP_627771.1| epoxide hydrolase [Streptomyces coelicolor A3(2)]
 gi|256786922|ref|ZP_05525353.1| epoxide hydrolase [Streptomyces lividans TK24]
 gi|5139628|emb|CAB45554.1| putative epoxide hydrolase [Streptomyces coelicolor A3(2)]
          Length = 354

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 3/103 (2%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P +LL+HG   S  + W     +  L   GFR +A D  G+G+S +      YR++ + 
Sbjct: 49  GPLVLLVHGFPESWYS-WRHQ--LPALAAAGFRAVALDVRGYGRSSRPDAVEAYRMLDLV 105

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           AD V+++E LG S   V+G+  GA IA    L  P   R+V L
Sbjct: 106 ADNVAVVEALGESSAVVVGHDWGANIAAHSALLRPDVFRAVGL 148


>gi|261416805|ref|YP_003250488.1| alpha/beta hydrolase fold protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373261|gb|ACX76006.1| alpha/beta hydrolase fold protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 464

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 10/126 (7%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQL---LCDQGFRVIAFDNLGHGKSDKSYIEND 78
           GD+    ++LIHGL     +      W Q+   L  +G+RV   +  G+GK+DK   E+ 
Sbjct: 202 GDEKGAPVILIHGLVDGRVS------WSQVAPQLAKKGYRVYVPELRGNGKTDKPIEESA 255

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-GGVGSVLYD 137
           Y +  +A D  + ++ L ++K H++G+S G+ +A  + + Y   + S+ L G   SV   
Sbjct: 256 YSIKELAKDIAAFIDKLELNKPHIVGHSFGSFVAQELSISYADKIGSITLIGSAASVDKK 315

Query: 138 SDVVDW 143
           +  +DW
Sbjct: 316 NATIDW 321


>gi|255530093|ref|YP_003090465.1| alpha/beta hydrolase fold protein [Pedobacter heparinus DSM 2366]
 gi|255343077|gb|ACU02403.1| alpha/beta hydrolase fold protein [Pedobacter heparinus DSM 2366]
          Length = 329

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T++L HG        + ++  I+ L  +GFRV+  D +G GKS K +I   Y    MAA 
Sbjct: 69  TVMLFHGKNFG---GYYWTEVIKSLTSRGFRVVVPDQIGFGKSSKPFIH--YSFHQMAAW 123

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             +LL+ LGI K  ++G+SMG  +A    L YP     ++L
Sbjct: 124 NKALLDALGIQKASILGHSMGGMLATRFALMYPEQTEKLLL 164


>gi|220916800|ref|YP_002492104.1| alpha/beta hydrolase fold protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219954654|gb|ACL65038.1| alpha/beta hydrolase fold protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 284

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +  +       P ++L+HG  SS+ T+  F+  +  L     RVIAFD  GHG++     
Sbjct: 46  YELHGPAGAKGPPLVLLHGGGSSIDTS--FASLLPALARH-RRVIAFDQQGHGRT-ADLP 101

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILG 129
           +  +     A D  +LL HLG+++  ++G+S G  IA  + + +P+ VR +++ 
Sbjct: 102 DRPFTFEQSADDTAALLRHLGVARADLLGFSNGGTIALQVAVRHPALVRRLVVA 155


>gi|295676180|ref|YP_003604704.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1002]
 gi|295436023|gb|ADG15193.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1002]
          Length = 432

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 12/119 (10%)

Query: 15  QFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGK 69
           Q A+ DV     +  T++L+HG       N+  + W   I+ L D G+RVIA D +G  K
Sbjct: 116 QMAYMDVKPAHPNGRTVVLLHG------KNFCSATWDTTIRRLSDAGYRVIAPDQIGFCK 169

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           S K      Y    +A +  +LLE LG+S V V+G+S G  +A    L YP   + ++L
Sbjct: 170 SSKPE-HYQYSFQQLARNTHALLESLGVSDVTVVGHSTGGMLAVRYALMYPRETQQLVL 227


>gi|90423166|ref|YP_531536.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB18]
 gi|90105180|gb|ABD87217.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB18]
          Length = 331

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 8   FRSWRKYQFAFYDVGD-KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           F S    +  +YD G   D P ++L HG    +  +W     I+ L + G RVIA D  G
Sbjct: 9   FASSNGIRIGYYDAGPATDTPPLVLCHGW-PELAFSWRHQ--IKALSEAGIRVIAPDQRG 65

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            G SD+      Y +  +  D V LL+HL I K   +G+  G  +   M L +P+ V  V
Sbjct: 66  FGASDRPQPVEAYDIEQLTGDLVGLLDHLAIDKAIFVGHDWGGFVVWQMPLRHPTRVAGV 125

Query: 127 I 127
           +
Sbjct: 126 V 126


>gi|289570023|ref|ZP_06450250.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T17]
 gi|289543777|gb|EFD47425.1| epoxide hydrolase ephB [Mycobacterium tuberculosis T17]
          Length = 189

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           D+  P ++L+HG   S   +W     I  L   G+RV+A D  G+G+S K  ++  YR+ 
Sbjct: 24  DQQGPLVVLLHGFPES-WYSWRHQ--IPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIK 80

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
            +  D V +L+  G  +  V+G+  GA +A +    +P     V+
Sbjct: 81  ELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVV 125


>gi|262044198|ref|ZP_06017269.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|259038460|gb|EEW39660.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
          Length = 288

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           R  +    D GD    T++++HG      T W  FS  I  L + G+RV+  D  G GKS
Sbjct: 22  RTLRIHINDCGDGKE-TVVMLHGSGPGA-TGWANFSRNIDPLVEAGYRVLLLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D + + +  R    A    S+++ LGI KVH++G SMG   A +  L +P  V  ++L G
Sbjct: 80  D-AIVNSGSRSDLNARILKSVVDQLGIDKVHLLGNSMGGHSAVAFTLSWPERVAKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|221218596|ref|YP_002527554.1| hypothetical protein pO103_98 [Escherichia coli]
 gi|215252924|gb|ACJ63583.1| conserved hypothetical protein [Escherichia coli]
          Length = 279

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 97/227 (42%), Gaps = 37/227 (16%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS-DKSYIENDYR 80
           GD + PTILLI G  SS+   W    + + L +QGF VI +DN   G+S    Y   +Y 
Sbjct: 19  GDTNDPTILLIMGATSSMI--WWEEDFCRKLSNQGFHVIRYDNRDVGRSITYEYGHPEYT 76

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL------------ 128
               A DA+ +L+   + K H++G SMG  I   + L +P  V ++ L            
Sbjct: 77  FEDWADDAIQVLDAYRVDKAHIVGMSMGGIITQIVALKHPDRVLTISLVMTSNYDSSLPK 136

Query: 129 --GGVGSVLYDSDVVDWQSLIDSFLLPSIDE------VQNPLG-KKFRKFADLDPGNDLK 179
               V  V    ++ +W+   +  +   +D        ++P   +K RK A    G D  
Sbjct: 137 KDSKVTEVFAKININNWEDK-EEVIKYVMDRSKVLVGTKHPFNEEKIRKLA----GKDFD 191

Query: 180 ALASCLSMIRKPFCQ------DDLYRIDVPVLIAVGSQDDLAGSPQE 220
             ++  SM    + +         + I+VP L+  G+ D +   P E
Sbjct: 192 RASNMESMENHEYVKGWGLYLSRTHEINVPTLVIHGTDDPII--PHE 236


>gi|120402252|ref|YP_952081.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119955070|gb|ABM12075.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
          Length = 300

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 61/115 (53%), Gaps = 22/115 (19%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN--------LGHGK 69
           + D+GD + P +LLI GL + +   W  +G+ + L +QG RVI FDN        L H +
Sbjct: 17  YEDMGDPNDPAVLLIMGLGAQLLL-WR-NGFCEKLINQGLRVIRFDNRDVGLSSKLHHHR 74

Query: 70  SD--------KSYIEND----YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
           S         +S++       Y L  MA DA +LL+HLGI   HV+G SMG  IA
Sbjct: 75  SGAPLLPRMARSFVGRPSPAAYTLEDMADDAAALLDHLGIDTAHVVGGSMGGMIA 129


>gi|331671912|ref|ZP_08372708.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli TA280]
 gi|331676014|ref|ZP_08376726.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli H591]
 gi|331070901|gb|EGI42260.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli TA280]
 gi|331076072|gb|EGI47354.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli H591]
 gi|332103846|gb|EGJ07192.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Shigella sp.
           D9]
          Length = 309

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 43  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 101 D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 159

Query: 131 VGS 133
            G+
Sbjct: 160 GGT 162


>gi|330012682|ref|ZP_08307460.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate
           hydrolase [Klebsiella sp. MS 92-3]
 gi|328533728|gb|EGF60419.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate
           hydrolase [Klebsiella sp. MS 92-3]
          Length = 288

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           R  +    D GD    T++++HG      T W  FS  I  L + G+RV+  D  G GKS
Sbjct: 22  RTLRIHINDCGDGKE-TVVMLHGSGPGA-TGWANFSRNIDPLVEAGYRVLLLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D + + +  R    A    S+++ LGI KVH++G SMG   A +  L +P  V  ++L G
Sbjct: 80  D-AIVNSGSRSDLNARILKSVVDQLGIDKVHLLGNSMGGHSAVAFTLSWPERVAKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|148254308|ref|YP_001238893.1| putative epoxide hydrolase [Bradyrhizobium sp. BTAi1]
 gi|146406481|gb|ABQ34987.1| putative epoxide hydrolase [Bradyrhizobium sp. BTAi1]
          Length = 334

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 15  QFAFYDVGD-KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +  +Y+ G   D P ++L HG    +  +W     I+ L + G RVIA D  G+G +D+ 
Sbjct: 19  RMGYYEAGPASDRPPLILCHGW-PELAFSWRHQ--IRALAEAGIRVIAPDQRGYGATDRP 75

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
                Y L  + AD V LL+HL I K   +G+  G  +   M L +P  V  V+
Sbjct: 76  EAVEAYDLEQLTADLVGLLDHLKIDKAVFVGHDWGGFVVWQMPLRHPDRVAGVV 129


>gi|188492410|ref|ZP_02999680.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 53638]
 gi|188487609|gb|EDU62712.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 53638]
          Length = 293

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|331640866|ref|ZP_08342001.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli H736]
 gi|1657545|gb|AAB18073.1| PcbD-like protein [Escherichia coli str. K-12 substr. MG1655]
 gi|331037664|gb|EGI09884.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli H736]
          Length = 309

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 43  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 101 D-SVVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLKWPERVGKLVLMG 159

Query: 131 VGS 133
            G+
Sbjct: 160 GGT 162


>gi|298717355|ref|YP_003729997.1| hydrolase or acyltransferase [Pantoea vagans C9-1]
 gi|298361544|gb|ADI78325.1| Predicted hydrolase or acyltransferase [Pantoea vagans C9-1]
          Length = 273

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 96/231 (41%), Gaps = 33/231 (14%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F++    Q  F D G      +L  HG         ++   ++ L D G+RVIAFD  G 
Sbjct: 4   FKTTDGTQIYFKDWGT--GKPVLFSHGWPLDAD---MWDSQMKFLADNGYRVIAFDRRGF 58

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS--YVRS 125
           G+SD+ +  NDY     A+D   L+ HL +  V ++G+SMG       +  Y S      
Sbjct: 59  GRSDQPWTGNDYDT--FASDINDLITHLDLQNVTLVGFSMGGGDVTRYIGSYGSDRVAAL 116

Query: 126 VILGGVGSVLYDSDVVDWQSLIDSFLLPSIDE-VQNPLGKKFRKFADLDPGND------- 177
           V+LG V  +       D+   +D  +   I E +     +  ++FA    G +       
Sbjct: 117 VLLGAVTPIF--GKTADYPQGVDMSVFEGIREGLLKDRAQFIKEFATPFYGTNAGQTVSD 174

Query: 178 --------------LKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL 214
                         LK+   C++   +   + D+ +++VP L+  GS D +
Sbjct: 175 GVMTQTLNIALLASLKSTVDCVTAFAETDFRADVAKVNVPTLVIHGSNDQI 225


>gi|160875307|ref|YP_001554623.1| alpha/beta hydrolase fold protein [Shewanella baltica OS195]
 gi|160860829|gb|ABX49363.1| alpha/beta hydrolase fold [Shewanella baltica OS195]
 gi|315267501|gb|ADT94354.1| alpha/beta hydrolase fold protein [Shewanella baltica OS678]
          Length = 258

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 7/117 (5%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           V     P +LLIHGL  ++       G  Q+L  Q ++VI  D   HG S+  + E DY 
Sbjct: 4   VSTGQGPAVLLIHGLFGNLDN---LKGLGQVLESQ-YQVIRVDVPNHGLSEH-WDEMDYP 58

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
              +A   VSLL+ L I + H++G+SMG +IA +  L +P  + S++   +  V Y+
Sbjct: 59  R--LATAMVSLLDELAIERAHIVGHSMGGKIAMATALAFPERIISMVAADIAPVAYE 113


>gi|11862915|dbj|BAB19271.1| D-(-)-3-hydroxybutyrate oligomer hydrolase [Acidovorax sp. SA1]
          Length = 291

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 90/205 (43%), Gaps = 30/205 (14%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIA 61
           M  +  + +   Y+  + + G  DAP ++  HGLA + +     +  +       +RVI 
Sbjct: 1   MTPLSRYTTCAGYEIHYMEWGAPDAPVVIAWHGLARTGRDMDPLAAHLA----SRYRVIC 56

Query: 62  FDNLGHGKSDKSYIEND-YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA--CSMVLF 118
            D LG G S  +    D YRL F A  A  LL+ LGI K H +G SMG  I   C+  LF
Sbjct: 57  PDTLGRGLSQWARAPQDEYRLSFYARIAADLLDQLGIEKAHWVGTSMGGAIGTVCASGLF 116

Query: 119 YPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGND- 177
            P      + G V S+L + +      L D+ L            ++ + +A   P  D 
Sbjct: 117 EPQ-----LKGRVQSLLLNDNA---PRLADAAL------------ERIKAYAGHPPAFDT 156

Query: 178 LKALASCLSMIRKPF--CQDDLYRI 200
           +K L +    + KP+    D+ +R+
Sbjct: 157 VKELEAFFRQVYKPYGWLSDEQWRL 181


>gi|324016652|gb|EGB85871.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           117-3]
          Length = 293

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|281177530|dbj|BAI53860.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli SE15]
          Length = 293

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|206576466|ref|YP_002238039.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Klebsiella
           pneumoniae 342]
 gi|288935025|ref|YP_003439084.1| alpha/beta hydrolase fold protein [Klebsiella variicola At-22]
 gi|206565524|gb|ACI07300.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Klebsiella
           pneumoniae 342]
 gi|288889734|gb|ADC58052.1| alpha/beta hydrolase fold protein [Klebsiella variicola At-22]
          Length = 288

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           R  +    D GD    T++++HG      T W  FS  I  L + G+RV+  D  G GKS
Sbjct: 22  RTLRIHINDCGDGKE-TVVMLHGSGPGA-TGWANFSRNIDPLVEAGYRVLLLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D + + +  R    A    S+++ LGI KVH++G SMG   A +  L +P  V  ++L G
Sbjct: 80  D-AIVNSGSRSDLNARILKSVVDQLGIDKVHLLGNSMGGHSAVAFTLSWPERVAKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|256157670|ref|ZP_05455588.1| 3-oxoadipate enol-lactonase [Brucella ceti M490/95/1]
 gi|256253357|ref|ZP_05458893.1| 3-oxoadipate enol-lactonase [Brucella ceti B1/94]
          Length = 267

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 97/238 (40%), Gaps = 31/238 (13%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRV--IAFDNLGHGKSDKSYIENDYRL 81
            D P ++ I+ L +       F  W ++    G  V  + +D  GHG SD    +  Y +
Sbjct: 20  NDKPVLVFINSLGTD------FRIWNKVRARLGHDVSTLVYDKRGHGLSDIG--KTPYTI 71

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +A D ++LL+ L I K  + G S+G  IA  +    P  V  ++L      +   ++ 
Sbjct: 72  ELLAQDLIALLDRLSIHKAVICGLSVGGLIAQGLYAARPDLVAGLVLSNTAHKIGTPEM- 130

Query: 142 DWQSLIDSFLLPSIDEV-------------QNPLGKKFRKFADLDPGNDLKALASCLSMI 188
            W + ID+ +   +  +             + P    ++ + ++     L+  A+  S +
Sbjct: 131 -WNARIDAIMQNGLASILDATMPRWFTAAYRRPDNAAYQAYCNMFTRQPLEGYAATCSAL 189

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRDHLLAV 242
           R        ++I VPV    G QD    +P    QEL S IP + +  I    H+  V
Sbjct: 190 RDADFTAAAHKISVPVRCVAGDQD--GSTPPTLVQELASLIPGAVFSQIANSGHIPCV 245


>gi|269929127|ref|YP_003321448.1| alpha/beta hydrolase fold protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269788484|gb|ACZ40626.1| alpha/beta hydrolase fold protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 376

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (48%), Gaps = 6/105 (5%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           +D P ++LIHG    + T WLF+   Q     G  V A D  GHG S K     D  L  
Sbjct: 132 EDGPAVILIHGFGGDLNT-WLFN---QEALAGGRTVYALDLPGHGGSSKDV--GDGSLDV 185

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           +A      ++ LGI + H+ G+SMG   A ++   +P  V S+ L
Sbjct: 186 LAGTVAGFMDALGIERAHLAGHSMGGATAMAVATAHPERVASLTL 230


>gi|325000003|ref|ZP_08121115.1| alpha/beta hydrolase fold protein [Pseudonocardia sp. P1]
          Length = 270

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (53%), Gaps = 7/110 (6%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           Y++     P +LLI G + S+      SG +     Q  +VIAFDN G G SD+     D
Sbjct: 14  YEISGSGDP-LLLIMGTSGSIPLWGELSGRLA----QTHQVIAFDNRGLGGSDRGAGPID 68

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             +  +A DA  LLE LGI + HV+G+S+G+ +   + L +P  V S ++
Sbjct: 69  --VATLAEDASGLLEALGIPRAHVLGWSLGSAVVQELALAHPEQVASAVM 116


>gi|320449517|ref|YP_004201613.1| proline iminopeptidase [Thermus scotoductus SA-01]
 gi|320149686|gb|ADW21064.1| proline iminopeptidase [Thermus scotoductus SA-01]
          Length = 282

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 61/112 (54%), Gaps = 8/112 (7%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           DVGD+ AP +L++HG         L  G    L  +GFRVI FD  G G+S +  +  D 
Sbjct: 19  DVGDEHAPALLVLHG-GPGGNAYALREGLQDYL--EGFRVIYFDQRGSGRSLE--LPQDP 73

Query: 80  RLVFMAA---DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           RL  + A   D V+L E LG+ + H++ +  GA +A  ++  YP  + +V+L
Sbjct: 74  RLFTIGALVEDTVALAEALGLEQFHLLAHGFGALVALELLRRYPEVLGAVLL 125


>gi|226308818|ref|YP_002768778.1| hydrolase [Rhodococcus erythropolis PR4]
 gi|226187935|dbj|BAH36039.1| putative hydrolase [Rhodococcus erythropolis PR4]
          Length = 305

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 101/251 (40%), Gaps = 38/251 (15%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD---QGFRVIAFDNLGHGKSD 71
            +A+ ++G      ++ +H  A+      +   W   + D   +   VIAFDN G G +D
Sbjct: 28  NYAYRELGTPGGVPVVFLHHFAA------VLDDWDPRIIDGIAENHHVIAFDNRGVGATD 81

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            +   +   L  M  DA + +  LG   V ++G+S+G  +A  + L  P+ VR ++L G 
Sbjct: 82  TAVPAD---LEKMGQDAAAFIRALGHGTVDLIGFSLGGAVAQMIALHDPTLVRRMVLAGT 138

Query: 132 GSVLYDSDVVDWQSLIDSF----------------LLPSIDEVQNPLGKKFRKFA----D 171
           G     +  VD    I  F                  P  DE ++     F + A    D
Sbjct: 139 GP--RGAGGVDQMGKIVGFAYLKAALARKDARHFLFFPRTDEGKSAADDYFARLAERTVD 196

Query: 172 LDPGNDLKALASCLSMI--RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQ--ELMSFIPS 227
            D    ++A  + L  I        DDL RI  PV +A G  D +  S    +L   IP+
Sbjct: 197 RDTRISMQARVAQLKAIVGGGKAAPDDLARITQPVFVANGDNDLMVASDHSADLARRIPN 256

Query: 228 SQYLNICRRDH 238
           S+     R  H
Sbjct: 257 SKLTIYPRSGH 267


>gi|260853578|ref|YP_003227469.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O26:H11 str. 11368]
 gi|257752227|dbj|BAI23729.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O26:H11 str. 11368]
 gi|323152083|gb|EFZ38378.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli EPECa14]
          Length = 293

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|238895169|ref|YP_002919904.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238547486|dbj|BAH63837.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 309

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           R  +    D GD    T++++HG      T W  FS  I  L + G+RV+  D  G GKS
Sbjct: 43  RTLRIHINDCGDGKE-TVVMLHGSGPGA-TGWANFSRNIDPLVEAGYRVLLLDCPGWGKS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D + + +  R    A    S+++ LGI KVH++G SMG   A +  L +P  V  ++L G
Sbjct: 101 D-AIVNSGSRSDLNARILKSVVDQLGIDKVHLLGNSMGGHSAVAFTLSWPERVAKLVLMG 159

Query: 131 VGS 133
            G+
Sbjct: 160 GGT 162


>gi|169633918|ref|YP_001707654.1| putative hydrolase (EstB) [Acinetobacter baumannii SDF]
 gi|169796810|ref|YP_001714603.1| putative hydrolase (EstB) [Acinetobacter baumannii AYE]
 gi|213156797|ref|YP_002318458.1| alpha/beta hydrolase fold protein EstB [Acinetobacter baumannii
           AB0057]
 gi|215484288|ref|YP_002326515.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter baumannii
           AB307-0294]
 gi|239502977|ref|ZP_04662287.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter baumannii
           AB900]
 gi|260555926|ref|ZP_05828146.1| alpha/beta hydrolase fold protein EstB [Acinetobacter baumannii
           ATCC 19606]
 gi|294838340|ref|ZP_06783023.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter sp. 6013113]
 gi|294859917|ref|ZP_06797686.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter sp. 6013150]
 gi|301344625|ref|ZP_07225366.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter baumannii
           AB056]
 gi|301513085|ref|ZP_07238322.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter baumannii
           AB058]
 gi|301596656|ref|ZP_07241664.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter baumannii
           AB059]
 gi|169149737|emb|CAM87628.1| putative hydrolase (EstB) [Acinetobacter baumannii AYE]
 gi|169152710|emb|CAP01714.1| putative hydrolase (EstB) [Acinetobacter baumannii]
 gi|213055957|gb|ACJ40859.1| alpha/beta hydrolase fold protein EstB [Acinetobacter baumannii
           AB0057]
 gi|213987196|gb|ACJ57495.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter baumannii
           AB307-0294]
 gi|260410837|gb|EEX04135.1| alpha/beta hydrolase fold protein EstB [Acinetobacter baumannii
           ATCC 19606]
          Length = 314

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 58/132 (43%), Gaps = 31/132 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKSDKSYIEN 77
           G  + PTILLI GL + +    LF  W    C    DQGFRVI FDN   G S K   + 
Sbjct: 35  GKPEHPTILLIMGLGAQM----LF--WPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHQG 88

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MA D   LL+ LG+SK HV+G SMG  IA  + 
Sbjct: 89  KRLNTMKLMGRFALGLRNQGAPYTLYDMADDVSMLLDRLGVSKAHVIGASMGGMIAQILA 148

Query: 117 LFYPSYVRSVIL 128
             YP  V  + L
Sbjct: 149 AKYPEKVEKLGL 160


>gi|326514828|dbj|BAJ99775.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 322

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 9/111 (8%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           + G +D P +LL+HG         L+ GW   +  L  +GFR +A D  G+G SD     
Sbjct: 23  EAGPEDGPAVLLVHGFPD------LWYGWRHQMAALAARGFRAVAPDMRGYGDSDAPPSA 76

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
             Y    +  D V+L+  L   +V V+G+  GA +A  + L  P  VR+++
Sbjct: 77  ASYTTFHLVGDLVALIADLAQPQVFVVGHDWGALVAWHLCLLRPDLVRALV 127


>gi|188580343|ref|YP_001923788.1| alpha/beta hydrolase fold [Methylobacterium populi BJ001]
 gi|317412042|sp|B1ZB18|RUTD_METPB RecName: Full=Putative aminoacrylate hydrolase RutD; AltName:
           Full=Aminohydrolase
 gi|179343841|gb|ACB79253.1| alpha/beta hydrolase fold [Methylobacterium populi BJ001]
          Length = 260

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 5/107 (4%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G + A T+LL  GL  S      F+  +  L ++ FRV+ +D+ G G+S    +E  + +
Sbjct: 11  GPEGARTVLLSPGLGGSAH---YFAPQVPALAER-FRVVTYDHRGTGRS-PGPLEPGHDI 65

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             MA D ++LL+HLGI    ++G+++G  IA  + L +P  V  +++
Sbjct: 66  AAMARDVLALLDHLGIGTTDIVGHALGGLIALHLALTHPERVERIVV 112


>gi|325497409|gb|EGC95268.1| 3-oxoadipate enol-lactonase I [Escherichia fergusonii ECD227]
          Length = 254

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 87/208 (41%), Gaps = 30/208 (14%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G ++AP I+L + L +++    ++   I  L    FRV+ +D  GHGK++K+       L
Sbjct: 9   GPENAPVIVLSNSLGTTLS---MWQPQISALTSH-FRVLRYDTHGHGKTEKN---ETVTL 61

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +  D V+LL+HL I K H  G SMG      +  + P    SV +  + S     +  
Sbjct: 62  AQLGEDVVALLDHLAIEKAHFCGISMGGLTGLWLARYKPQRFHSVTV--LNSAAKIGEAT 119

Query: 142 DWQSLIDSFLLPSIDEVQNPLGKKF-----------------RKFADLDPGNDLKALASC 184
            W S   +     +  +     +++                 ++ A+  P    +  ASC
Sbjct: 120 GWLSRAQAVREKGMQAIAATAPERWFSESYRLTAATHVAFLCQQLAESSP----EGYASC 175

Query: 185 LSMIRKPFCQDDLYRIDVPVLIAVGSQD 212
              +     + +L  ID+PVL+  G  D
Sbjct: 176 CEALANSDLRAELSAIDLPVLLIAGELD 203


>gi|229494673|ref|ZP_04388431.1| hydrolase, alpha/beta fold family [Rhodococcus erythropolis SK121]
 gi|229318340|gb|EEN84203.1| hydrolase, alpha/beta fold family [Rhodococcus erythropolis SK121]
          Length = 270

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 118/282 (41%), Gaps = 37/282 (13%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLC--DQGFR 58
           M++  + F +    +  +Y+    + P ++L HGL  +         W Q +    Q +R
Sbjct: 1   MISRTEGFITVADGERVWYETA-GEGPDLILTHGLGGNAAV------WYQQVPYFAQHYR 53

Query: 59  VIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLF 118
           VI++D  G G+S       ++  V   +D + +++ L + + HV+G SMG   A    + 
Sbjct: 54  VISWDQRGFGRSTNE--NGNHGPVAAVSDLIEIMDLLDVDRAHVVGQSMGGWAALGTAIA 111

Query: 119 YPSYVRSVIL----GGVGSVLYDSD--------VVDWQSLID----SFLLPSIDEVQNPL 162
            P  V SV+L    GG+  V +  D         V  + L +       LPS+D  +  L
Sbjct: 112 VPDRVESVVLACTTGGI-PVGFGPDSAPPLTAAPVTARPLGEHPAVGGRLPSLDMARAYL 170

Query: 163 GKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM 222
            +    F    P  +   +    +     +   DL  +  PVL+  G  DDL  +P+ + 
Sbjct: 171 YQALGTFGHRPPDTEFFRILKAHN-----YSPSDLAAVTAPVLLIAGELDDLM-TPERIR 224

Query: 223 S---FIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYANELRA 261
           S   F+P ++ + +  R H     D      +V  +  ++RA
Sbjct: 225 SAAEFLPHAEVVELADRGHSPYFEDPHAWNELVAHFLADVRA 266


>gi|295706974|ref|YP_003600049.1| alpha/beta fold family hydrolase [Bacillus megaterium DSM 319]
 gi|294804633|gb|ADF41699.1| hydrolase, alpha/beta fold family [Bacillus megaterium DSM 319]
          Length = 269

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 106/260 (40%), Gaps = 43/260 (16%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           +LL+HG   S QT      W   +    + ++VIA D +GHG+S        Y +  +  
Sbjct: 21  LLLLHGFTGSSQT------WRTFMKKFVKDYQVIAVDIIGHGQSAAPKEIKPYSMEAVVE 74

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSL 146
               LL+ L +S+V+V+GYSMG R+A S    YP +V+ ++L      L   +    +  
Sbjct: 75  ALHELLQQLSLSQVNVIGYSMGGRLALSFAQRYPHHVKKLVLESASPGLKTREEQKLRKE 134

Query: 147 IDSFL---------------------------LPSIDEVQNPLGKKFRKFADLDPGNDLK 179
            D  L                           LPS   VQ  + K+     ++   N LK
Sbjct: 135 KDEQLASRIMKNGIEEFVKFWEGIPLFRSQKQLPS--HVQEAVRKERLSHTEIGLSNSLK 192

Query: 180 ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDH 238
            + + +    +P   + L  + +PVL+  G  D       +E+ + IP++    I    H
Sbjct: 193 GMGTGV----QPSLWEKLDDLLMPVLLISGEVDQKFCLISKEMQTLIPNATSRIILGTGH 248

Query: 239 LLAVGDKQ-FKQGVVNFYAN 257
            + V   + F + V  F A 
Sbjct: 249 AIHVEQPEIFGRIVSEFLAT 268


>gi|209744610|gb|ACI70612.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli]
          Length = 309

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 43  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 101 D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 159

Query: 131 VGS 133
            G+
Sbjct: 160 GGT 162


>gi|119718921|ref|YP_919416.1| 2-acetyl-1-alkylglycerophosph ocholine esterase [Thermofilum
           pendens Hrk 5]
 gi|119524041|gb|ABL77413.1| conserved hypothetical 2-acetyl-1-alkylglycerophosph ocholine
           esterase [Thermofilum pendens Hrk 5]
          Length = 295

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 108/253 (42%), Gaps = 50/253 (19%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T+L++HG  SS    W     I +L    F V+AFD   HG+SD  Y     R V   + 
Sbjct: 72  TVLVVHGYTSSKWDEWYIKPVIDILARNNFNVVAFDMRAHGESDGRYTTLGLREVEDISK 131

Query: 88  AVSLLEHLGI-SKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVD---- 142
            + LLE  G+ S++ ++GYSMG  I   M       V++ +         DS  +D    
Sbjct: 132 IIDLLEEKGLASRLGMIGYSMGGAITL-MTAAREDRVKAAVA--------DSPYIDIRAS 182

Query: 143 ---WQSLIDS----FLLPSIDEVQNPLGKKFR-KFADLDPGNDLKALASCLSMIRKPFCQ 194
              W   + +     LL S      PL   F  K    DP   +  + +  S+IRK    
Sbjct: 183 GKRWVKRVGAPLRYLLLASY-----PLIIYFTSKTTRTDPSKLV--MFNYASLIRK---- 231

Query: 195 DDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLN------ICRRDHLLAVGD--KQ 246
                   P+LI  G  DDL  + +E+ +F   ++ +N      +    H+ A+ D  K+
Sbjct: 232 --------PLLIIAGRNDDLV-ALEEIETFFNENKKVNPNTELWVTDSKHVSAIQDYPKE 282

Query: 247 FKQGVVNFYANEL 259
           +++ VV F+   L
Sbjct: 283 YEKRVVEFFERWL 295


>gi|84687470|ref|ZP_01015347.1| 3-oxoadipate enol-lactone hydrolase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664495|gb|EAQ10982.1| 3-oxoadipate enol-lactone hydrolase [Rhodobacterales bacterium
           HTCC2654]
          Length = 264

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 118/262 (45%), Gaps = 33/262 (12%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + D G KD PT+L  + L +  +   L+   +  L D   R+I +D  GHG +  +  + 
Sbjct: 13  YDDRGPKDGPTVLFANSLGTDFR---LWDRVVARLPDH-LRLIRYDKRGHGLT--TAPDG 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y +  +  DA  LL+HL +  V V+G S+G  IA  +       +R+++L    + +  
Sbjct: 67  PYFMGDLVQDAARLLDHLKVRDVVVVGLSIGGFIAQGLAAERLDLIRAMVLSNTAAKIGT 126

Query: 138 SDVVDWQSLIDSFLLPSIDEVQNPLGKKF--RKFADLDPGNDLKALASCLSMIRKP---- 191
           + +  W+  + +     ++ + +   +++  RKF D DP + ++A  +   M+R+P    
Sbjct: 127 TAM--WEERVATVRRDGVEALADATMERWFGRKFRDSDP-DTVEAFRNM--MVRQPVEGY 181

Query: 192 ------FCQDDLY----RIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRD 237
                   + DLY    R+ +P L   GS+D    +P    +E    +  S++  I    
Sbjct: 182 AGCAAAIGESDLYESTARLKLPTLGIAGSED--GSTPPDLVRETTELVAGSKFHLIRGSG 239

Query: 238 HLLAVGDKQFKQGVVNFYANEL 259
           HL  V +      V+  +  E+
Sbjct: 240 HLPCVDNPDEYARVLTTFLTEI 261


>gi|157155601|ref|YP_001461525.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli E24377A]
 gi|157159865|ref|YP_001457183.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli HS]
 gi|209917565|ref|YP_002291649.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli SE11]
 gi|218552915|ref|YP_002385828.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli IAI1]
 gi|218693813|ref|YP_002401480.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 55989]
 gi|218698742|ref|YP_002406371.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli IAI39]
 gi|218703636|ref|YP_002411155.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli UMN026]
 gi|254160422|ref|YP_003043530.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B str. REL606]
 gi|260866519|ref|YP_003232921.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O111:H- str. 11128]
 gi|300820080|ref|ZP_07100255.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           107-1]
 gi|300820414|ref|ZP_07100566.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           119-7]
 gi|300900409|ref|ZP_07118579.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           198-1]
 gi|300916123|ref|ZP_07132890.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           115-1]
 gi|300932251|ref|ZP_07147526.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           187-1]
 gi|300935582|ref|ZP_07150567.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           21-1]
 gi|309794926|ref|ZP_07689347.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           145-7]
 gi|312970442|ref|ZP_07784623.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 1827-70]
 gi|190359832|sp|A7ZWZ6|MHPC_ECOHS RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|190359841|sp|A7ZI96|MHPC_ECO24 RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|254810986|sp|B7L505|MHPC_ECO55 RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|254810987|sp|B7NK06|MHPC_ECO7I RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|254810989|sp|B7M2Z7|MHPC_ECO8A RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|254810991|sp|B7N8Q6|MHPC_ECOLU RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|254810992|sp|B6HZX5|MHPC_ECOSE RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|157065545|gb|ABV04800.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli HS]
 gi|157077631|gb|ABV17339.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli E24377A]
 gi|209910824|dbj|BAG75898.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli SE11]
 gi|218350545|emb|CAU96233.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 55989]
 gi|218359683|emb|CAQ97224.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli IAI1]
 gi|218368728|emb|CAR16469.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli IAI39]
 gi|218430733|emb|CAR11607.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli UMN026]
 gi|242376135|emb|CAQ30824.1| 2-hydroxy-6-ketonona-2,4-dienedioate hydrolase [Escherichia coli
           BL21(DE3)]
 gi|253972323|gb|ACT37994.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B str. REL606]
 gi|253976532|gb|ACT42202.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli BL21(DE3)]
 gi|257762875|dbj|BAI34370.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O111:H- str. 11128]
 gi|284920160|emb|CBG33219.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 042]
 gi|300356055|gb|EFJ71925.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           198-1]
 gi|300416542|gb|EFJ99852.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           115-1]
 gi|300459215|gb|EFK22708.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           21-1]
 gi|300459996|gb|EFK23489.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           187-1]
 gi|300527199|gb|EFK48268.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           119-7]
 gi|300527360|gb|EFK48422.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           107-1]
 gi|308121579|gb|EFO58841.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           145-7]
 gi|309700614|emb|CBI99910.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli ETEC H10407]
 gi|310337091|gb|EFQ02229.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 1827-70]
 gi|323164140|gb|EFZ49947.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Shigella sonnei
           53G]
 gi|323171160|gb|EFZ56809.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli LT-68]
 gi|323178390|gb|EFZ63968.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 1180]
 gi|323184822|gb|EFZ70193.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 1357]
          Length = 293

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|108801734|ref|YP_641931.1| alpha/beta hydrolase fold [Mycobacterium sp. MCS]
 gi|119870885|ref|YP_940837.1| alpha/beta hydrolase fold [Mycobacterium sp. KMS]
 gi|108772153|gb|ABG10875.1| alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]
 gi|119696974|gb|ABL94047.1| alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]
          Length = 315

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           + G++ AP ++L HG    +  +W     I +L + G+ VIA D  G+G S +     DY
Sbjct: 26  EAGERGAPVVVLAHGF-PELAYSWRHQ--IPVLAEAGYHVIAPDQRGYGGSTRPDAVEDY 82

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSD 139
            +V +  D   LL+ +G  +  V+G+  G+ +  +  L YP  V  ++   V  V   SD
Sbjct: 83  DIVALTGDLAGLLDDVGAQRAVVVGHDWGSPVVTNFALLYPDRVAGMVNLSVPPVPRASD 142


>gi|218904310|ref|YP_002452144.1| hydrolase, alpha/beta fold family [Bacillus cereus AH820]
 gi|218537936|gb|ACK90334.1| hydrolase, alpha/beta fold family [Bacillus cereus AH820]
          Length = 294

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF  + +Y+ +  + G K  P I+  HGL S   T   F    + L D+ + V++FD  G
Sbjct: 4   FFVEFGEYEASVCEWGGKSNPQIICFHGLGS---TKLSFIEMAEFLKDK-YHVVSFDLPG 59

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLEH+G    H++ +S GA +A       P  V  +
Sbjct: 60  HGKTPNFETDEDYGASHLINWVVALLEHIGKETFHLLAHSWGASVALHYAAERPEKVNKM 119

Query: 127 IL 128
           +L
Sbjct: 120 VL 121


>gi|15800080|ref|NP_286092.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 EDL933]
 gi|291281257|ref|YP_003498075.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxononatrienedioate
           hydrolase [Escherichia coli O55:H7 str. CB9615]
 gi|331651278|ref|ZP_08352303.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli M718]
 gi|12513185|gb|AAG54700.1|AE005214_7 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EDL933]
 gi|13359861|dbj|BAB33827.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. Sakai]
 gi|209744604|gb|ACI70609.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli]
 gi|209744606|gb|ACI70610.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli]
 gi|209744608|gb|ACI70611.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli]
 gi|209744612|gb|ACI70613.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli]
 gi|290761130|gb|ADD55091.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxononatrienedioate
           hydrolase [Escherichia coli O55:H7 str. CB9615]
 gi|331051019|gb|EGI23071.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli M718]
          Length = 309

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 43  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 101 D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 159

Query: 131 VGS 133
            G+
Sbjct: 160 GGT 162


>gi|326799994|ref|YP_004317813.1| alpha/beta hydrolase [Sphingobacterium sp. 21]
 gi|326550758|gb|ADZ79143.1| alpha/beta hydrolase fold protein [Sphingobacterium sp. 21]
          Length = 294

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 97/199 (48%), Gaps = 14/199 (7%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y+V  + AP ++LIHG   ++  NW     I L  ++  +++  +  GHG++  + I  
Sbjct: 43  YYEVHGEGAP-LVLIHGSFMTIPMNW--EQIIPLFKNR--KIVVAEMQGHGRT--ADIPR 95

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
                 MA D   LL+HL I    ++GYSMG  +A  M + +P  V+ ++   + S  Y 
Sbjct: 96  TLSYENMADDISELLKHLHIDSADILGYSMGGGVAFQMGIRHPEQVKKLV---IVSGAYK 152

Query: 138 SDVVDWQSLIDSFLLPSIDEVQ-NPLGKKFRKFADLDPGNDLKALASCLSMIRKPF-CQD 195
            D   W     +F   + D  + +PL   ++  +   P    +     +S+  KP+   +
Sbjct: 153 HDGW-WPETEKAFATMTADMFKGSPLEDAYKALSP-HPEKFNEFFTKTMSIDLKPYDWTE 210

Query: 196 DLYRIDVPVLIAVGSQDDL 214
           D+ ++D+P+L+ +G  D +
Sbjct: 211 DVRKMDIPILMLLGDADGI 229


>gi|312960496|ref|ZP_07775003.1| acetoin dehydrogenase, dihydrolipoamide acetyltransferase component
           [Pseudomonas fluorescens WH6]
 gi|311285230|gb|EFQ63804.1| acetoin dehydrogenase, dihydrolipoamide acetyltransferase component
           [Pseudomonas fluorescens WH6]
          Length = 361

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + D+G+   P ++L+HG    +  NWLF+   Q       RVIA D  GHG+S K     
Sbjct: 117 YLDLGEGATP-LVLVHGFGGDL-NNWLFN---QPALAAERRVIALDLPGHGESGKLLQTG 171

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D   +  A   ++LL+HL + +VH+ G+SMG  ++ ++    P  V S+IL
Sbjct: 172 DAEELSQAV--LALLDHLQLERVHLAGHSMGGLVSLTLASQAPERVASLIL 220


>gi|290959542|ref|YP_003490724.1| hydrolase [Streptomyces scabiei 87.22]
 gi|260649068|emb|CBG72182.1| putative hydrolase [Streptomyces scabiei 87.22]
          Length = 285

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 104/242 (42%), Gaps = 38/242 (15%)

Query: 27  PTILLIHGLASSVQTNWLFSG-WIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
           P +LL+HGL     ++W  +  W+     +  R +A D  GHG+S K       R  ++ 
Sbjct: 33  PGVLLLHGLMGRA-SHWAPTARWLS----ERHRAVALDQRGHGRSAKPEQAAYTREAYVE 87

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV-GSVLYDSDVVDWQ 144
            DA + +E LG+  V ++G++MGA  A  +    P  VR +I+  +  S L  +   +W+
Sbjct: 88  -DAEAAVEQLGLGPVVLIGHAMGALTAWQLAARRPDLVRGLIICDMRASALGAASQREWE 146

Query: 145 SLIDSFLLP-----------SIDE--VQNPLGKKFRKFADL------------DPGNDLK 179
           +   ++ LP             D+  V+ P   +   +A++            DP   LK
Sbjct: 147 NWFKAWPLPFATLADVRKWFGEDDPWVERPSPSRGEFYAEVMHEGPDGWRPVFDPEQMLK 206

Query: 180 ALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSSQYLNICRRDH 238
              + +         ++L ++  P L+  G   +L     QE++  +P  QY  +    H
Sbjct: 207 TRETWVYDAH----WEELTQVRCPALVVRGLDGELGRAESQEMVRVLPHGQYAEVADAGH 262

Query: 239 LL 240
           L+
Sbjct: 263 LV 264


>gi|226363256|ref|YP_002781038.1| hydrolase [Rhodococcus opacus B4]
 gi|226241745|dbj|BAH52093.1| putative hydrolase [Rhodococcus opacus B4]
          Length = 260

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 102/231 (44%), Gaps = 26/231 (11%)

Query: 27  PTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           P +L++HG+  S  +   F+     L     R++A+D  G+G+S+      D      AA
Sbjct: 11  PALLMLHGIGGSADS---FAPQFDELAGS-LRLLAWDAPGYGRSEDPGRPFDLDDYADAA 66

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG--VGSVLYDSDVVDWQ 144
             V + +  G +  HV+G S G  IA  + + +P  VRS++LG   VGS   D      +
Sbjct: 67  ADV-IRDRCGDAGAHVLGMSWGGVIATRLAMRHPGLVRSLLLGSSTVGSGSDDEAAARMR 125

Query: 145 SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDL--KALASCLSMIRKP---FCQD---- 195
           S I        D  Q    ++  +      G+DL  KA A   + IR P   +  +    
Sbjct: 126 SRISVL---EQDGAQAFAAERAPRLMSGSAGDDLVAKATAIMAASIRLPGYGYAAESMAA 182

Query: 196 -----DLYRIDVPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHL 239
                DL +ID+P L+  G +D + G P  Q L   IP + ++ I    HL
Sbjct: 183 TDHTADLPKIDIPTLVLSGDEDGVTGVPASQVLAGGIPGAVFVTIRGAGHL 233


>gi|269956421|ref|YP_003326210.1| alpha/beta hydrolase fold protein [Xylanimonas cellulosilytica DSM
           15894]
 gi|269305102|gb|ACZ30652.1| alpha/beta hydrolase fold protein [Xylanimonas cellulosilytica DSM
           15894]
          Length = 229

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 62/116 (53%), Gaps = 9/116 (7%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDK 72
           + A++  G + AP ++L+HG+ ++       S W  +  D  +  R++  D  GHG S +
Sbjct: 9   RIAYHLRGTEGAPVLVLLHGMGAASDA----SSWAPVAEDLARDHRLVVPDLRGHGDSGR 64

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
                 Y L  MA D  +LL+ LG+ +  V+G+SMG  +A ++ L  P  V ++++
Sbjct: 65  P---GTYTLAEMADDVAALLDRLGVERATVVGHSMGGLVAIALTLARPDLVEALVV 117


>gi|94313598|ref|YP_586807.1| 3-oxoadipate enol-lactonase [Cupriavidus metallidurans CH34]
 gi|93357450|gb|ABF11538.1| 3-oxoadipate enol-lactonase [Cupriavidus metallidurans CH34]
          Length = 259

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 94/221 (42%), Gaps = 31/221 (14%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           Q FRV+ +D  GHG+S  +     Y +  +  D + LL+HLG+ +VH  G SMG      
Sbjct: 46  QHFRVLRYDTRGHGESGVT--PGPYSIAQLGGDVIGLLDHLGLQRVHFCGLSMGGITGMW 103

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQ----------------SLIDSFLLPSIDEV 158
           + L +   +  ++L    +  Y     +W                 +++D +L P     
Sbjct: 104 LALHHADRLNRLVL--CNTAAYIGPPENWTNRAALVEREGMAAITAAVVDKWLTPDFSAQ 161

Query: 159 QNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP 218
           Q  L ++ +    L   +     A+CL+ +R    + ++ RI  P L+  GS  D+   P
Sbjct: 162 QPELVQRLQTM--LGATSPSGYAANCLA-VRDSDLRAEIQRIQTPTLVIAGS-GDIPTPP 217

Query: 219 QE---LMSFIPSSQYLNI--CRRDHLLAVGDKQFKQGVVNF 254
            +   L   IP ++Y  +      +L  V  + F Q V+ F
Sbjct: 218 ADGRYLADTIPGARYTELYAAHLSNLQQV--EGFTQAVLTF 256


>gi|261220475|ref|ZP_05934756.1| beta-ketoadipate enol-lactone hydrolase [Brucella ceti B1/94]
 gi|265996175|ref|ZP_06108732.1| beta-ketoadipate enol-lactone hydrolase [Brucella ceti M490/95/1]
 gi|260919059|gb|EEX85712.1| beta-ketoadipate enol-lactone hydrolase [Brucella ceti B1/94]
 gi|262550472|gb|EEZ06633.1| beta-ketoadipate enol-lactone hydrolase [Brucella ceti M490/95/1]
          Length = 253

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 97/238 (40%), Gaps = 31/238 (13%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRV--IAFDNLGHGKSDKSYIENDYRL 81
            D P ++ I+ L +       F  W ++    G  V  + +D  GHG SD    +  Y +
Sbjct: 6   NDKPVLVFINSLGTD------FRIWNKVRARLGHDVSTLVYDKRGHGLSDIG--KTPYTI 57

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +A D ++LL+ L I K  + G S+G  IA  +    P  V  ++L      +   ++ 
Sbjct: 58  ELLAQDLIALLDRLSIHKAVICGLSVGGLIAQGLYAARPDLVAGLVLSNTAHKIGTPEM- 116

Query: 142 DWQSLIDSFLLPSIDEV-------------QNPLGKKFRKFADLDPGNDLKALASCLSMI 188
            W + ID+ +   +  +             + P    ++ + ++     L+  A+  S +
Sbjct: 117 -WNARIDAIMQNGLASILDATMPRWFTAAYRRPDNAAYQAYCNMFTRQPLEGYAATCSAL 175

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRDHLLAV 242
           R        ++I VPV    G QD    +P    QEL S IP + +  I    H+  V
Sbjct: 176 RDADFTAAAHKISVPVRCVAGDQD--GSTPPTLVQELASLIPGAVFSQIANSGHIPCV 231


>gi|89107221|ref|AP_001001.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli str. K-12 substr. W3110]
 gi|90111115|ref|NP_414883.4| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli str. K-12 substr. MG1655]
 gi|170080924|ref|YP_001730244.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli str. K-12 substr. DH10B]
 gi|300947996|ref|ZP_07162139.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           116-1]
 gi|300954105|ref|ZP_07166576.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           175-1]
 gi|301645731|ref|ZP_07245653.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           146-1]
 gi|12644343|sp|P77044|MHPC_ECOLI RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|254810990|sp|B1XBJ6|MHPC_ECODH RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|85674491|dbj|BAE76131.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli str. K12 substr. W3110]
 gi|87081721|gb|AAC73452.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli str. K-12 substr. MG1655]
 gi|169888759|gb|ACB02466.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli str. K-12 substr. DH10B]
 gi|300318895|gb|EFJ68679.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           175-1]
 gi|300452433|gb|EFK16053.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           116-1]
 gi|301076011|gb|EFK90817.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           146-1]
 gi|315616686|gb|EFU97303.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 3431]
          Length = 293

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SVVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLKWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|300813526|ref|ZP_07093860.1| hydrolase, alpha/beta domain protein [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|300512362|gb|EFK39528.1| hydrolase, alpha/beta domain protein [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 238

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 86/187 (45%), Gaps = 19/187 (10%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
              ++L+HG   + + +  F   I+    + F+VIA D  GHGKSD   I+       ++
Sbjct: 21  GEALILLHG---NGENSHYFDKQIRDFA-KYFKVIAIDTRGHGKSDP--IKEKLTFEDLS 74

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQS 145
            D + +L  L I K +++G+S GA IA      YPS ++ +IL        + D +    
Sbjct: 75  RDLLDILNFLKIDKANILGFSDGANIALVFAKNYPSRIKKLILNSPNK---NVDQIKLLP 131

Query: 146 LIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVL 205
            I SF+   + ++ + L K+FR        N     +     I+      D  +ID PVL
Sbjct: 132 RIFSFIFYYLLKIVSNLCKRFR--------NYFSVYSLIFDTIK--IKDSDFKKIDFPVL 181

Query: 206 IAVGSQD 212
           I  G++D
Sbjct: 182 IIAGAKD 188


>gi|327254663|gb|EGE66279.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli STEC_7v]
          Length = 289

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 23  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 80

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 81  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 139

Query: 131 VGS 133
            G+
Sbjct: 140 GGT 142


>gi|1665748|dbj|BAA13054.1| MhpC [Escherichia coli W3110]
          Length = 293

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SVVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLKWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|329928579|ref|ZP_08282446.1| hydrolase, alpha/beta domain protein [Paenibacillus sp. HGF5]
 gi|328937695|gb|EGG34104.1| hydrolase, alpha/beta domain protein [Paenibacillus sp. HGF5]
          Length = 263

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 88/206 (42%), Gaps = 32/206 (15%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           ++L+HG   S         W Q+L   QGFRVI  D  GHG+SD       Y +  MA D
Sbjct: 22  VILLHGFCGSSAY------WEQVLPYLQGFRVIVPDLRGHGRSDAPM--GSYTIEQMADD 73

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY-DSDVVDWQ-- 144
            + L++ L I K  ++G+S+G  IA S    Y S +     G + S  Y DSD    +  
Sbjct: 74  VLLLMDELDIPKAALLGHSLGGYIALSFAQRYASRLNG--FGLIHSTGYPDSDEAKEKRV 131

Query: 145 ----------------SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI 188
                            L+     P   E +    ++ ++   L P     A+ + L+M 
Sbjct: 132 KAVSTIQGEGITAFVDGLVPGLFAPDTKETKPECIQRAKEIGYLTPPQG--AIGAALAMR 189

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDL 214
            +P  +D L    +P+L+  G +D L
Sbjct: 190 ERPDRRDVLSASTLPILLVAGEKDGL 215


>gi|301025501|ref|ZP_07189048.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           69-1]
 gi|300396016|gb|EFJ79554.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           69-1]
          Length = 293

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|229589890|ref|YP_002872009.1| non-heme chloroperoxidase [Pseudomonas fluorescens SBW25]
 gi|229361756|emb|CAY48638.1| non-heme chloroperoxidase [Pseudomonas fluorescens SBW25]
          Length = 272

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 84/192 (43%), Gaps = 32/192 (16%)

Query: 49  IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMG 108
           ++ L  +GFR +AFD  G G+SD+ +  NDY     A D   L+EHL +  V ++G+SMG
Sbjct: 40  MEYLSSRGFRTLAFDRRGFGRSDQPWTGNDYDT--FADDIAQLIEHLDLKDVTLVGFSMG 97

Query: 109 -------------ARIACSMVLF-----------YPSYVRSVILGGVGSVLYDSDVVDWQ 144
                        AR+A  ++L            YP  V + +  G+ + L    + D  
Sbjct: 98  GGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPTEVFDGIKAGL----LKDRA 153

Query: 145 SLIDSFLLP--SIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDV 202
             I  F  P   I++ Q        +   +     LK+   C++   +   + D+ +IDV
Sbjct: 154 QFIADFNTPFFGINKGQTVSAGVLTQTLQIALLASLKSTVDCVTAFSETDFRPDMAKIDV 213

Query: 203 PVLIAVGSQDDL 214
           P L+  G  D +
Sbjct: 214 PTLVIHGDGDQI 225


>gi|220918229|ref|YP_002493533.1| alpha/beta hydrolase fold protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219956083|gb|ACL66467.1| alpha/beta hydrolase fold protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 344

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 54/104 (51%), Gaps = 10/104 (9%)

Query: 28  TILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           T+LL+HG       N+    W   I  L   GFRVIA D +G GKS K      +  V +
Sbjct: 81  TVLLLHG------KNFHAGTWADTIAALNRAGFRVIAPDQIGFGKSSKPE-RYQFSFVQL 133

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           AA+  +LL  LGI++  V+G+SMG  +A    L YP     ++L
Sbjct: 134 AANTRALLASLGIARTAVVGHSMGGMLAVRYALEYPDATERLLL 177


>gi|323965299|gb|EGB60757.1| alpha/beta hydrolase [Escherichia coli M863]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|154252017|ref|YP_001412841.1| alpha/beta hydrolase fold protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154155967|gb|ABS63184.1| alpha/beta hydrolase fold [Parvibaculum lavamentivorans DS-1]
          Length = 363

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 68/121 (56%), Gaps = 9/121 (7%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G +DAP ++L+HG ++    ++++  + + L + G+RV+A+DN G G SD+     D  L
Sbjct: 63  GPEDAPLVVLVHGFSTP---SFVWDNYFKPLTESGYRVLAYDNFGRGLSDRPRAVYDAEL 119

Query: 82  VFMAADAVSLLEHLGI-SKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GGVGSVLYD 137
             +    V+LL+ L +  ++ ++GYSMG  IA      +   VRS+ L    G+G  + D
Sbjct: 120 --LDRQLVNLLDALKVDRRIDLVGYSMGGAIATIFTARHTERVRSLTLIAPAGLGVAMDD 177

Query: 138 S 138
           +
Sbjct: 178 N 178


>gi|61680029|pdb|1U2E|A Chain A, Crystal Structure Of The C-C Bond Hydrolase Mhpc
 gi|61680030|pdb|1U2E|B Chain B, Crystal Structure Of The C-C Bond Hydrolase Mhpc
 gi|61680031|pdb|1U2E|C Chain C, Crystal Structure Of The C-C Bond Hydrolase Mhpc
 gi|61680032|pdb|1U2E|D Chain D, Crystal Structure Of The C-C Bond Hydrolase Mhpc
 gi|1702883|emb|CAA70749.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli K-12]
          Length = 289

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 23  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 80

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 81  D-SVVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLKWPERVGKLVLMG 139

Query: 131 VGS 133
            G+
Sbjct: 140 GGT 142


>gi|217973411|ref|YP_002358162.1| alpha/beta hydrolase fold protein protein [Shewanella baltica
           OS223]
 gi|217498546|gb|ACK46739.1| alpha/beta hydrolase fold protein [Shewanella baltica OS223]
          Length = 258

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 7/117 (5%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           V     P +LLIHGL  ++       G  Q+L  Q ++VI  D   HG S+  + E DY 
Sbjct: 4   VSTGQGPAVLLIHGLFGNLDN---LKGLGQVLESQ-YQVIRVDVPNHGLSEH-WDEMDYP 58

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
              +A   VSLL+ L I + H++G+SMG +IA +  L +P  + S++   +  V Y+
Sbjct: 59  R--LATAMVSLLDELAIERAHIVGHSMGGKIAMATALAHPERIISMVAADIAPVAYE 113


>gi|261409315|ref|YP_003245556.1| alpha/beta hydrolase fold protein [Paenibacillus sp. Y412MC10]
 gi|261285778|gb|ACX67749.1| alpha/beta hydrolase fold protein [Paenibacillus sp. Y412MC10]
          Length = 263

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 88/206 (42%), Gaps = 32/206 (15%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCD-QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           ++L+HG   S         W Q+L   QGFRVI  D  GHG+SD       Y +  MA D
Sbjct: 22  VILLHGFCGSSAY------WEQVLPYLQGFRVIVPDLRGHGRSDAPM--GSYTIEQMADD 73

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLY-DSDVVDWQ-- 144
            + L++ L I K  ++G+S+G  IA S    Y S +     G + S  Y DSD    +  
Sbjct: 74  VLLLMDELDIPKAALLGHSLGGYIALSFAQRYASRLNG--FGLIHSTGYPDSDEAKEKRV 131

Query: 145 ----------------SLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMI 188
                            L+     P   E +    ++ ++   L P     A+ + L+M 
Sbjct: 132 KAVSTIQGEGITAFVDGLVPGLFAPDTKETKPECIQRAKEIGYLTPPQG--AIGAALAMR 189

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDL 214
            +P  +D L    +P+L+  G +D L
Sbjct: 190 ERPDRRDVLSASTLPILLVAGEKDGL 215


>gi|170021271|ref|YP_001726225.1| alpha/beta hydrolase fold [Escherichia coli ATCC 8739]
 gi|170683466|ref|YP_001742483.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli SMS-3-5]
 gi|191169394|ref|ZP_03031136.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B7A]
 gi|194438907|ref|ZP_03070992.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 101-1]
 gi|253774662|ref|YP_003037493.1| alpha/beta hydrolase fold protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|256020325|ref|ZP_05434190.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Shigella sp.
           D9]
 gi|293403472|ref|ZP_06647563.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli FVEC1412]
 gi|293408499|ref|ZP_06652338.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B354]
 gi|293418422|ref|ZP_06660857.1| hypothetical protein ECCG_03305 [Escherichia coli B088]
 gi|298379084|ref|ZP_06988965.1| hypothetical protein ECFG_04492 [Escherichia coli FVEC1302]
 gi|307312267|ref|ZP_07591903.1| alpha/beta hydrolase fold protein [Escherichia coli W]
 gi|331666699|ref|ZP_08367573.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli TA271]
 gi|169756199|gb|ACA78898.1| alpha/beta hydrolase fold [Escherichia coli ATCC 8739]
 gi|170521184|gb|ACB19362.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli SMS-3-5]
 gi|190900575|gb|EDV60382.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B7A]
 gi|194422201|gb|EDX38203.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli 101-1]
 gi|253325706|gb|ACT30308.1| alpha/beta hydrolase fold protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|291324950|gb|EFE64365.1| hypothetical protein ECCG_03305 [Escherichia coli B088]
 gi|291429325|gb|EFF02345.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli FVEC1412]
 gi|291471677|gb|EFF14160.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B354]
 gi|298280197|gb|EFI21701.1| hypothetical protein ECFG_04492 [Escherichia coli FVEC1302]
 gi|306907769|gb|EFN38271.1| alpha/beta hydrolase fold protein [Escherichia coli W]
 gi|315059636|gb|ADT73963.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli W]
 gi|323379801|gb|ADX52069.1| alpha/beta hydrolase fold protein [Escherichia coli KO11]
 gi|323938538|gb|EGB34787.1| alpha/beta hydrolase [Escherichia coli E1520]
 gi|323963340|gb|EGB58902.1| alpha/beta hydrolase [Escherichia coli H489]
 gi|323972373|gb|EGB67582.1| alpha/beta hydrolase [Escherichia coli TA007]
 gi|324117076|gb|EGC10988.1| alpha/beta hydrolase [Escherichia coli E1167]
 gi|331065923|gb|EGI37807.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli TA271]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|323976168|gb|EGB71261.1| alpha/beta hydrolase [Escherichia coli TW10509]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|300903388|ref|ZP_07121316.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           84-1]
 gi|301301495|ref|ZP_07207630.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           124-1]
 gi|300404683|gb|EFJ88221.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           84-1]
 gi|300842992|gb|EFK70752.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           124-1]
 gi|315256170|gb|EFU36138.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           85-1]
          Length = 293

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLKWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|325528267|gb|EGD05433.1| 3-oxoadipate enol-lactonase [Burkholderia sp. TJI49]
          Length = 261

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 97/222 (43%), Gaps = 21/222 (9%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           DAP ++  + L + +Q   +++  I+    Q F V+ +D  GHG SD       Y +  +
Sbjct: 22  DAPWLVFSNSLGADLQ---MWAPQIRPFT-QHFNVLRYDTRGHGHSDAP--AGSYTIDQL 75

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV---- 140
           A D + LL+HL I++ H  G SMG     ++   +PS +   +L    + +   +V    
Sbjct: 76  AGDVIGLLDHLDIARAHFCGISMGGLTGAALAARFPSRIERAVLANTAAKIGSPEVWAPR 135

Query: 141 -----VDWQSLIDSFLLPS--IDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFC 193
                 +  + +   +LP    D       + F    D     D    A+    +     
Sbjct: 136 AQKARAEGMAALADAVLPRWFTDAFVGREPRLFDAIRDTFVHTDKDGYAANCDALNAADL 195

Query: 194 QDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLN 232
           ++++ RI +PVL+  G+  D++  P +   L + IP ++++ 
Sbjct: 196 REEVKRIALPVLVVTGAH-DMSTPPDQGRALAAAIPGARHVE 236


>gi|38703860|ref|NP_308431.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. Sakai]
 gi|254791530|ref|YP_003076367.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. TW14359]
 gi|190359871|sp|Q8X5K0|MHPC_ECO57 RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|254590930|gb|ACT70291.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. TW14359]
          Length = 293

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|115495833|ref|NP_001069002.1| epoxide hydrolase 2 [Bos taurus]
 gi|109659347|gb|AAI18307.1| Epoxide hydrolase 2, cytoplasmic [Bos taurus]
          Length = 555

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F ++G    P + L HG   S   +W +   I  L   GFRV+A D  G+G+S       
Sbjct: 252 FVELGS--GPVVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLAVDMKGYGESSAPPEIE 306

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           +Y L  ++ D ++ L+ LGIS+   +G+  G  +  ++ LF+P  VR+V
Sbjct: 307 EYSLEVLSKDMITFLDKLGISQAVFIGHDWGGMLVWTIALFHPERVRAV 355


>gi|53987058|gb|AAV27304.1| lactonohydrolase [Acinetobacter calcoaceticus]
          Length = 276

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 92/226 (40%), Gaps = 39/226 (17%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + D G +DAP I   HG   S   +W     +     +GFRV+A D  GHG+S + +  +
Sbjct: 14  YKDWGPRDAPVIFFHHGWPLS-SDDW--DAQMLFFLKEGFRVVAHDRRGHGRSTQVWDGH 70

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS--YVRSVILGGVGSVL 135
           D  +   A D  +++EHLG+     +G+S G       V  YP+    ++V++  V  ++
Sbjct: 71  D--MDHYADDVAAVVEHLGVQGAVHVGHSTGGGEVAYYVARYPNDPVAKAVLISAVPPLM 128

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP---- 191
                V  +S  D       D++QN L K   +F    P           + + +P    
Sbjct: 129 -----VKTESNPDGLPKEVFDDLQNQLFKNRSQFYHDVPAGPFYGFNRPGAKVSEPVVLN 183

Query: 192 -------------------FCQDD----LYRIDVPVLIAVGSQDDL 214
                              F Q D    L +I+VPVLI  G  D +
Sbjct: 184 WWRQGMMGGAKAHYDGIVAFSQTDFTEALKKIEVPVLILHGEDDQV 229


>gi|296484555|gb|DAA26670.1| epoxide hydrolase 2, cytoplasmic [Bos taurus]
          Length = 555

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F ++G    P + L HG   S   +W +   I  L   GFRV+A D  G+G+S       
Sbjct: 252 FVELGS--GPVVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLAVDMKGYGESSAPPEIE 306

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           +Y L  ++ D ++ L+ LGIS+   +G+  G  +  ++ LF+P  VR+V
Sbjct: 307 EYSLEVLSKDMITFLDKLGISQAVFIGHDWGGMLVWTIALFHPERVRAV 355


>gi|256024027|ref|ZP_05437892.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia sp.
           4_1_40B]
 gi|301021036|ref|ZP_07185080.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           196-1]
 gi|307136996|ref|ZP_07496352.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli H736]
 gi|260450459|gb|ACX40881.1| alpha/beta hydrolase fold protein [Escherichia coli DH1]
 gi|299881675|gb|EFI89886.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           196-1]
 gi|315135033|dbj|BAJ42192.1| 2-hydroxy-6-ketonona-2,4-dienedioic acidhydrolase [Escherichia coli
           DH1]
 gi|323943320|gb|EGB39475.1| alpha/beta hydrolase [Escherichia coli E482]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SVVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLKWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|323528703|ref|YP_004230855.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1001]
 gi|323385705|gb|ADX57795.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1001]
          Length = 292

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 101/230 (43%), Gaps = 40/230 (17%)

Query: 25  DAPTILL-IHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
           D P  L+ IHG+ S ++    + G I  L   GFRV+ FD  GHG+S  S ++  Y +  
Sbjct: 31  DGPRALICIHGVGSYLEA---WQGAINEL-GTGFRVLTFDLRGHGRS--SLVKGRYEIDD 84

Query: 84  MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILGGVGSVLYDSDV-- 140
              D ++L +HLG  + ++ G+S+G  IA  + L +P  + R V+L  V     D     
Sbjct: 85  FVGDVLALADHLGFDRFNLAGFSLGGLIAQRLALTHPERLERLVLLSTVAGRTPDERTRV 144

Query: 141 -------------VDWQSLIDSFLLPSIDEVQ-NPLGKKFRKFADLDPGNDLKALASCLS 186
                          + + +  +L     E   N + +  R+ A  DP         C +
Sbjct: 145 LARLAALQAGDRGSHYDASLSRWLTEEFQEAHPNLIAELRRRNAQNDP--------DCYA 196

Query: 187 MIRKPFCQDD----LYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQ 229
              +   Q D    + +I VP LI  G +DDL  +P+    +   IP+S+
Sbjct: 197 SAYRVLAQTDFGGLIDQIPVPTLIVTG-EDDLGSNPRMSLFMHECIPNSR 245


>gi|218530013|ref|YP_002420829.1| alpha/beta hydrolase fold protein [Methylobacterium
           chloromethanicum CM4]
 gi|317412038|sp|B7KWT4|RUTD_METC4 RecName: Full=Putative aminoacrylate hydrolase RutD; AltName:
           Full=Aminohydrolase
 gi|218522316|gb|ACK82901.1| alpha/beta hydrolase fold protein [Methylobacterium
           chloromethanicum CM4]
          Length = 260

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 61/104 (58%), Gaps = 6/104 (5%)

Query: 28  TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAAD 87
           T+LL  GL  S      F+  + +L ++ FRV+ +D+ G G+S  S +E  + +  MA D
Sbjct: 17  TVLLSPGLGGSAH---YFAPQVPVLAER-FRVVTYDHRGTGRS-PSPLEPGHDIAAMARD 71

Query: 88  AVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILGG 130
            ++LL+HLGI    ++G+++G  IA  + L +P  V R V++ G
Sbjct: 72  VLALLDHLGIGTADIVGHALGGLIALQLALTHPERVGRIVVING 115


>gi|148656459|ref|YP_001276664.1| alpha/beta hydrolase fold protein [Roseiflexus sp. RS-1]
 gi|148568569|gb|ABQ90714.1| alpha/beta hydrolase fold [Roseiflexus sp. RS-1]
          Length = 315

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (48%), Gaps = 12/127 (9%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
           V+ F    +Y   + D G +DAP +LLIHG A+              L   G RV+  D 
Sbjct: 36  VQHFVRVGEYDLHYTDEGPRDAPVVLLIHGFAAWAFAWRAQR---SALIAAGRRVVTIDM 92

Query: 65  LGHGKSDKS----YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
           +G+G S +     Y  +D  L+ + A     L+ LGI+   V+G+S G R+A  + L  P
Sbjct: 93  IGYGASSRPAAPVYSTHDQALLILQA-----LDILGITTFDVVGHSFGGRVAFQVALLAP 147

Query: 121 SYVRSVI 127
             VR+++
Sbjct: 148 ERVRTIV 154


>gi|296140584|ref|YP_003647827.1| alpha/beta hydrolase fold protein [Tsukamurella paurometabola DSM
           20162]
 gi|296028718|gb|ADG79488.1| alpha/beta hydrolase fold protein [Tsukamurella paurometabola DSM
           20162]
          Length = 308

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 54/106 (50%), Gaps = 16/106 (15%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI------------- 75
           +LL+ GLA  + T W    ++  L   GFRVI  DN   G+S  + +             
Sbjct: 30  VLLVAGLAEDL-TTW-SDRFVSALVATGFRVIRMDNRDCGRSSYATMPPPNMLRQLAARP 87

Query: 76  -ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP 120
             + Y L  MAADA  L++HLG+  VH++G SMG  IA ++   YP
Sbjct: 88  RRDAYTLADMAADAAQLIDHLGVGPVHLVGRSMGGMIAQTVAARYP 133


>gi|254447873|ref|ZP_05061338.1| hypothetical protein GP5015_162 [gamma proteobacterium HTCC5015]
 gi|198262653|gb|EDY86933.1| hypothetical protein GP5015_162 [gamma proteobacterium HTCC5015]
          Length = 303

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (48%), Gaps = 30/129 (23%)

Query: 3   NEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAF 62
           NE++ +         + D+G +  P +LL+ G+  SVQ         + L DQGFRVI F
Sbjct: 9   NEIELY---------YEDLGRQGDPAVLLVCGM--SVQLIEWPDSLCRHLVDQGFRVIRF 57

Query: 63  DNLGHGKSDKSYIEN-------------------DYRLVFMAADAVSLLEHLGISKVHVM 103
           DN   G S +S ++                    DY L  +  DAV+LL+HL I+K H +
Sbjct: 58  DNREAGLSSRSTVKQAPPIIRSYYRYKRGLPVKADYPLRQLMRDAVALLDHLDIAKAHWV 117

Query: 104 GYSMGARIA 112
           G+SMG  I+
Sbjct: 118 GFSMGGMIS 126


>gi|331645529|ref|ZP_08346633.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli M605]
 gi|331045691|gb|EGI17817.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli M605]
          Length = 309

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 43  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 101 D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 159

Query: 131 VGS 133
            G+
Sbjct: 160 GGT 162


>gi|193065157|ref|ZP_03046230.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli E22]
 gi|194430326|ref|ZP_03062818.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B171]
 gi|192927131|gb|EDV81752.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli E22]
 gi|194411632|gb|EDX27962.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli B171]
 gi|320201594|gb|EFW76170.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli EC4100B]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSMAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|163845730|ref|YP_001633774.1| alpha/beta hydrolase fold-containing protein [Chloroflexus
           aurantiacus J-10-fl]
 gi|222523435|ref|YP_002567905.1| alpha/beta hydrolase fold protein [Chloroflexus sp. Y-400-fl]
 gi|163667019|gb|ABY33385.1| alpha/beta hydrolase fold-containing protein [Chloroflexus
           aurantiacus J-10-fl]
 gi|222447314|gb|ACM51580.1| alpha/beta hydrolase fold protein [Chloroflexus sp. Y-400-fl]
          Length = 335

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 113/261 (43%), Gaps = 54/261 (20%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + DVG  D   ++LIHG   S   ++ +   +  L   G+RVI++D  GHG SD    +N
Sbjct: 71  YQDVGPSDGQPLVLIHGWDCS---SFWWHHVVDPLAQAGYRVISYDLKGHGFSDTDPRQN 127

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
            Y +   +AD  +L+  L +  VH+  +S+GA +   +   +P  VRS+I      + Y+
Sbjct: 128 -YTVAGFSADLQALIRALDLGAVHLAAFSLGAFVGLHVAAHHPDMVRSLIFFNFSLLPYN 186

Query: 138 S----------DVVD-------------WQSLIDSFLL-----PSIDEVQ-NPLGKKFRK 168
                      DVV              W   I + L+     PSI +++   LG ++  
Sbjct: 187 KLASAFVPRLLDVVFNRVLRPIERRNLWWLPFIYARLVMAQHTPSISDIRLGTLGLRYCD 246

Query: 169 FA-------DLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL--AGSPQ 219
            A       +L     L A+A    MIR+            P+L+  G+ D +      +
Sbjct: 247 PAAVRVSATELSRPEILNAVAEQARMIRQ------------PLLLVAGANDPIMRPADGR 294

Query: 220 ELMSFIPSSQYLNICRRDHLL 240
           +L++  P+  +L + +  HL+
Sbjct: 295 KLVALTPNGSFLEVPKCGHLI 315


>gi|78063972|ref|YP_373880.1| Alpha/beta hydrolase [Burkholderia sp. 383]
 gi|77971857|gb|ABB13236.1| 3-oxoadipate enol-lactonase [Burkholderia sp. 383]
          Length = 261

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 99/222 (44%), Gaps = 21/222 (9%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           DAP ++  + L + +Q   +++  I+ L  Q F V+ +D  GHG SD       Y +  +
Sbjct: 22  DAPWLVFSNSLGADLQ---MWAPQIRPLT-QHFNVLRYDTRGHGHSDAP--AGSYTVEQL 75

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDV---- 140
           A D + LL+H+GI++ H  G SMG     ++   +P+ +   +L    + +   +V    
Sbjct: 76  AGDVIGLLDHVGIARAHFCGISMGGLTGAALAARFPTRIVRAVLSNTAAKIGSPEVWAPR 135

Query: 141 -----VDWQSLIDSFLLPS--IDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFC 193
                 +  + +   +LP    D       + F    D     D    A+    +     
Sbjct: 136 AQKARAEGMAALADAVLPRWFTDAFVEREPRLFDAIRDTFVHTDKDGYAANCDALNAADL 195

Query: 194 QDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLN 232
           ++++  I +PVL+  G++ D++  P +   L + IP +Q++ 
Sbjct: 196 REEVKGIALPVLVVTGAK-DMSTPPDQGRALAAAIPGAQHVE 236


>gi|323945532|gb|EGB41586.1| alpha/beta hydrolase [Escherichia coli H120]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|326801100|ref|YP_004318919.1| alpha/beta hydrolase [Sphingobacterium sp. 21]
 gi|326551864|gb|ADZ80249.1| alpha/beta hydrolase fold protein [Sphingobacterium sp. 21]
          Length = 258

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 23  DKDAP-TILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           +KDAP TI+LIHG+ S++   +     I  +  + F VI +D   HG S  S +++ YR 
Sbjct: 17  NKDAPQTIVLIHGMFSNLSVYYF---RIAPILAKYFHVIMYDLKSHGLS--SRVDHGYRF 71

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
             M+ D + L++ L + KVH++GYS G  +A +  L YPS +
Sbjct: 72  DDMSYDLIDLMDTLMLEKVHLVGYSFGGLVALNTCLKYPSRI 113


>gi|326488687|dbj|BAJ97955.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 373

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 43/74 (58%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           +G  V  FDN G G+S     ++ Y    MA DA++L++HLG  K HV G+SMGA I+C 
Sbjct: 50  EGIEVCCFDNRGVGRSSILPHKSYYSTAIMARDALALMDHLGWKKAHVFGHSMGAMISCK 109

Query: 115 MVLFYPSYVRSVIL 128
           +    P  + S+ L
Sbjct: 110 LAAMAPHRLSSLAL 123


>gi|187776464|ref|ZP_02802909.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4196]
 gi|188024932|ref|ZP_02774822.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4113]
 gi|189010775|ref|ZP_02809258.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4076]
 gi|189402209|ref|ZP_02780944.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4401]
 gi|189403103|ref|ZP_02793295.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4486]
 gi|189404008|ref|ZP_02786491.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4501]
 gi|189405449|ref|ZP_02815487.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC869]
 gi|189406295|ref|ZP_02827598.2| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC508]
 gi|195940225|ref|ZP_03085607.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4024]
 gi|208809009|ref|ZP_03251346.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4206]
 gi|208815568|ref|ZP_03256747.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4045]
 gi|208823047|ref|ZP_03263365.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4042]
 gi|209399853|ref|YP_002268990.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4115]
 gi|217324401|ref|ZP_03440485.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. TW14588]
 gi|261223829|ref|ZP_05938110.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261256037|ref|ZP_05948570.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. FRIK966]
 gi|293413604|ref|ZP_06656253.1| hypothetical protein ECDG_00145 [Escherichia coli B185]
 gi|187766959|gb|EDU30803.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4196]
 gi|188015909|gb|EDU54031.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4113]
 gi|188998551|gb|EDU67539.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4076]
 gi|189356908|gb|EDU75327.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4401]
 gi|189362379|gb|EDU80798.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4486]
 gi|189368043|gb|EDU86459.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4501]
 gi|189370059|gb|EDU88475.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC869]
 gi|189375451|gb|EDU93867.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC508]
 gi|208728810|gb|EDZ78411.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4206]
 gi|208732216|gb|EDZ80904.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4045]
 gi|208737240|gb|EDZ84924.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4042]
 gi|209161253|gb|ACI38686.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC4115]
 gi|217320622|gb|EEC29046.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. TW14588]
 gi|291433662|gb|EFF06635.1| hypothetical protein ECDG_00145 [Escherichia coli B185]
 gi|320192759|gb|EFW67399.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. EC1212]
 gi|320638532|gb|EFX08243.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. G5101]
 gi|320644098|gb|EFX13178.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H- str. 493-89]
 gi|320649381|gb|EFX17932.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H- str. H 2687]
 gi|320656823|gb|EFX24703.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O55:H7 str. 3256-97 TW 07815]
 gi|320665337|gb|EFX32427.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. LSU-61]
 gi|326341107|gb|EGD64899.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. 1044]
 gi|326346118|gb|EGD69857.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O157:H7 str. 1125]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|26990356|ref|NP_745781.1| alpha/beta fold family hydrolase [Pseudomonas putida KT2440]
 gi|24985315|gb|AAN69245.1|AE016559_4 hydrolase, alpha/beta fold family [Pseudomonas putida KT2440]
          Length = 292

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 115/249 (46%), Gaps = 37/249 (14%)

Query: 17  AFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           ++ DVG      ++LIHG+  + +   ++ G    L +  +RVIA+D LGHG+S      
Sbjct: 29  SYLDVGQGQ--PVVLIHGVGLNKE---MWGGQFVGLAND-YRVIAYDMLGHGQS--RVPA 80

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS-VILGGV-GSV 134
            D  L   A     LL+HL I++  V+G+SMG  +A +  L YP  + + V+L  V    
Sbjct: 81  ADTPLEGYADQLAELLDHLQIAQATVIGFSMGGLVARAFALNYPQRLAALVVLNSVFNRT 140

Query: 135 LYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF-RKFADLDPG-----------NDLKALA 182
              S  V  ++   + L P  + V   L + F R++   +P            ND +   
Sbjct: 141 PEQSAGVIARAAQAAELGPDAN-VDAALDRWFSREYKAANPAQVAAIRQVLASNDPQGYH 199

Query: 183 SCLSMIRKPFCQDDLYRID------VPVLIAVGSQDDLAGSP---QELMSFIPSSQYLNI 233
           +  S+    F   D+YR D      VP LIA G  D    +P   ++L + IP ++ + +
Sbjct: 200 TTYSL----FATQDMYRADDLGSIQVPTLIATGELDS-GSTPAMTRQLAACIPGARSVVL 254

Query: 234 CRRDHLLAV 242
             + H++ V
Sbjct: 255 AEQRHMMPV 263


>gi|297519955|ref|ZP_06938341.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli OP50]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|289770815|ref|ZP_06530193.1| epoxide hydrolase [Streptomyces lividans TK24]
 gi|289701014|gb|EFD68443.1| epoxide hydrolase [Streptomyces lividans TK24]
          Length = 325

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 3/103 (2%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P +LL+HG   S  + W     +  L   GFR +A D  G+G+S +      YR++ + 
Sbjct: 20  GPLVLLVHGFPESWYS-WRHQ--LPALAAAGFRAVALDVRGYGRSSRPDAVEAYRMLDLV 76

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           AD V+++E LG S   V+G+  GA IA    L  P   R+V L
Sbjct: 77  ADNVAVVEALGESSAVVVGHDWGANIAAHSALLRPDVFRAVGL 119


>gi|296330062|ref|ZP_06872545.1| putative esterase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305675665|ref|YP_003867337.1| putative esterase [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296152787|gb|EFG93653.1| putative esterase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305413909|gb|ADM39028.1| putative esterase [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 282

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 114/268 (42%), Gaps = 29/268 (10%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           ++A  D     +  ++ +HG   S Q+     G   +L D  FR+I  D LGHG++D   
Sbjct: 13  RYAVTDERPDASEAVVCLHGFTGSKQSWTFLDG---MLPD--FRLIKIDCLGHGETDAPL 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG-- 132
               Y      +D   + + L + KV ++GYSMG R+A S  + +P  V +++L      
Sbjct: 68  NGRRYNTNRQVSDLAEIFDQLKLHKVKLIGYSMGGRLAYSFAVAFPERVSALVLESTTPG 127

Query: 133 ---------SVLYDSDVVDW--QSLIDSFL-----LPSIDEVQNPLGKKFR-KFADLDPG 175
                     ++ D  + D+  +  I +F+     +P     Q  L +  R +       
Sbjct: 128 LKTLEERRERIMRDRKLADFILRDGIKAFVQYWENIPLFSS-QQQLAEDIRHRIRSGRLR 186

Query: 176 NDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYL 231
           N+   LA+ L+ +    +P     +  I VP+L+  G  D       QE+   +PSS+  
Sbjct: 187 NNKIGLANSLTGMGTGSQPSLWSRVEEITVPLLLICGEWDKKFCAINQEVHKKLPSSRIE 246

Query: 232 NICRRDHLLAVGDKQFKQGVVNFYANEL 259
            + +  H + V   +F   +V+ +   L
Sbjct: 247 IVPKAGHTVHVEQPRFFGKIVSEFLTGL 274


>gi|86142349|ref|ZP_01060859.1| probable hydrolytic enzyme [Leeuwenhoekiella blandensis MED217]
 gi|85831101|gb|EAQ49558.1| probable hydrolytic enzyme [Leeuwenhoekiella blandensis MED217]
          Length = 319

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 103/234 (44%), Gaps = 48/234 (20%)

Query: 15  QFAFYDVGDKD--APTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGK 69
           + AF DV  K+     I+L+HG       N+  + W   I+ L  +GFRVI  D +G GK
Sbjct: 40  EMAFMDVKPKNYNGKNIVLLHG------KNFNGAYWRTTIEALTAEGFRVIVPDQIGFGK 93

Query: 70  SDKS-YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           S K  Y +  Y    +A +  ++L+ +G+ K  V+G+SMG  +A    L +P     +IL
Sbjct: 94  SAKPDYFQ--YTFQQLALNTKAVLDSIGVEKTAVLGHSMGGMLATRFALMFPETTEKLIL 151

Query: 129 -GGVGSVLYDSDV----VDW------------------QSLIDSFLLPSIDEVQNPLGKK 165
              +G   +   V    V+W                  +S  D    PS DE  N L   
Sbjct: 152 ENPIGLEDWKLKVPYKPVEWWYKNELKKSYSSIKNYQLESYYDGNWDPSYDEWVNLL--- 208

Query: 166 FRKFADLDPGNDLKALASCLSMIRK-PFCQDDLY---RIDVPVLIAVGSQDDLA 215
               A     +D + +A   ++  +  F Q  +Y   ++ VP L+ +G++D  A
Sbjct: 209 ----AGWTLNSDYETIAWNAALTYEMVFTQPVVYEFEKVSVPTLLIIGTRDRTA 258


>gi|331661725|ref|ZP_08362648.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli TA143]
 gi|331060147|gb|EGI32111.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli TA143]
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|193076720|gb|ABO11425.2| estB [Acinetobacter baumannii ATCC 17978]
          Length = 314

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 58/132 (43%), Gaps = 31/132 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKSDKSYIEN 77
           G  + PTILLI GL + +    LF  W    C    DQGFRVI FDN   G S K   + 
Sbjct: 35  GKPEHPTILLIMGLGAQM----LF--WPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHQG 88

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MA D   LL+ LG+S+ HV+G SMG  IA  + 
Sbjct: 89  KRLNTMKLMGRFALGLRNQGAPYTLYDMADDVSMLLDRLGVSRAHVIGASMGGMIALILA 148

Query: 117 LFYPSYVRSVIL 128
             YP  V  + L
Sbjct: 149 AKYPEKVEKLGL 160


>gi|218248040|ref|YP_002373411.1| alpha/beta hydrolase fold protein [Cyanothece sp. PCC 8801]
 gi|218168518|gb|ACK67255.1| alpha/beta hydrolase fold protein [Cyanothece sp. PCC 8801]
          Length = 267

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 4/117 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           + YQF +Y  G+ + P +L +HG   S +    F   I  L  + F  ++ D  GHGK+ 
Sbjct: 2   KNYQFNYYFKGNPNQPVMLFLHGFLGSCRD---FDEAIVFL-SKNFYCLSVDLPGHGKTQ 57

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
               +  Y +  +A   ++LL  L I +  ++GYSMG RIA  + L +P     VIL
Sbjct: 58  VLGGKEYYTIPKIAEGLINLLNELKIHQCLLVGYSMGGRIALYLTLHFPDRFCQVIL 114


>gi|209519059|ref|ZP_03267866.1| alpha/beta hydrolase fold [Burkholderia sp. H160]
 gi|209500501|gb|EEA00550.1| alpha/beta hydrolase fold [Burkholderia sp. H160]
          Length = 372

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 12/119 (10%)

Query: 15  QFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGK 69
           Q A+ DV     +  T++L+HG       N+  + W   I+ L D G+RVIA D +G  K
Sbjct: 87  QMAYMDVQPAHANGRTVVLLHG------KNFCAATWDATIRRLSDAGYRVIAPDQIGFCK 140

Query: 70  SDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           S K      Y    +A +  +LLE LG+S V V+G+S G  +A    L YP   + ++L
Sbjct: 141 SSKPE-HYQYSFQQLARNTHALLESLGVSDVTVVGHSTGGMLAIRYALMYPRETQQLVL 198


>gi|70729541|ref|YP_259279.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas fluorescens Pf-5]
 gi|68343840|gb|AAY91446.1| acetoin dehydrogenase E2 component, dihydrolipoamide
           acetyltransferase [Pseudomonas fluorescens Pf-5]
          Length = 370

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 61/113 (53%), Gaps = 7/113 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +++ G+   P +LL+HG    +  NWLF+         G RVIA D  GHG+S K+    
Sbjct: 125 YFERGEGGTP-LLLVHGFGGDL-NNWLFN---HEALAAGRRVIALDLPGHGESAKALQRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D  L  ++   ++LL+HL I   H++G+SMG  ++ +     P  VR++ L G
Sbjct: 180 D--LDELSQVLLALLDHLEIPVAHLVGHSMGGAVSLNTARLAPDRVRTLTLIG 230


>gi|315640210|ref|ZP_07895329.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
           [Enterococcus italicus DSM 15952]
 gi|315484042|gb|EFU74519.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
           [Enterococcus italicus DSM 15952]
          Length = 272

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 5/106 (4%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
            + AP ++ +HG   + +T   F+    LL D  +  +A D LGHG+S  +     YR  
Sbjct: 16  KEGAPVMVCVHGFTGTKKT---FAAIADLLPD--YNWLALDCLGHGESAIAIAARHYRYE 70

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            +     + ++ LG+   H++GYSMGAR+A    + YP  ++S++L
Sbjct: 71  AVIDTLAATVKSLGVDTYHLLGYSMGARLALGWAIKYPERIQSLLL 116


>gi|260842556|ref|YP_003220334.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O103:H2 str. 12009]
 gi|300924067|ref|ZP_07140062.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           182-1]
 gi|301330796|ref|ZP_07223393.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           78-1]
 gi|257757703|dbj|BAI29200.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O103:H2 str. 12009]
 gi|300419704|gb|EFK03015.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           182-1]
 gi|300843270|gb|EFK71030.1| hydrolase, alpha/beta fold family protein [Escherichia coli MS
           78-1]
 gi|323160402|gb|EFZ46351.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli E128010]
          Length = 293

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSMAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|289435007|ref|YP_003464879.1| hydrolase protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289171251|emb|CBH27793.1| hydrolase protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 276

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 108/250 (43%), Gaps = 29/250 (11%)

Query: 12  RKYQFA-FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +KY  + F+   +K  P +L++HG   +  T   +   I+ L ++ + ++A D LGHG++
Sbjct: 6   QKYHVSTFFSAEEK--PVLLMLHGFTGTSGT---YYDAIKSLKER-YNIVAPDLLGHGRT 59

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-- 128
                +  Y +     D   +L  L I +  V+GYSMG R+A      +P  V+ +IL  
Sbjct: 60  ANPDEQERYLMEHTCEDLAEILRQLEIQQCFVLGYSMGGRVATGFAASHPEKVQGLILIS 119

Query: 129 ---GGVGSV------LYDSDVVD--WQSLIDSFL-----LPSIDEVQNPLGKKFRKFADL 172
              G +  V      L D+ + D   Q+ I +F+     LP     +N    K  K    
Sbjct: 120 SSPGLLHEVDREKRMLADNQLADRIEQNGIQAFVDYWENLPLFTSQRNLPSDKQAKIRKE 179

Query: 173 DPGNDLKALASCLSMI---RKPFCQDDLYRIDVPVLIAVGSQD-DLAGSPQELMSFIPSS 228
                   LA  L  I   ++    D L     PVL+  G  D     + QE++  +P++
Sbjct: 180 RLEQKPIGLAMSLRGIGTGKQASYWDHLRNFTFPVLLITGELDAKFENTAQEMLQHLPNA 239

Query: 229 QYLNICRRDH 238
            ++ I +  H
Sbjct: 240 THVTIKQAGH 249


>gi|324997485|ref|ZP_08118597.1| alpha/beta hydrolase fold protein [Pseudonocardia sp. P1]
          Length = 314

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 5/110 (4%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G  D P ++L+HG     +  W +   +  L D G+R +A D  G+G +DK+     Y L
Sbjct: 34  GPPDGPLVVLLHGFP---EFWWTWRHQLLALGDAGYRAVAPDLRGYGDTDKT--PRGYDL 88

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
             +A D   L+  LG  + HV+G+  GA IA ++   +P  V S+ + G 
Sbjct: 89  WTLAGDCAGLVRALGERRAHVVGHDWGAAIAWTVAALHPRLVASLTVLGA 138


>gi|284034823|ref|YP_003384754.1| alpha/beta hydrolase fold protein [Kribbella flavida DSM 17836]
 gi|283814116|gb|ADB35955.1| alpha/beta hydrolase fold protein [Kribbella flavida DSM 17836]
          Length = 285

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 59/109 (54%), Gaps = 5/109 (4%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND--Y 79
           GD   P ILLIHG A+S+  ++  + + +LL      V+ +D+   G+S  SY      Y
Sbjct: 22  GDPADPPILLIHGAAASM--DYWETAFCELLAAGPRYVVRYDHRDTGRS-VSYPPGKPGY 78

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
               +  D V +L+ LGI + HV G SMG  IA  +VL +P  VRS+ L
Sbjct: 79  TGTDLVRDPVGILDALGIGRAHVAGLSMGGGIAQQLVLDFPDRVRSLTL 127


>gi|325121337|gb|ADY80860.1| hypothetical protein BDGL_000274 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 299

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 58/132 (43%), Gaps = 31/132 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKSDKSYIEN 77
           G  + PTILLI GL + +    LF  W    C    DQGFRVI FDN   G S K   E 
Sbjct: 20  GKPEHPTILLIMGLGAQM----LF--WPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHEG 73

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MA D   L++ LG++K HV+G SMG  IA  + 
Sbjct: 74  KRLNTVKLMGRFALGLSNQGAPYTLHDMADDVSMLIDRLGVTKTHVIGASMGGMIAQILA 133

Query: 117 LFYPSYVRSVIL 128
             YP  V  + L
Sbjct: 134 AKYPEKVEKLGL 145


>gi|330910149|gb|EGH38659.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli AA86]
          Length = 289

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKS
Sbjct: 23  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKS 80

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 81  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 139

Query: 131 VGS 133
            G+
Sbjct: 140 GGT 142


>gi|326504962|dbj|BAK06772.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 360

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 43/74 (58%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           +G  V  FDN G G+S     ++ Y    MA DA++L++HLG  K HV G+SMGA I+C 
Sbjct: 79  EGIEVCCFDNRGVGRSSILPHKSYYSTAIMARDALALMDHLGWKKAHVFGHSMGAMISCK 138

Query: 115 MVLFYPSYVRSVIL 128
           +    P  + S+ L
Sbjct: 139 LAAMAPHRLSSLAL 152


>gi|315445774|ref|YP_004078653.1| hydrolase or acyltransferase of alpha/beta superfamily
           [Mycobacterium sp. Spyr1]
 gi|315264077|gb|ADU00819.1| predicted hydrolase or acyltransferase of alpha/beta superfamily
           [Mycobacterium sp. Spyr1]
          Length = 287

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +Q  + + GD DAP I+L+HG  +S   +++F   I  L D+ +RVIA D LG G SD  
Sbjct: 14  HQVFYREAGDPDAPVIVLLHGFPTS---SFMFRNLIPELADR-YRVIAPDYLGFGYSDAP 69

Query: 74  YIEN-DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
            +E+ DY    +      LL  LGI +  +     GA +   + L  P+ + ++I
Sbjct: 70  TVEDFDYTFDALTDSVAGLLTQLGIRRYAIYVQDYGAPVGWRLALRDPAAITAII 124


>gi|293608897|ref|ZP_06691200.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829470|gb|EFF87832.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 314

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 58/132 (43%), Gaps = 31/132 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKSDKSYIEN 77
           G  + PTILLI GL + +    LF  W    C    DQGFRVI FDN   G S K   E 
Sbjct: 35  GKPEHPTILLIMGLGAQM----LF--WPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHEG 88

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MA D   L++ LG++K HV+G SMG  IA  + 
Sbjct: 89  KRLNTVKLMGRFALGLSNQGAPYTLHDMADDVSMLIDRLGVTKTHVIGASMGGMIAQILA 148

Query: 117 LFYPSYVRSVIL 128
             YP  V  + L
Sbjct: 149 AKYPEKVEKLGL 160


>gi|159039351|ref|YP_001538604.1| alpha/beta hydrolase fold [Salinispora arenicola CNS-205]
 gi|157918186|gb|ABV99613.1| alpha/beta hydrolase fold [Salinispora arenicola CNS-205]
          Length = 276

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R++ F     G    P +LL+HG     Q +  ++  + +L   G R  A D  G+    
Sbjct: 6   REFTFDVRLGGPPAGPPVLLLHGFP---QHSGEWADVVPILHAAGLRTYALDQRGYSPGA 62

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           +      YRL  +  DA ++LE LGI   HV+G+  GA +   +   +PS VR++ 
Sbjct: 63  RPKPVGAYRLAELVGDAAAVLEALGIDAAHVVGHDWGAVVGWGLAAGHPSRVRTLT 118


>gi|312195098|ref|YP_004015159.1| alpha/beta hydrolase fold protein [Frankia sp. EuI1c]
 gi|311226434|gb|ADP79289.1| alpha/beta hydrolase fold protein [Frankia sp. EuI1c]
          Length = 345

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 101/233 (43%), Gaps = 32/233 (13%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           DAP ++++HG+      ++ FS     + D G  V+ +D  GHGKS+++   + Y +   
Sbjct: 25  DAPVVVMLHGMVIDNLASFYFS-LGNAMADAGCEVVCYDLRGHGKSERT--PSGYGIATA 81

Query: 85  AADAVSLLEHLGISK-VHVMGYSMGARIACSMVLFYPSYVRSVIL-------GGVGSVLY 136
            AD  ++L+ LGI + VH++G S GA +A +  + +P  V S+ L        G+G  + 
Sbjct: 82  MADLTAVLDELGIDRPVHLVGNSYGATLALTYGVEHPDRVASLTLIEPPFRIEGLGEEMA 141

Query: 137 DSDVVDWQSLIDSFLLPSIDEVQN--------PLGKKFRKFADLDPGNDLKALASCLSMI 188
                  +SL       S DEV+          +G+  R    L     L+       M+
Sbjct: 142 -------RSLTQVLAAISDDEVEEWLQFSAGRAVGRIMRSAQAL-----LRETTVAEDML 189

Query: 189 -RKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELMSFIPSSQYLNICRRDHLL 240
             KPF  + L  +  PVL   G   ++      L   +P    + +    H++
Sbjct: 190 ATKPFSPERLSALPAPVLAIYGGNSEIIEQGDGLARLVPDCTLVVLEHHTHMV 242


>gi|94313797|ref|YP_587006.1| 3-oxoadipate enol-lactonase [Cupriavidus metallidurans CH34]
 gi|93357649|gb|ABF11737.1| 3-oxoadipate enol-lactonase [Cupriavidus metallidurans CH34]
          Length = 258

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 102/240 (42%), Gaps = 29/240 (12%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           RK  +      DK  P +++ + L +++    ++   +  L    +RV+ +D  GHG+S 
Sbjct: 7   RKLHYVIEGAADK--PVLVMSNSLGTTLD---MWGPQMAGLTAH-YRVLRYDTRGHGRS- 59

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            +   + + +  +A D +++++H GI + H  G SMG      +  ++       +L   
Sbjct: 60  -ALPSSSFGMRELAEDVIAIMDHAGIERAHFCGLSMGGMTGMYLARYHAGRFGRFVLANT 118

Query: 132 GSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFAD---------LDP------GN 176
            +++    V  W + I++     +  + N  G   R F D          +P      G 
Sbjct: 119 AALIGPESV--WNTRIETVRRDGMAAIVN--GVLARWFTDHYVLTRRDEYEPVRRMLTGT 174

Query: 177 DLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQD--DLAGSPQELMSFIPSSQYLNIC 234
             +  A+  + +R    +  L  I  PVL+  G QD    A   QE++  IP ++YL + 
Sbjct: 175 SAEGYAANCAAVRDADLRGLLPGIQAPVLVIAGEQDLATTAAQGQEVVRAIPGAEYLELA 234


>gi|16081937|ref|NP_394346.1| triacylglycerol lipase related protein [Thermoplasma acidophilum
           DSM 1728]
 gi|10640164|emb|CAC12016.1| triacylglycerol lipase related protein [Thermoplasma acidophilum]
          Length = 235

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 101/234 (43%), Gaps = 36/234 (15%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQL--LCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAA 86
           ++ +HGL  S       + WI+L    D  FR+I FD LGHG+SDK  +E  Y +   A+
Sbjct: 24  LVFLHGLGGS------GNNWIRLDRFLDGRFRMICFDLLGHGRSDKPRVE--YTVEVQAS 75

Query: 87  DAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSL 146
             V  L  LG+++  ++G S G  I+  + L                      V D+  L
Sbjct: 76  AIVEALSKLGVNRFTLVGNSYGGWISLYIAL-------------------KKKVPDYLVL 116

Query: 147 IDSF-LLPSIDEVQNPLGKKF-RKFADLDPGND---LKALASCLSMIRKPFCQDDLYRID 201
           +DS  L P+I E+ +    +F +K   ++ GND   ++ ++   S        +DL  I 
Sbjct: 117 VDSAGLNPTIAELGDEKLNEFVKKVMSVEEGNDEYVIRNISINNSKEEWKIKDEDLRSIK 176

Query: 202 VPVLIAVGSQDDLAGSP--QELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVN 253
              LI  G+ D++      ++    IP+S    I    H   +   Q    ++N
Sbjct: 177 TKTLIIWGTADNVLSIEYGRKFHELIPNSLLFEIPYAKHTPQITHPQIVARIIN 230


>gi|224371396|ref|YP_002605560.1| putative hydrolase or acyltransferase family protein (alpha/beta
           hydrolase superfamily) [Desulfobacterium autotrophicum
           HRM2]
 gi|223694113|gb|ACN17396.1| putative hydrolase or acyltransferase family protein (alpha/beta
           hydrolase superfamily) [Desulfobacterium autotrophicum
           HRM2]
          Length = 330

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 70/135 (51%), Gaps = 19/135 (14%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDA-PTILLIHGLASSVQTNWLFSG--WIQL---LCDQ 55
           +N  KF    +  +  + D+GD+DA   I+LIHG          FSG  W ++   L  +
Sbjct: 39  VNTFKFNSQNQDLRMRYMDIGDRDAQKVIVLIHGKN--------FSGYYWERVAKDLLKR 90

Query: 56  GFRVIAFDNLGHGKSDK--SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIAC 113
            +RVI  D +G GKS K  SY    Y    +A +  SLL++L I K  ++G+SMG  +A 
Sbjct: 91  KYRVIMPDQIGFGKSSKPESY---QYSFGQLALNTKSLLDNLNIKKFDLVGHSMGGMLAT 147

Query: 114 SMVLFYPSYVRSVIL 128
           +  + YP  V  +IL
Sbjct: 148 TFAVNYPELVNKLIL 162


>gi|145225426|ref|YP_001136104.1| alpha/beta hydrolase fold [Mycobacterium gilvum PYR-GCK]
 gi|145217912|gb|ABP47316.1| alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]
          Length = 287

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           +Q  + + GD DAP I+L+HG  +S   +++F   I  L D+ +RVIA D LG G SD  
Sbjct: 14  HQVFYREAGDPDAPVIVLLHGFPTS---SFMFRNLIPELADR-YRVIAPDYLGFGYSDAP 69

Query: 74  YIEN-DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
            +E+ DY    +      LL  LGI +  +     GA +   + L  P+ + ++I
Sbjct: 70  TVEDFDYTFDALTDSVAGLLTQLGIRRYAIYVQDYGAPVGWRLALRDPAAITAII 124


>gi|326800727|ref|YP_004318546.1| alpha/beta hydrolase [Sphingobacterium sp. 21]
 gi|326551491|gb|ADZ79876.1| alpha/beta hydrolase fold protein [Sphingobacterium sp. 21]
          Length = 335

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQL---LCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           +   ++L+HG       N+  + W Q    L D G+RV+  D +G GKS K      Y  
Sbjct: 68  NGKVVVLLHG------KNFNGAYWEQTAKTLADNGYRVVIPDQIGFGKSSKPQ-RIQYSF 120

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             +A +  +LL+ LGISK+ ++G+SMG  +A    L YP  V  +IL
Sbjct: 121 QLLAKNTKALLDSLGISKIFLLGHSMGGMLATRFTLMYPDLVDKLIL 167


>gi|239994263|ref|ZP_04714787.1| alpha/beta fold family hydrolase [Alteromonas macleodii ATCC 27126]
          Length = 303

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 65/134 (48%), Gaps = 18/134 (13%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
            +S  ++ +A + VG+ D  TI+LI GL   +Q  +  +  I+ L   GFRVI FDN   
Sbjct: 13  LKSGDRFCYAEHGVGNTD--TIVLIVGLG--LQLVYWPNALIERLVASGFRVICFDNRDA 68

Query: 68  GKSDKSYI--------------ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIAC 113
           G+S +S                +  Y L  MA D   LLE L I+  H+ G SMG  IA 
Sbjct: 69  GRSVRSDTPHPSLLQQLRGRSPKGAYGLERMAEDTAQLLEALNITSAHIAGMSMGGMIAQ 128

Query: 114 SMVLFYPSYVRSVI 127
           ++   +P  V S+ 
Sbjct: 129 TLASLHPEKVISMT 142


>gi|310644114|ref|YP_003948872.1| alpha/beta hydrolase fold [Paenibacillus polymyxa SC2]
 gi|309249064|gb|ADO58631.1| Alpha/beta hydrolase fold [Paenibacillus polymyxa SC2]
          Length = 260

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 110/264 (41%), Gaps = 30/264 (11%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKS 73
           Y   + D G+    TIL IH     V T+  F+  IQ L    FR +AFD  GHGKS  S
Sbjct: 9   YSMHYIDSGE--GMTILFIH---PPVLTSLNFTYQIQGLSPD-FRTVAFDIRGHGKSQPS 62

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV-RSVILGGVG 132
                Y L+  A D   L++ L + KV + GYS G  I    +L YP      +++ G+ 
Sbjct: 63  EQTVTYPLI--AQDIKHLMDRLSLDKVFLCGYSTGGSIVLEFLLTYPDRAWGGIVISGMS 120

Query: 133 SV--LYDSDVVDWQSLIDSF-----LLPSIDEVQNPLGKKFRK-FADLD---PGNDLKAL 181
            V      + + W + +        +  SI   Q      FRK F D     PGN  +  
Sbjct: 121 EVNDWRLRNKISWGTALSKIGAVGTIALSIAWSQTKQLSLFRKLFNDAKQSHPGNVEQYY 180

Query: 182 ASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNICRRDHLL 240
              L    K  C   L  I +PVL+  G +D         L   +P S+ + I + DH L
Sbjct: 181 RYSL----KYNCTSRLGEIHLPVLLVYGEEDKHFHPYANILHQQLPKSELVFIKKADHRL 236

Query: 241 ---AVG--DKQFKQGVVNFYANEL 259
              A G  ++  KQ +  F  N L
Sbjct: 237 PTKAAGTLNELIKQFIDRFSENNL 260


>gi|317048159|ref|YP_004115807.1| alpha/beta hydrolase fold protein [Pantoea sp. At-9b]
 gi|316949776|gb|ADU69251.1| alpha/beta hydrolase fold protein [Pantoea sp. At-9b]
          Length = 272

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 112/267 (41%), Gaps = 46/267 (17%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSG--W---IQLLCDQGFRVIAF 62
           F++    Q  F D G K  P +L  HG        W   G  W   +  L ++G+RVIAF
Sbjct: 4   FKTTDGTQIYFKDWG-KGHP-VLFSHG--------WPLDGDMWDSQMNFLAERGYRVIAF 53

Query: 63  DNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           D  G G+SD+ +   DY     A+D   L+ HLG+ KV ++G+SMG       +  Y S 
Sbjct: 54  DRRGFGRSDQPWQGYDYDT--FASDINDLINHLGLDKVTLVGFSMGGGDVTRYIGNYGSA 111

Query: 123 VRS--VILGGVGSVLYDSDVVDWQSLIDSFLLPSI-DEVQNPLGKKFRKFADLDPGND-- 177
             +  V+LG V  +   ++  D+   +D  +   I D ++    +  + FA    G +  
Sbjct: 112 RVAGLVLLGAVTPIFGQAE--DYPEGVDLSVFAGIRDGLRKDRAQFIQDFAAPFYGTNAG 169

Query: 178 -------------------LKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL---A 215
                              LK    C++   +   + D+ +++VP L+  GS D +   A
Sbjct: 170 QTVSEGVLTQTLNIALLASLKGTLDCVTAFSETDFRGDIAKVNVPTLVIHGSNDQIVPFA 229

Query: 216 GSPQELMSFIPSSQYLNICRRDHLLAV 242
            + +     IP ++        H  AV
Sbjct: 230 TTGKVAAEMIPGAELKVYENGPHGFAV 256


>gi|218682085|ref|ZP_03529686.1| alpha/beta hydrolase fold protein [Rhizobium etli CIAT 894]
          Length = 247

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 98/209 (46%), Gaps = 32/209 (15%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKS 70
           K  +A Y  G+     IL IHG   + +       W   + D  +   VI  D+ GHG+S
Sbjct: 51  KMYYAEYGEGEP----ILFIHGGLGNAEV------WGNQVADFARDHLVIVADSRGHGRS 100

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
            +S     Y L  M +D V+LL++L I KV ++G+S G  I   M + +P  +  VI   
Sbjct: 101 TRSQKPFGYDL--MTSDYVALLDYLKIDKVTLVGWSDGGIIGIEMAMKHPEKLTRVI-AQ 157

Query: 131 VGSVLYDS---DVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
             +V  D    DV+D  +  ++++        N  G+++RK +     N+  A    +S 
Sbjct: 158 AANVTTDGVKPDVMD-NTTFNNYI--------NVAGEQYRKLSPTP--NEYDAFVKQISE 206

Query: 188 I---RKPFCQDDLYRIDVPVLIAVGSQDD 213
           +   +  +   DL +I VPV +A+G  D+
Sbjct: 207 MWATQPAWTAADLAKISVPVTLAIGDHDE 235


>gi|146339853|ref|YP_001204901.1| 3-oxoadipate enol-lactonase [Bradyrhizobium sp. ORS278]
 gi|146192659|emb|CAL76664.1| 3-oxoadipate enol-lactonase (Enol-lactone hydrolase)
           (Beta-ketoadipate enol-lactone hydrolase)
           [Bradyrhizobium sp. ORS278]
          Length = 260

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 88/204 (43%), Gaps = 21/204 (10%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRL 81
           G    PT++L + L S++Q   ++   ++    Q FRVI +D  GHGKS        Y +
Sbjct: 17  GRDGGPTLMLSNSLGSTLQ---MWEPQMRAFT-QVFRVIRYDRRGHGKS--QVPPGPYSI 70

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
                DA+++L+ L I KVH  G SMG  +   +    P  +  V+L    +  Y  D  
Sbjct: 71  ERCGRDALAILDDLNIEKVHWCGVSMGGMVGQWLAAHAPERIGKVVL--ANTTCYYPDPA 128

Query: 142 DWQSLIDSFLLPSIDEVQNPL--GKKFRKFADLDP--GNDLKAL---------ASCLSMI 188
            W + I +     +  + + +  G   ++F D  P     +KA+          +C   +
Sbjct: 129 IWDARIKAVRDSGLAGIADTIIAGWLTQEFRDRHPDVAERMKAMLVATPVEGYLACCEAL 188

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQD 212
           R    +DDL  +  P L+  G  D
Sbjct: 189 RALDLRDDLSNVKSPTLVVAGRYD 212


>gi|226304371|ref|YP_002764329.1| hydrolase [Rhodococcus erythropolis PR4]
 gi|229494147|ref|ZP_04387910.1| hydrolase, alpha/beta fold family [Rhodococcus erythropolis SK121]
 gi|226183486|dbj|BAH31590.1| putative hydrolase [Rhodococcus erythropolis PR4]
 gi|229318509|gb|EEN84367.1| hydrolase, alpha/beta fold family [Rhodococcus erythropolis SK121]
          Length = 295

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 60/121 (49%), Gaps = 11/121 (9%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           Q  + D G    P ++LIHGL  +  +NW     I+ L    +RVIA D  GHG SDK  
Sbjct: 15  QLKYVDQGS--GPVVVLIHGLLGA-HSNW--EPQIETLSRH-YRVIAPDLFGHGASDKP- 67

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL---GGV 131
              DY L   AA    LLE L I    ++G+S+G  IA   +  +P  V  + L   GG+
Sbjct: 68  -AGDYSLSAHAATVRDLLEALDIPSATLVGHSLGGGIAMQTLYLFPDRVERLCLVASGGL 126

Query: 132 G 132
           G
Sbjct: 127 G 127


>gi|225573617|ref|ZP_03782372.1| hypothetical protein RUMHYD_01811 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039017|gb|EEG49263.1| hypothetical protein RUMHYD_01811 [Blautia hydrogenotrophica DSM
           10507]
          Length = 276

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 97/219 (44%), Gaps = 21/219 (9%)

Query: 11  WRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS 70
           W +    FY V  +  P +LL HG   + + +  F   IQ    + +++I  D  GHGKS
Sbjct: 41  WVEDAHIFYQVIGQGKPLVLL-HG---NGENHKYFRSQIQFFRRE-YQLILIDTRGHGKS 95

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
              Y   ++ L  +A D  ++LE LGI K   +G+S GA +A  + L  P  V S+IL  
Sbjct: 96  SPGYRRWNFGL--LAKDVEAVLECLGIEKAAFLGFSDGANLALEVALRSPKRVTSLIL-- 151

Query: 131 VGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRK 190
                  S  ++ Q +   F L +       +   + K   ++    LK     L     
Sbjct: 152 ------VSGNLNPQGMKKGFYLRT-----KLMYWLYEKIGKINQRACLKWQLYGLMACHP 200

Query: 191 PFCQDDLYRIDVPVLIAVGSQDDLA-GSPQELMSFIPSS 228
              + +L R+ VPVLI  G +D +     + + + IP+S
Sbjct: 201 HINERELSRLKVPVLIIAGEKDLIKENHTRHIHNLIPNS 239


>gi|73993673|ref|XP_857430.1| PREDICTED: similar to epoxide hydrolase 2, cytoplasmic isoform 2
           [Canis familiaris]
          Length = 556

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P + L HG   S   +W +   I  L   GFRV+A D  G+G+S       +Y +  + 
Sbjct: 256 GPAVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLALDMKGYGESSSPPEIEEYSMEVLC 312

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            + V+ L+ LGI +   +G+  G  +  +M LFYP  VR+V
Sbjct: 313 QEMVTFLDKLGIPQAVFIGHDWGGMLVWNMALFYPERVRAV 353


>gi|322828731|gb|EFZ32420.1| hydrolase-like protein, putative [Trypanosoma cruzi]
          Length = 429

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 103/251 (41%), Gaps = 57/251 (22%)

Query: 13  KYQFAFYDVGD--KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQ----GFRVIAFDNLG 66
           + +  +   GD  K  P +LLI GL      N     W +  C++    GF V+ FDN  
Sbjct: 19  RIELCYQCFGDPLKQMPVVLLIGGL------NMQIYAWDEAFCEKLVKCGFFVVRFDNRD 72

Query: 67  HGKSDK------------------SYIEN-DYRLVFMAADAVSLLEHLGISKVHVMGYSM 107
            G S K                  ++ E   Y +  MA DA+ LL+ LGIS  HVMG SM
Sbjct: 73  IGLSTKVEKRGSVIPARLLLPKALAFGERLPYTIKDMARDALGLLDALGISSAHVMGISM 132

Query: 108 GARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLP------SIDEVQN- 160
           G  IA +M L  P  V S  L  + S     D+ D Q  +  +LL       ++DE+ N 
Sbjct: 133 GGMIAQTMALLSPHRVLS--LTSIMSTTNAPDLPDPQLWVKMWLLRKPPVNCTLDELINF 190

Query: 161 ---PLGKKFRKFADLDPGN-------DLKALASCLSMIRK-------PFCQDDLYRIDVP 203
               + K  R    +D  +        L+  +    +IR+       P   +DL  +  P
Sbjct: 191 RLESIKKLLRGTLPVDEEHLKRGYLKSLQRSSYSAGLIRQAAAIRRCPGRDEDLRSLSCP 250

Query: 204 VLIAVGSQDDL 214
            L+  G QD L
Sbjct: 251 TLVIHGQQDVL 261


>gi|170720280|ref|YP_001747968.1| alpha/beta hydrolase fold family protein [Pseudomonas putida W619]
 gi|169758283|gb|ACA71599.1| alpha/beta hydrolase fold [Pseudomonas putida W619]
          Length = 331

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 59/132 (44%), Gaps = 21/132 (15%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG------- 68
             +  VG    P +LL+ GL   +  +W     ++ LC QGFRVI +DN   G       
Sbjct: 39  LVYQSVGAPRDPALLLVMGLGGQL-IHW-PDDVVEALCRQGFRVIRYDNRDVGLSRWNQQ 96

Query: 69  -KSDKSYIE-----------NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
             S    IE             Y L  MA D + L++ LGI + HV+G SMG  IA  M 
Sbjct: 97  PPSANLTIELLRYKFGLPVAAPYTLPDMADDGLRLMDALGIGQFHVLGVSMGGMIAQHMA 156

Query: 117 LFYPSYVRSVIL 128
              P  VRS+ L
Sbjct: 157 AMAPERVRSLTL 168


>gi|73993678|ref|XP_857554.1| PREDICTED: similar to epoxide hydrolase 2, cytoplasmic isoform 4
           [Canis familiaris]
          Length = 554

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P + L HG   S   +W +   I  L   GFRV+A D  G+G+S       +Y +  + 
Sbjct: 256 GPAVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLALDMKGYGESSSPPEIEEYSMEVLC 312

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            + V+ L+ LGI +   +G+  G  +  +M LFYP  VR+V
Sbjct: 313 QEMVTFLDKLGIPQAVFIGHDWGGMLVWNMALFYPERVRAV 353


>gi|57105102|ref|XP_534566.1| PREDICTED: similar to epoxide hydrolase 2, cytoplasmic isoform 1
           [Canis familiaris]
          Length = 556

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P + L HG   S   +W +   I  L   GFRV+A D  G+G+S       +Y +  + 
Sbjct: 258 GPAVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLALDMKGYGESSSPPEIEEYSMEVLC 314

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            + V+ L+ LGI +   +G+  G  +  +M LFYP  VR+V
Sbjct: 315 QEMVTFLDKLGIPQAVFIGHDWGGMLVWNMALFYPERVRAV 355


>gi|311742929|ref|ZP_07716737.1| alpha/beta hydrolase fold family hydrolase [Aeromicrobium marinum
           DSM 15272]
 gi|311313609|gb|EFQ83518.1| alpha/beta hydrolase fold family hydrolase [Aeromicrobium marinum
           DSM 15272]
          Length = 316

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 62/124 (50%), Gaps = 15/124 (12%)

Query: 14  YQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSD 71
           Y+ A+   G    P +LL+HGLA    T      W +++    + F VIA D LGHG+SD
Sbjct: 15  YRRAYRTAGT--GPALLLVHGLACDSST------WDEVIAPLAEHFTVIAPDLLGHGESD 66

Query: 72  KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL--- 128
           K   + DY L   A     LL  LG+ KV V+G+S G  +A      +P     V+L   
Sbjct: 67  KP--DADYSLGGYANAMRDLLTILGVDKVTVIGHSFGGGVAMQFAYQFPERTERVVLVST 124

Query: 129 GGVG 132
           GG+G
Sbjct: 125 GGLG 128


>gi|116621095|ref|YP_823251.1| alpha/beta hydrolase fold protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116224257|gb|ABJ82966.1| alpha/beta hydrolase fold [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 287

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P ++++HG+  ++   W       L+ D  FR+  +D  GHG SD       Y     
Sbjct: 18  EGPPVVMVHGITGNLAI-WHLEIVPGLMSD--FRITTYDLRGHGYSDVP--PTGYTTADH 72

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL--GGVGSVLYDSDVVD 142
           A D   LLE LGI + HVMG+S GA IA    + +P  V  ++L   G+ ++    +  D
Sbjct: 73  AMDLKHLLETLGIERAHVMGHSFGADIALHFTILFPERVDRLVLVEPGIAALTPLRESED 132

Query: 143 W 143
           W
Sbjct: 133 W 133


>gi|300786375|ref|YP_003766666.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
 gi|299795889|gb|ADJ46264.1| alpha/beta hydrolase [Amycolatopsis mediterranei U32]
          Length = 296

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 97/241 (40%), Gaps = 44/241 (18%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSD 71
           R    A+  +GD  A  ++L+ GL   +  +W    +   L ++G++VI FDN   G+S 
Sbjct: 10  RGISLAYERIGDTGAEPLVLVAGLGQQLH-SWP-DAFCAKLAERGYQVIRFDNRDAGRST 67

Query: 72  KS--------------YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
                           +    Y L  MAAD + L + L +   HV G SMG  I+ ++  
Sbjct: 68  HPRFRPPSLAGMLVGRFPAQQYDLTDMAADTIGLFDALDLETAHVAGVSMGGMISQTVAA 127

Query: 118 FYPSYVRSV--ILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFA----- 170
            YP  +R++  I+   GS ++    +    ++ +    S +E      + FR        
Sbjct: 128 RYPERIRTLTSIMSTTGSRVFGRPALSTLRMMGAKPPKSREEAIESAVRMFRHIGSRGFP 187

Query: 171 --------------DLDP--GNDLKALASCL-SMIRKPFCQDDLYRIDVPVLIAVGSQDD 213
                         D DP  G   + LA+ + S  R P     L +I  P L+  G +D 
Sbjct: 188 FDEARVRERAGTSWDRDPTAGGVGRQLAAIMKSGNRTPL----LRKITAPTLVIHGDRDR 243

Query: 214 L 214
           +
Sbjct: 244 M 244


>gi|49477674|ref|YP_036518.1| hydrolase [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|49329230|gb|AAT59876.1| possible hydrolase [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 265

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 94/205 (45%), Gaps = 17/205 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y V  +  P I+ IH       T+  F   I+ L  + F+VIAFD  GHG S  S    
Sbjct: 12  YYIVKGEGTP-IIFIH---PPTLTSENFEYQIEEL-SRNFKVIAFDVRGHGNSQSSSQPI 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP-SYVRSVILGGVGSVL- 135
            Y L+  A D  SLL+HL I K  V GYS G+ +A   +L YP + +  +++GG+  V  
Sbjct: 67  TYSLI--AKDMKSLLDHLEIKKSFVCGYSTGSTVALEFLLTYPENSLGGILIGGMSEVRQ 124

Query: 136 -YDSDVVDW-----QSLIDSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALASCLSMI 188
            Y  + +       ++   SFL  +I    +   K F++ F +   GN  K +       
Sbjct: 125 GYLKNKISLGVQLAKARAISFLAFAISWGNSNTKKIFKRMFREARKGNA-KNIEQYYRYS 183

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDD 213
               C + L  I +P+L+  G  D 
Sbjct: 184 LHYNCTNRLKDIHLPMLLVYGQNDK 208


>gi|73993675|ref|XP_857471.1| PREDICTED: similar to epoxide hydrolase 2, cytoplasmic isoform 3
           [Canis familiaris]
          Length = 555

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 26  APTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMA 85
            P + L HG   S   +W +   I  L   GFRV+A D  G+G+S       +Y +  + 
Sbjct: 258 GPAVCLCHGFPES-WFSWRYQ--IPALAQAGFRVLALDMKGYGESSSPPEIEEYSMEVLC 314

Query: 86  ADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            + V+ L+ LGI +   +G+  G  +  +M LFYP  VR+V
Sbjct: 315 QEMVTFLDKLGIPQAVFIGHDWGGMLVWNMALFYPERVRAV 355


>gi|320662522|gb|EFX29911.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli O55:H7 str. USDA 5905]
          Length = 288

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIE 76
           F D G  D  T++L+HG      T W  FS  I  L + G+RVI  D  G GKSD S + 
Sbjct: 28  FNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVEAGYRVILLDCPGWGKSD-SIVN 84

Query: 77  NDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
           +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G G+
Sbjct: 85  SGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMGGGT 141


>gi|304408696|ref|ZP_07390317.1| alpha/beta hydrolase fold protein [Shewanella baltica OS183]
 gi|307305525|ref|ZP_07585273.1| alpha/beta hydrolase fold protein [Shewanella baltica BA175]
 gi|304352517|gb|EFM16914.1| alpha/beta hydrolase fold protein [Shewanella baltica OS183]
 gi|306911828|gb|EFN42253.1| alpha/beta hydrolase fold protein [Shewanella baltica BA175]
          Length = 258

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (52%), Gaps = 7/117 (5%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           V     P +LLIHGL  ++       G  Q+L  Q ++VI  D   HG S+  + E DY 
Sbjct: 4   VSTGQGPAVLLIHGLFGNLDN---LKGLGQVLESQ-YQVIRVDVPNHGLSEH-WDEMDYP 58

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
              +A   V+LL+ L I + H++G+SMG +IA +  L +P  + S++   +  V Y+
Sbjct: 59  --HLATAMVALLDELAIERAHIVGHSMGGKIAMATALAHPQRIISMVAADIAPVAYE 113


>gi|238020045|ref|ZP_04600471.1| hypothetical protein VEIDISOL_01922 [Veillonella dispar ATCC 17748]
 gi|237863569|gb|EEP64859.1| hypothetical protein VEIDISOL_01922 [Veillonella dispar ATCC 17748]
          Length = 286

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 11/122 (9%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           +Y++    VGD +   I+  HG + S  T      W   +   G+RVI  D +GHG SD 
Sbjct: 26  EYRYGLTIVGDGEP--IVCFHGFSESSYT------W-DAINLPGYRVIRIDLIGHGDSDI 76

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL--GG 130
              +  Y +  M  D  +++ H+   + ++MGYSMGARIA S  L Y S ++ +IL  G 
Sbjct: 77  PDEDKAYTIPQMIEDLHTVIYHMVGDRYYLMGYSMGARIALSYALEYESEIKGLILESGS 136

Query: 131 VG 132
           VG
Sbjct: 137 VG 138


>gi|228933714|ref|ZP_04096561.1| Hydrolase [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228825947|gb|EEM71733.1| Hydrolase [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
          Length = 265

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 94/205 (45%), Gaps = 17/205 (8%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           +Y V  +  P I+ IH       T+  F   I+ L  + F+VIAFD  GHG S  S    
Sbjct: 12  YYIVKGEGTP-IIFIH---PPTLTSENFEYQIEEL-SRNFKVIAFDVRGHGNSQSSSQPI 66

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYP-SYVRSVILGGVGSVL- 135
            Y L+  A D  SLL+HL I K  V GYS G+ +A   +L YP + +  +++GG+  V  
Sbjct: 67  TYSLI--AKDMKSLLDHLEIKKSFVCGYSTGSTVALKFLLTYPENSLGGILIGGMSEVRQ 124

Query: 136 -YDSDVVDW-----QSLIDSFLLPSIDEVQNPLGKKFRK-FADLDPGNDLKALASCLSMI 188
            Y  + +       ++   SFL  +I    +   K F++ F +   GN  K +       
Sbjct: 125 GYLKNKISLGVQLAKARAISFLAFAISWGNSNTKKIFKRMFREARKGNA-KNIEQYYRYS 183

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDD 213
               C + L  I +P+L+  G  D 
Sbjct: 184 LHYNCTNRLKDIHLPMLLVYGQNDK 208


>gi|225686423|ref|YP_002734395.1| 3-oxoadipate enol-lactonase [Brucella melitensis ATCC 23457]
 gi|225642528|gb|ACO02441.1| 3-oxoadipate enol-lactonase [Brucella melitensis ATCC 23457]
 gi|326410798|gb|ADZ67862.1| 3-oxoadipate enol-lactonase [Brucella melitensis M28]
 gi|326554090|gb|ADZ88729.1| 3-oxoadipate enol-lactonase [Brucella melitensis M5-90]
          Length = 267

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 97/238 (40%), Gaps = 31/238 (13%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRV--IAFDNLGHGKSDKSYIENDYRL 81
            D P ++ I+ L +       F  W ++    G  V  + +D  GHG SD    +  Y +
Sbjct: 20  NDKPVLVFINSLGTD------FRIWNKVRARLGHDVSTLVYDKRGHGLSDIG--KTPYTI 71

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +A D ++LL+ L I K  + G S+G  IA  +    P  V  ++L      +   ++ 
Sbjct: 72  ELLAQDLIALLDRLSIHKAVICGLSVGGLIAQGLYAARPDLVAGLVLSNTAHKIGTPEM- 130

Query: 142 DWQSLIDSFLLPSIDEV-------------QNPLGKKFRKFADLDPGNDLKALASCLSMI 188
            W + ID+ +   +  +             + P    ++ + ++     L+  A+  + +
Sbjct: 131 -WNARIDAIMQNGLASILDATMPRWFTAAYRRPDNAAYQAYCNMFTRQPLEGYATTCAAL 189

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRDHLLAV 242
           R        ++I VPV    G QD    +P    QEL S IP + +  I    H+  V
Sbjct: 190 RDADFTAAAHKISVPVRCVAGDQD--GSTPPTLVQELASLIPGAVFSQIANSGHIPCV 245


>gi|54022437|ref|YP_116679.1| putative hydrolase [Nocardia farcinica IFM 10152]
 gi|54013945|dbj|BAD55315.1| putative hydrolase [Nocardia farcinica IFM 10152]
          Length = 293

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 67/140 (47%), Gaps = 6/140 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           +  +++ G  + PTI+L+HG      +   F+  I +L  Q F V+A D  G G+SDK  
Sbjct: 23  KLHYHEAGVGNGPTIVLLHGGGPGASSWSNFARNIPVLA-QNFHVLAVDQPGFGRSDKPV 81

Query: 75  IENDYRLVFMAADAVSLLEHLGIS-KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
               Y     AA    LL+ LG++ +VH++G S+G   A    L YP     ++L G G 
Sbjct: 82  DHPQY-FSHSAAALKDLLDTLGVTERVHLLGNSLGGGAAVRFALDYPDRAGKLVLMGPGG 140

Query: 134 V---LYDSDVVDWQSLIDSF 150
           +    Y  D  +   L+  F
Sbjct: 141 LSMNAYAPDPTEGVKLLSRF 160


>gi|313894013|ref|ZP_07827579.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
           [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441577|gb|EFR60003.1| 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
           [Veillonella sp. oral taxon 158 str. F0412]
          Length = 286

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 11/122 (9%)

Query: 13  KYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           +Y++    VGD +   I+  HG + S  T      W   +   G+RVI  D +GHG SD 
Sbjct: 26  EYRYGLTVVGDGEP--IVCFHGFSESSYT------W-DAINLPGYRVIRIDLIGHGDSDI 76

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL--GG 130
              +  Y +  M  D  +++ H+   + ++MGYSMGARIA S  L Y S ++ +IL  G 
Sbjct: 77  PDEDKAYTIPQMIEDLHTVIYHMVGDRYYLMGYSMGARIALSYALEYESEIKGLILESGS 136

Query: 131 VG 132
           VG
Sbjct: 137 VG 138


>gi|29830353|ref|NP_824987.1| epoxide hydrolase [Streptomyces avermitilis MA-4680]
 gi|29607464|dbj|BAC71522.1| putative epoxide hydrolase [Streptomyces avermitilis MA-4680]
          Length = 333

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 3/102 (2%)

Query: 25  DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFM 84
           + P ++L+HG   S   +W        L   GFRV+A D  G+G+SD+    + Y ++ +
Sbjct: 29  EGPLVVLLHGFPES-SYSWRHQ--FGPLAAAGFRVVAPDQRGYGRSDRPESVDAYTILHL 85

Query: 85  AADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
             D + L+  LG    +V+G+  GA +A    L  P  VR V
Sbjct: 86  VGDVIGLIHALGEETAYVVGHDWGAPVAWHTALLRPDVVRGV 127


>gi|229088599|ref|ZP_04220257.1| hypothetical protein bcere0022_47700 [Bacillus cereus Rock3-44]
 gi|228694737|gb|EEL48055.1| hypothetical protein bcere0022_47700 [Bacillus cereus Rock3-44]
          Length = 313

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 4/122 (3%)

Query: 7   FFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           FF     Y+ +  + GDK+ P +   HGL S   T   F    + L D+ + +++FD  G
Sbjct: 23  FFVELNGYKVSVCEWGDKNNPQMTCFHGLGS---TKLSFIEVAERLKDK-YHIVSFDLPG 78

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           HGK+     + DY    +    V+LLE +G    H++ +S GA +A   V   P  VR +
Sbjct: 79  HGKTSSFENDEDYGASHLTNWVVALLEKIGRETFHIVAHSWGASVALHYVAERPEKVRKM 138

Query: 127 IL 128
           +L
Sbjct: 139 VL 140


>gi|302608258|emb|CBW44699.1| putative hydrolases or acyltransferases (alpha/beta hydrolase
           superfamily) [Marinobacter hydrocarbonoclasticus]
          Length = 264

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 59/110 (53%), Gaps = 7/110 (6%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+HGL  S++      G I    + G+++ A D   HG S  +   +D     MA D 
Sbjct: 16  LILLHGLFGSLEN----LGGIARRLEDGWQIHALDERNHGSSPHT---DDMDYPAMAEDV 68

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDS 138
           ++ L+  GI K  ++G+SMG ++A  + L +P  VRS+I+  +  V Y +
Sbjct: 69  IAYLDAQGIEKASLLGHSMGGKVAMQVALKHPERVRSLIVADISPVTYKA 118


>gi|7531037|sp|Q59695|ACOC_PSEPU RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of acetoin cleaving system; AltName:
           Full=Acetoin dehydrogenase E2 component; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           acetoin cleaving system
 gi|529563|gb|AAB58981.1| dihydrolipoamide acetyltransferase [Pseudomonas putida]
 gi|1093519|prf||2104227D dihydrolipoamide acetyltransferase
          Length = 370

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 63/111 (56%), Gaps = 6/111 (5%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++++G +    ++L+HG    +  NWLF+    L  ++  RVIA D  GHG+S K+    
Sbjct: 125 WFELGGEGGTPLVLVHGFGGDL-NNWLFN-HPALAAER--RVIALDLPGHGESAKALQRG 180

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D  L  ++   ++LL+HL I+K H+ G+SMG  ++ ++    P  V S+ L
Sbjct: 181 D--LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVAGLAPQRVASLSL 229


>gi|116198919|ref|XP_001225271.1| hypothetical protein CHGG_07615 [Chaetomium globosum CBS 148.51]
 gi|88178894|gb|EAQ86362.1| hypothetical protein CHGG_07615 [Chaetomium globosum CBS 148.51]
          Length = 303

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 53/112 (47%), Gaps = 5/112 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           +  +   G +  P IL I G   +    W            GFRV  FD  GHG+S++SY
Sbjct: 38  RLTYTQTGPRSGPPILFITGWRQAA-IEWRKQS--AYFSAAGFRVTTFDLRGHGESEESY 94

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
               YR+   AAD   LL HL + +V + G+SMG  +A +    YP+  + V
Sbjct: 95  F--GYRISRFAADLDDLLTHLNLHQVAIAGHSMGCSVAWAWWDQYPASRKRV 144


>gi|294632870|ref|ZP_06711429.1| epoxide hydrolase [Streptomyces sp. e14]
 gi|292830651|gb|EFF89001.1| epoxide hydrolase [Streptomyces sp. e14]
          Length = 320

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 3/104 (2%)

Query: 23  DKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           + + P ++L+HG   S ++ W        L + G+RV+A D  G+G+SD       Y ++
Sbjct: 19  EGEGPLVVLLHGFPESWRS-WRHQ--FGPLAEAGYRVVAPDQRGYGRSDHPAEVEAYTIL 75

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
            +  D V L+  LG  K +V+G+  GA +A    L  P  V  V
Sbjct: 76  HLVGDVVGLIRELGEEKAYVVGHDWGAPVAWHTALLRPDLVLGV 119


>gi|302525665|ref|ZP_07278007.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Streptomyces
           sp. AA4]
 gi|302434560|gb|EFL06376.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Streptomyces
           sp. AA4]
          Length = 281

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 73/154 (47%), Gaps = 7/154 (4%)

Query: 1   MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVI 60
           M  E  +  +    +  +++ G ++  T+LL+HG      + W   G    +  + +R +
Sbjct: 1   MTPEGSYADTAGGLRLHYHESGAENVETVLLLHGGGPGA-SAWSNFGRNLPVFGKSYRTL 59

Query: 61  AFDNLGHGKSDKSYIENDYRLVFMAADA-VSLLEHLGISKVHVMGYSMGARIACSMVLFY 119
           A D  G G+SDK      Y     ++DA V L++ LGI K H++G S+GA  A  + L +
Sbjct: 60  AIDQPGFGRSDKPTDHPQY--FRHSSDAIVGLMDRLGIEKAHLVGNSLGAGAAVRLALNH 117

Query: 120 PSYVRSVILGGVGSV---LYDSDVVDWQSLIDSF 150
           P     ++L G G +   L+  D  +   L+  F
Sbjct: 118 PGRAGRLVLMGAGGLSVNLFAPDPTEGVRLLSKF 151


>gi|116054209|ref|YP_788653.1| putative hydrolase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313111891|ref|ZP_07797681.1| putative hydrolase [Pseudomonas aeruginosa 39016]
 gi|115589430|gb|ABJ15445.1| putative hydrolase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310884183|gb|EFQ42777.1| putative hydrolase [Pseudomonas aeruginosa 39016]
          Length = 265

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 110/267 (41%), Gaps = 25/267 (9%)

Query: 2   MNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIA 61
           M  + F  +      A+   G  + P + L + + +++    ++   +  L    FRV+ 
Sbjct: 1   MGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLH---MWDAQLPALTRH-FRVLR 56

Query: 62  FDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS 121
           +D  GHG S  S     Y L  +  D + LL+ L + + H +G S+G  +   + L  P 
Sbjct: 57  YDARGHGAS--SVPPGPYTLARLGEDVLELLDALEVRRAHFLGLSLGGIVGQWLALHAPQ 114

Query: 122 YVRSVILGG--------------VGSVLYDSDVVDWQS-LIDSFLLPSIDEVQNPLGKKF 166
            +  ++L                + +VL   D+ D  +  + ++  P++ E   P+ ++F
Sbjct: 115 RIERLVLANTSAWLGPAAQWDERIAAVLQAEDMSDTAAGFLGNWFPPALLERAEPVVERF 174

Query: 167 RKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDL-AGSPQELMSFI 225
           R         +   LA   + +R    +  L RI+ P L+  G+ D + A S  EL++  
Sbjct: 175 RAMLM---ATNRHGLAGSFAAVRDTDLRAQLARIERPTLVIAGAYDTVTAASHGELIATS 231

Query: 226 PSSQYLNICRRDHLLAVGDKQFKQGVV 252
            +   L      HL  V   Q  +G V
Sbjct: 232 IAGARLVTLPAVHLSNVEFPQAFEGAV 258


>gi|322508581|gb|ADX04035.1| Lactonohydrolase [Acinetobacter baumannii 1656-2]
 gi|323518192|gb|ADX92573.1| alpha/beta superfamily hydrolase/acyltransferase [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 276

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 92/226 (40%), Gaps = 39/226 (17%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + D G +DAP I   HG   S   +W     +     +GFRV+A D  GHG+S + +  +
Sbjct: 14  YKDWGPRDAPVIFFHHGWPLS-SDDW--DAQMLFFLKEGFRVVAHDRRGHGRSTQVWDGH 70

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS--YVRSVILGGVGSVL 135
           D  +   A D   ++EHLG+     +G+S G       V  YP+    ++V++  V  ++
Sbjct: 71  D--MDHYADDVAVVVEHLGVQGAVHVGHSTGGGEVAHYVARYPNDPVAKAVLISAVPPLM 128

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP---- 191
                V  +S  D       D++QN L K   +F    P           + + +P    
Sbjct: 129 -----VKTESNPDGLPKEVFDDLQNQLFKNRSQFYHDVPAGPFYGYNRPGAKVSEPVVLN 183

Query: 192 -------------------FCQ----DDLYRIDVPVLIAVGSQDDL 214
                              F Q    +DL +I++PVLI  G  D +
Sbjct: 184 WWRQGMMGGAKAHYDGIVAFSQTDFTEDLKKIEIPVLILHGEDDQV 229


>gi|17988983|ref|NP_541616.1| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 1 str. 16M]
 gi|23500387|ref|NP_699827.1| 3-oxoadipate enol-lactone hydrolase [Brucella suis 1330]
 gi|62317507|ref|YP_223360.1| 3-oxoadipate enol-lactone hydrolase PcaL [Brucella abortus bv. 1
           str. 9-941]
 gi|83269489|ref|YP_418780.1| alpha/beta hydrolase [Brucella melitensis biovar Abortus 2308]
 gi|161620701|ref|YP_001594587.1| 3-oxoadipate enol-lactonase [Brucella canis ATCC 23365]
 gi|189022760|ref|YP_001932501.1| 3-oxoadipate enol-lactonase [Brucella abortus S19]
 gi|225629131|ref|ZP_03787164.1| 3-oxoadipate enol-lactonase [Brucella ceti str. Cudo]
 gi|237817058|ref|ZP_04596050.1| 3-oxoadipate enol-lactonase [Brucella abortus str. 2308 A]
 gi|254691003|ref|ZP_05154257.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 6 str. 870]
 gi|254695690|ref|ZP_05157518.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 3 str. Tulya]
 gi|254698787|ref|ZP_05160615.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699873|ref|ZP_05161701.1| 3-oxoadipate enol-lactonase [Brucella suis bv. 5 str. 513]
 gi|254705865|ref|ZP_05167693.1| 3-oxoadipate enol-lactonase [Brucella pinnipedialis M163/99/10]
 gi|254711094|ref|ZP_05172905.1| 3-oxoadipate enol-lactonase [Brucella pinnipedialis B2/94]
 gi|254712445|ref|ZP_05174256.1| 3-oxoadipate enol-lactonase [Brucella ceti M644/93/1]
 gi|254715518|ref|ZP_05177329.1| 3-oxoadipate enol-lactonase [Brucella ceti M13/05/1]
 gi|254732232|ref|ZP_05190810.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 4 str. 292]
 gi|256029475|ref|ZP_05443089.1| 3-oxoadipate enol-lactonase [Brucella pinnipedialis M292/94/1]
 gi|256043528|ref|ZP_05446455.1| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059164|ref|ZP_05449373.1| 3-oxoadipate enol-lactonase [Brucella neotomae 5K33]
 gi|256111442|ref|ZP_05452462.1| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 3 str. Ether]
 gi|256256188|ref|ZP_05461724.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 9 str. C68]
 gi|260167433|ref|ZP_05754244.1| 3-oxoadipate enol-lactonase [Brucella sp. F5/99]
 gi|260544742|ref|ZP_05820563.1| 3-oxoadipate enol-lactonase [Brucella abortus NCTC 8038]
 gi|260564725|ref|ZP_05835210.1| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 1 str. 16M]
 gi|260568075|ref|ZP_05838544.1| 3-oxoadipate enol-lactonase [Brucella suis bv. 4 str. 40]
 gi|260756597|ref|ZP_05868945.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 6 str. 870]
 gi|260760028|ref|ZP_05872376.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 4 str. 292]
 gi|260763267|ref|ZP_05875599.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261216092|ref|ZP_05930373.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 3 str. Tulya]
 gi|261217254|ref|ZP_05931535.1| 3-oxoadipate enol-lactonase [Brucella ceti M13/05/1]
 gi|261313294|ref|ZP_05952491.1| 3-oxoadipate enol-lactonase [Brucella pinnipedialis M163/99/10]
 gi|261318684|ref|ZP_05957881.1| 3-oxoadipate enol-lactonase [Brucella pinnipedialis B2/94]
 gi|261320125|ref|ZP_05959322.1| 3-oxoadipate enol-lactonase [Brucella ceti M644/93/1]
 gi|261750347|ref|ZP_05994056.1| 3-oxoadipate enol-lactonase [Brucella suis bv. 5 str. 513]
 gi|261756845|ref|ZP_06000554.1| 3-oxoadipate enol-lactonase [Brucella sp. F5/99]
 gi|294853570|ref|ZP_06794242.1| 3-oxoadipate enol-lactonase [Brucella sp. NVSL 07-0026]
 gi|297249549|ref|ZP_06933250.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 5 str. B3196]
 gi|17984819|gb|AAL53880.1| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 1 str. 16M]
 gi|23464006|gb|AAN33832.1| 3-oxoadipate enol-lactone hydrolase [Brucella suis 1330]
 gi|62197700|gb|AAX75999.1| PcaL, 3-oxoadipate enol-lactone hydrolase [Brucella abortus bv. 1
           str. 9-941]
 gi|82939763|emb|CAJ12764.1| Alpha/beta hydrolase fold:Esterase/lipase/thioesterase, active
           site:ATP/GTP-binding site motif A (P-loop):Alpha/beta
           hydrolase [Brucella melitensis biovar Abortus 2308]
 gi|161337512|gb|ABX63816.1| 3-oxoadipate enol-lactonase [Brucella canis ATCC 23365]
 gi|189021334|gb|ACD74055.1| 3-oxoadipate enol-lactonase [Brucella abortus S19]
 gi|225615627|gb|EEH12676.1| 3-oxoadipate enol-lactonase [Brucella ceti str. Cudo]
 gi|237787871|gb|EEP62087.1| 3-oxoadipate enol-lactonase [Brucella abortus str. 2308 A]
 gi|260098013|gb|EEW81887.1| 3-oxoadipate enol-lactonase [Brucella abortus NCTC 8038]
 gi|260152368|gb|EEW87461.1| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 1 str. 16M]
 gi|260154740|gb|EEW89821.1| 3-oxoadipate enol-lactonase [Brucella suis bv. 4 str. 40]
 gi|260670346|gb|EEX57286.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 4 str. 292]
 gi|260673688|gb|EEX60509.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676705|gb|EEX63526.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 6 str. 870]
 gi|260917699|gb|EEX84560.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 3 str. Tulya]
 gi|260922343|gb|EEX88911.1| 3-oxoadipate enol-lactonase [Brucella ceti M13/05/1]
 gi|261292815|gb|EEX96311.1| 3-oxoadipate enol-lactonase [Brucella ceti M644/93/1]
 gi|261297907|gb|EEY01404.1| 3-oxoadipate enol-lactonase [Brucella pinnipedialis B2/94]
 gi|261302320|gb|EEY05817.1| 3-oxoadipate enol-lactonase [Brucella pinnipedialis M163/99/10]
 gi|261736829|gb|EEY24825.1| 3-oxoadipate enol-lactonase [Brucella sp. F5/99]
 gi|261740100|gb|EEY28026.1| 3-oxoadipate enol-lactonase [Brucella suis bv. 5 str. 513]
 gi|294819225|gb|EFG36225.1| 3-oxoadipate enol-lactonase [Brucella sp. NVSL 07-0026]
 gi|297173418|gb|EFH32782.1| 3-oxoadipate enol-lactonase [Brucella abortus bv. 5 str. B3196]
          Length = 267

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 97/238 (40%), Gaps = 31/238 (13%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRV--IAFDNLGHGKSDKSYIENDYRL 81
            D P ++ I+ L +       F  W ++    G  V  + +D  GHG SD    +  Y +
Sbjct: 20  NDKPVLVFINSLGTD------FRIWNKVRARLGHDVSTLVYDKRGHGLSDIG--KTPYTI 71

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +A D ++LL+ L I K  + G S+G  IA  +    P  V  ++L      +   ++ 
Sbjct: 72  ELLAQDLIALLDRLSIHKAVICGLSVGGLIAQGLYAARPDLVAGLVLSNTAHKIGTPEM- 130

Query: 142 DWQSLIDSFLLPSIDEV-------------QNPLGKKFRKFADLDPGNDLKALASCLSMI 188
            W + ID+ +   +  +             + P    ++ + ++     L+  A+  + +
Sbjct: 131 -WNARIDAIMQNGLASILDATMPRWFTAAYRRPDNAAYQAYCNMFTRQPLEGYAATCAAL 189

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRDHLLAV 242
           R        ++I VPV    G QD    +P    QEL S IP + +  I    H+  V
Sbjct: 190 RDADFTAAAHKISVPVRCVAGDQD--GSTPPTLVQELASLIPGAVFSQIANSGHIPCV 245


>gi|148652807|ref|YP_001279900.1| alpha/beta hydrolase fold protein [Psychrobacter sp. PRwf-1]
 gi|148571891|gb|ABQ93950.1| alpha/beta hydrolase fold [Psychrobacter sp. PRwf-1]
          Length = 285

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 113/267 (42%), Gaps = 30/267 (11%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           FA+ + G ++  T ++     ++V  NW     I     Q   V+AFDN G G S     
Sbjct: 25  FAYREYGQQNGGTPIIFLNHLAAVLDNW--DPRIMDGIAQTHHVVAFDNRGVGASTGRVA 82

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
           E+   +  MA DA++ ++  G  KV + G+SMG  I+  + L  PS VR +++ G G   
Sbjct: 83  ES---IEQMADDAITFIKAKGFDKVDLFGFSMGGMISQEIALKKPSLVRKMVISGTGPA- 138

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPL----------GKKFRK---------FADLDPGN 176
               +     + +  LL  +   Q+P           GK+  K           DLD   
Sbjct: 139 GGRGISKVNRVANFELLRGLLTRQDPKVFLFFTRTDNGKRAAKAFIQHINERTQDLDKKI 198

Query: 177 DLKALASCLSMIRKPFCQD--DLYRIDVPVLIAVGSQDDLAGS--PQELMSFIPSSQYLN 232
            + A  + L  ++K   ++  DL  I  P L+A G  D +  +    +L   +P+SQ + 
Sbjct: 199 TIAAYRAQLKALKKWGNKNPVDLSVIKQPTLVANGEHDRMVPTLNTYDLAKRLPNSQLII 258

Query: 233 ICRRDH-LLAVGDKQFKQGVVNFYANE 258
                H  +    K F +  +NF AN 
Sbjct: 259 YPDAGHGGIFQNHKDFIKQTLNFLANN 285


>gi|226946207|ref|YP_002801280.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Azotobacter vinelandii DJ]
 gi|226721134|gb|ACO80305.1| dihydrolipoamide acetyltransferase,acetoin dehydrogeanse E2
           component, AcoC [Azotobacter vinelandii DJ]
          Length = 370

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           F D G+   P +LL+HG    +  NWLF+    L  D+  RVIA D  GHG+S K+    
Sbjct: 125 FLDRGEGGIP-LLLVHGFGGDL-NNWLFN-HEALAADR--RVIALDLPGHGESGKTLKSG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D  L  ++   ++LL+HL I + H+ G+SMG  ++ ++    P  V S+ L
Sbjct: 180 D--LDELSRAVLALLDHLDIPRAHLAGHSMGGAVSLNLARLAPERVVSLSL 228


>gi|330821158|ref|YP_004350020.1| alpha/beta hydrolase fold protein [Burkholderia gladioli BSR3]
 gi|327373153|gb|AEA64508.1| alpha/beta hydrolase fold protein [Burkholderia gladioli BSR3]
          Length = 280

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 103/233 (44%), Gaps = 55/233 (23%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++ IHG+ S ++    + G I  L  +GFRV++FD  GHG+S++  ++  Y +     D 
Sbjct: 36  LVCIHGVGSYLEA---WQGAINAL-GRGFRVLSFDLRGHGRSER--VKGRYEIDDFVGDV 89

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL-------------------- 128
           ++L +H G ++  + G+S+G  IA  + L +P+ +R ++L                    
Sbjct: 90  LALADHAGFTRFDLAGFSLGGLIAQRLALTHPARLRRLVLLATVAGRTAEERARVAERLA 149

Query: 129 ---GGVGSVLYDSDVVDWQSLIDSFLLPS-IDEVQNPLGKKFRKFADLDPGNDLKALASC 184
               G     YD+ +  W S       P+ +DE++       R+ A  DP         C
Sbjct: 150 ALQAGERGAHYDASLSRWLSEDFQARHPALVDELR-------RRNARNDP--------DC 194

Query: 185 LSMIRKPFCQDD----LYRIDVPVLIAVGSQDDLAGSPQELMSF----IPSSQ 229
            +   +   Q D    + +I +P LIA G  D  AGS   +  +    IP S+
Sbjct: 195 YAAAYRVLAQTDFGGLIDQIAMPTLIATGECD--AGSNPRMARYMHERIPDSR 245


>gi|265999086|ref|ZP_05464971.2| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 2 str. 63/9]
 gi|263092172|gb|EEZ16469.1| 3-oxoadipate enol-lactonase [Brucella melitensis bv. 2 str. 63/9]
          Length = 253

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 97/238 (40%), Gaps = 31/238 (13%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRV--IAFDNLGHGKSDKSYIENDYRL 81
            D P ++ I+ L +       F  W ++    G  V  + +D  GHG SD    +  Y +
Sbjct: 6   NDKPVLVFINSLGTD------FRIWNKVRARLGHDVSTLVYDKRGHGLSDIG--KTPYTI 57

Query: 82  VFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVV 141
             +A D ++LL+ L I K  + G S+G  IA  +    P  V  ++L      +   ++ 
Sbjct: 58  ELLAQDLIALLDRLSIHKAVICGLSVGGLIAQGLYAARPDLVAGLVLSNTAHKIGTPEM- 116

Query: 142 DWQSLIDSFLLPSIDEV-------------QNPLGKKFRKFADLDPGNDLKALASCLSMI 188
            W + ID+ +   +  +             + P    ++ + ++     L+  A+  + +
Sbjct: 117 -WNARIDAIMQNGLASILDATMPRWFTAAYRRPDNAAYQAYCNMFTRQPLEGYATTCAAL 175

Query: 189 RKPFCQDDLYRIDVPVLIAVGSQDDLAGSP----QELMSFIPSSQYLNICRRDHLLAV 242
           R        ++I VPV    G QD    +P    QEL S IP + +  I    H+  V
Sbjct: 176 RDADFTAAAHKISVPVRCVAGDQD--GSTPPTLVQELASLIPGAVFSQIANSGHIPCV 231


>gi|295700301|ref|YP_003608194.1| alpha/beta hydrolase [Burkholderia sp. CCGE1002]
 gi|295439514|gb|ADG18683.1| alpha/beta hydrolase fold protein [Burkholderia sp. CCGE1002]
          Length = 294

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 4/130 (3%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFD 63
           V+     R+ Q  + DVG +   T++++HG  +   T W  F+  ++ L   G+RVI  D
Sbjct: 20  VRITEDGREMQLHYNDVG-QGKETVVMLHGSGAGA-TGWANFNRNVEPLVAAGYRVILMD 77

Query: 64  NLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYV 123
            LG GKSD    +   R    A    +LL+ L I + H++G SMG   A +  L  P  V
Sbjct: 78  CLGWGKSDPIVCKGS-RSELNARCLKALLDALDIERAHLIGNSMGGHSAVAFALLEPKRV 136

Query: 124 RSVILGGVGS 133
             ++L G G+
Sbjct: 137 GKLVLMGGGT 146


>gi|167044232|gb|ABZ08913.1| putative alpha/beta hydrolase fold [uncultured marine microorganism
           HF4000_APKG5H11]
          Length = 332

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
            F + + GD   PT++++HG++    + W F   + L     + VIA D  GHG +D + 
Sbjct: 67  NFHYLEWGDPANPTLVMLHGVSQQAHS-WDF---VSLALSPDYHVIAVDQRGHGDTDWA- 121

Query: 75  IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
            +  Y L  M AD   ++E LG++  ++MG+SMG R +      +P  +RS+ +   G
Sbjct: 122 ADGVYSLDSMQADIDGVVEVLGLNDFNLMGHSMGGRNSFIWASRHPGMLRSLTIVDTG 179


>gi|86159361|ref|YP_466146.1| Alpha/beta hydrolase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775872|gb|ABC82709.1| Alpha/beta hydrolase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 345

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 54/106 (50%), Gaps = 14/106 (13%)

Query: 28  TILLIHGLASSVQTNWLFSGW---IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF- 83
           T+LL+HG       N+    W   I  L   GFRVIA D +G GKS K      Y+  F 
Sbjct: 82  TVLLLHG------KNFHAGTWAETIAALNRAGFRVIAPDQIGFGKSSKP---ERYQFSFA 132

Query: 84  -MAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            +AA+  +LL  LG+ +  V+G+SMG  +A    L YP     ++L
Sbjct: 133 QLAANTRALLASLGVERTAVVGHSMGGMLAVRYALEYPEATERLLL 178


>gi|291385851|ref|XP_002709497.1| PREDICTED: epoxide hydrolase 2, cytoplasmic [Oryctolagus cuniculus]
          Length = 555

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 3/106 (2%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           V     P + L HG   S   +W +   I  L   G+RV+A D  G+G+S       +Y 
Sbjct: 253 VEQGSGPAVCLCHGFPES-WFSWRYQ--IPALAQAGYRVLAVDMKGYGESSAPPEIEEYS 309

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           +  +  D V+ L++LGI +   +G+  G  +  SM LF+P  VR+V
Sbjct: 310 MEVLCKDMVTFLDNLGIPQAVFIGHDWGGMLVWSMALFHPERVRAV 355


>gi|119478396|ref|ZP_01618404.1| epoxide hydrolase [marine gamma proteobacterium HTCC2143]
 gi|119448605|gb|EAW29851.1| epoxide hydrolase [marine gamma proteobacterium HTCC2143]
          Length = 363

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDY 79
           ++GD   P IL+ HG   S  + W     I+ L   G+RV+A D  G+GK+D     N Y
Sbjct: 61  EMGDT-GPLILMAHGWPESWYS-WRHQ--IRFLAAAGYRVVAPDMRGYGKTDAPLDVNSY 116

Query: 80  RLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131
            +  +A D + +L+ LG  +  ++G+  GA +A    L YP    S+I+  V
Sbjct: 117 DITTLAGDMIGVLDALGEEQATMVGHDWGAIVAAYSTLLYPERFSSLIIMSV 168


>gi|299771109|ref|YP_003733135.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter sp. DR1]
 gi|298701197|gb|ADI91762.1| Poly(3-hydroxyalkanoate) depolymerase [Acinetobacter sp. DR1]
          Length = 314

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 58/132 (43%), Gaps = 31/132 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKSDKSYIEN 77
           G  + PTILLI GL + +    LF  W    C    DQGFRVI FDN   G S K   E 
Sbjct: 35  GKPEHPTILLIMGLGAQM----LF--WPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHEG 88

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MA D   L++ LG++K HV+G SMG  IA  + 
Sbjct: 89  KRLNTVKLMGRFALGLGNQGAPYTLHDMADDVSMLIDRLGVNKAHVIGASMGGMIAQILA 148

Query: 117 LFYPSYVRSVIL 128
             YP  V  + L
Sbjct: 149 AKYPEKVEKLGL 160


>gi|77465032|ref|YP_354535.1| putative hydrolase [Rhodobacter sphaeroides 2.4.1]
 gi|77389450|gb|ABA80634.1| putative hydrolase [Rhodobacter sphaeroides 2.4.1]
          Length = 224

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 91/229 (39%), Gaps = 14/229 (6%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           + LIHG   S    W   GW   L   GF  +     GHG    S+   DY    +A D 
Sbjct: 4   VALIHGWGGSFAATWEADGWSDALRAAGFDPVGVTIAGHGPEGGSHDPADY--ADLAGDL 61

Query: 89  VSLLEHLGISKVH-VMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLI 147
            + L     + +H  +G+S+G ++   +    P     ++LGG+G  L+  +     +L+
Sbjct: 62  AAKLP----AGLHGAIGFSLGTKLLLELEARSPGRNGRLVLGGIGDNLFAPEAAG-PALV 116

Query: 148 DSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKP-FCQDDLYRIDVPVLI 206
            +  L        P       +A+    +D   LA+ L     P   +D L     P+LI
Sbjct: 117 AA--LRGEATTPPPQVAALLAYAEKS-ASDPACLAAILERPANPVLTEDRLATAQAPILI 173

Query: 207 AVGSQDDLAGSP-QELMSFIPSSQYLNICRRDHLLAVGDKQFKQGVVNF 254
              S+DD    P   L   +P + +  I    H+    D +F++  V F
Sbjct: 174 -FNSRDDAVAQPDTRLCRAMPHASHRLIEGPGHVALTSDARFREAAVEF 221


>gi|270156898|ref|ZP_06185555.1| hydrolase, alpha/beta fold family [Legionella longbeachae D-4968]
 gi|289164675|ref|YP_003454813.1| alpha/beta hydrolase fold protein [Legionella longbeachae NSW150]
 gi|269988923|gb|EEZ95177.1| hydrolase, alpha/beta fold family [Legionella longbeachae D-4968]
 gi|288857848|emb|CBJ11694.1| putative alpha/beta hydrolase fold protein [Legionella longbeachae
           NSW150]
          Length = 285

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 80/178 (44%), Gaps = 15/178 (8%)

Query: 14  YQFAFYDVGDKDAPTILL-IHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDK 72
           +   +Y+ GD + P +L+ +HGL  + +    F    Q+L    +RVI  D +G G SDK
Sbjct: 15  HNMTYYEWGDSNNPEVLVCVHGLFRNARD---FDDLAQVLSS-NYRVICPDMVGRGLSDK 70

Query: 73  SYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVG 132
                DY  +   +D   LL  LG+ K+  +G SMG  I   M     S ++ ++L  +G
Sbjct: 71  VCNPKDYSTLTYISDITILLAQLGVRKIDYLGTSMGGIIGMVMAAMKNSPIKKLVLNDIG 130

Query: 133 SVLYDSDVVDWQSLI------DSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASC 184
             +   D    Q ++       +    ++ EV+  L K +  F  L P    + LA C
Sbjct: 131 PFV---DTKALQRIVAYGKEGSARSFETLGEVEAYLKKTYSSFDQLSP-KQWQHLALC 184


>gi|154687207|ref|YP_001422368.1| YtxM [Bacillus amyloliquefaciens FZB42]
 gi|154353058|gb|ABS75137.1| YtxM [Bacillus amyloliquefaciens FZB42]
          Length = 274

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 105/248 (42%), Gaps = 33/248 (13%)

Query: 20  DVGDKDAPTILLIHGLASSVQTNWLF-SGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           D G + +  I+ +HG   S + +W+F  G        G R++  D LGHG++D       
Sbjct: 18  DSGHESSEAIVCLHGFTGS-KESWMFLRGMFP-----GERMVMIDCLGHGETDAPVQAAR 71

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL--- 135
           Y      AD  ++ + L + KV ++GYSMG R+A S    +P  V +++L      L   
Sbjct: 72  YSASRQVADLAAVFDQLKLHKVKLIGYSMGGRLAYSFAQAFPHRVSALVLESTTPGLSTL 131

Query: 136 --------YDSDVVDW------QSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG---NDL 178
                    D  + D+       S +D +    +   Q  L    +  A +  G   N+ 
Sbjct: 132 QERKKRIQSDRKLADFILREGITSFVDYWEGIPLFATQLSLPDSVK--ASIRAGRLKNNP 189

Query: 179 KALASCL---SMIRKPFCQDDLYRIDVPVLIAVGSQDD-LAGSPQELMSFIPSSQYLNIC 234
             LA  L       +P   + L+RI  PVL+  G  D+      Q++ + +PSS+   + 
Sbjct: 190 SGLAGSLLGMGTGSQPSWWEALHRIKAPVLLICGEWDEKFCAINQKVHNLLPSSKIEVVK 249

Query: 235 RRDHLLAV 242
           +  H + V
Sbjct: 250 QAGHTVHV 257


>gi|330999026|ref|ZP_08322751.1| hydrolase, alpha/beta domain protein [Parasutterella
           excrementihominis YIT 11859]
 gi|329575768|gb|EGG57294.1| hydrolase, alpha/beta domain protein [Parasutterella
           excrementihominis YIT 11859]
          Length = 298

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 113/279 (40%), Gaps = 54/279 (19%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F   +  +F +   GDK  P +LLI GL       W  S +I +L ++  RVI  DN   
Sbjct: 3   FAHLKTGRFHYEVFGDKQLPAVLLIMGLGMPA-AGWPRS-FISMLLEKSLRVITVDNRDA 60

Query: 68  GKSD--------------------KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSM 107
           G S+                    +  ++  Y L  MA D V LL+ L + + HV+G SM
Sbjct: 61  GLSEHFSHLKTSISVPAAIGRTLLRLPVQAPYLLEDMALDLVQLLDELKLQRAHVVGASM 120

Query: 108 GARIACSMVLFYPSYVRSV--ILGGVGS--------------VLYDSDVVD-------WQ 144
           G  I  ++    PS V S+  I+   G+              +++ SD+          +
Sbjct: 121 GGMIGQTLASIRPSRVASLTSIMSASGNPRTGFGKLRAIYSILMHSSDLSTEEGREKHLE 180

Query: 145 SLIDSFLLPSID---EVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRID 201
            +  +   PS +   + ++ L  +  ++       + + LA   S  R      D+ RI 
Sbjct: 181 RVFMTLKSPSYEYTAQEKHELLHEMSRYEIDQTAGERQLLAILASGDRS----SDIARIT 236

Query: 202 VPVLIAVGSQDDL--AGSPQELMSFIPSSQYLNICRRDH 238
            P L+  G  D L    + +E+   IP S++L + R  H
Sbjct: 237 APTLVIHGEDDPLLPLAAGKEVADLIPKSEFLALPRMGH 275


>gi|303256331|ref|ZP_07342347.1| alpha/beta hydrolase family protein [Burkholderiales bacterium
           1_1_47]
 gi|302861060|gb|EFL84135.1| alpha/beta hydrolase family protein [Burkholderiales bacterium
           1_1_47]
          Length = 306

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 113/279 (40%), Gaps = 54/279 (19%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
           F   +  +F +   GDK  P +LLI GL       W  S +I +L ++  RVI  DN   
Sbjct: 11  FAHLKTGRFHYEVFGDKQLPAVLLIMGLGMPA-AGWPRS-FISMLLEKSLRVITVDNRDA 68

Query: 68  GKSD--------------------KSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSM 107
           G S+                    +  ++  Y L  MA D V LL+ L + + HV+G SM
Sbjct: 69  GLSEHFSHLKTSISVPAAIGRTLLRLPVQAPYLLEDMALDLVQLLDELKLQRAHVVGASM 128

Query: 108 GARIACSMVLFYPSYVRSV--ILGGVGS--------------VLYDSDVVD-------WQ 144
           G  I  ++    PS V S+  I+   G+              +++ SD+          +
Sbjct: 129 GGMIGQTLASIRPSRVASLTSIMSASGNPRTGFGKLRAIYSILMHSSDLSTEEGREKHLE 188

Query: 145 SLIDSFLLPSID---EVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRID 201
            +  +   PS +   + ++ L  +  ++       + + LA   S  R      D+ RI 
Sbjct: 189 RVFMTLKSPSYEYTAQEKHELLHEMSRYEIDQTAGERQLLAILASGDRS----SDIARIT 244

Query: 202 VPVLIAVGSQDDL--AGSPQELMSFIPSSQYLNICRRDH 238
            P L+  G  D L    + +E+   IP S++L + R  H
Sbjct: 245 APTLVIHGEDDPLLPLAAGKEVADLIPKSEFLALPRMGH 283


>gi|209525645|ref|ZP_03274183.1| alpha/beta hydrolase fold protein [Arthrospira maxima CS-328]
 gi|209493978|gb|EDZ94295.1| alpha/beta hydrolase fold protein [Arthrospira maxima CS-328]
          Length = 268

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 6/121 (4%)

Query: 10  SWRKYQFAFYDV--GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGH 67
            WR   ++FY    GD+  P ILL+HG   + +    F   I  L D  F  +  D  G 
Sbjct: 3   QWRVGCYSFYGELKGDRTQPIILLLHGFMGNCRD---FDLAISSLPDD-FCCLTIDLPGQ 58

Query: 68  GKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVI 127
           GK+     +  Y++  +A+  + LL++L I    ++GYSMG R+   ++L YP+  +  I
Sbjct: 59  GKTQVLAGDEAYKMPAIASGLIGLLDYLKIDNCVLVGYSMGGRLGLYLILHYPTRFKQAI 118

Query: 128 L 128
           L
Sbjct: 119 L 119


>gi|313496927|gb|ADR58293.1| AcoC [Pseudomonas putida BIRD-1]
          Length = 368

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 64/111 (57%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++++G+   P ++L+HG    +  NWLF+    L  ++  RVIA D  GHG+S K+    
Sbjct: 125 WFELGEGGTP-LVLVHGFGGDL-NNWLFN-HPALAAER--RVIALDLPGHGESAKALQRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D  L  ++   ++LL+HL I+K H+ G+SMG  ++ ++    P  V S+ L
Sbjct: 180 D--LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSL 228


>gi|312960392|ref|ZP_07774901.1| Arylesterase [Pseudomonas fluorescens WH6]
 gi|311285277|gb|EFQ63849.1| Arylesterase [Pseudomonas fluorescens WH6]
          Length = 272

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 84/192 (43%), Gaps = 32/192 (16%)

Query: 49  IQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMG 108
           ++ L  +G+R IAFD  G G+SD+ +  NDY     A D   L+EHL +  V ++G+SMG
Sbjct: 40  MEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYNT--FADDIAQLIEHLDLKDVTLVGFSMG 97

Query: 109 -------------ARIACSMVLF-----------YPSYVRSVILGGVGSVLYDSDVVDWQ 144
                        AR+A  ++L            YP  V + +  G+ + L    + D  
Sbjct: 98  GGDVSRYIARHGSARVAGLVLLGAVTPIFGQTADYPQGVPAEVFAGIEAGL----LKDRA 153

Query: 145 SLIDSFLLP--SIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDV 202
             I  F  P   +++ Q        +   +     LK+   C++   +   + D+ +IDV
Sbjct: 154 QFISDFNTPFFGLNKGQVVSEGTLSQTLQIAMLASLKSTVDCVTAFSETDFRPDMAKIDV 213

Query: 203 PVLIAVGSQDDL 214
           P L+  G  D +
Sbjct: 214 PTLVIHGDGDQI 225


>gi|326331387|ref|ZP_08197677.1| epoxide hydrolase [Nocardioidaceae bacterium Broad-1]
 gi|325950643|gb|EGD42693.1| epoxide hydrolase [Nocardioidaceae bacterium Broad-1]
          Length = 333

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + + G  D P +LL+HG   S   +W     I  L D G+R +A D  G+G S K     
Sbjct: 20  WVESGPPDGPLVLLVHGFPES-WYSWRHQ--IAALADAGYRTVAIDVRGYGGSSKPDAIE 76

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           DYR++    D V L+  LG     ++G+  GA IA +     P    +V
Sbjct: 77  DYRMLRHVGDNVGLVHALGARTATIVGHDWGAPIAWTSAQLRPDVFTAV 125


>gi|291523477|emb|CBK81770.1| Predicted hydrolases or acyltransferases (alpha/beta hydrolase
           superfamily) [Coprococcus catus GD/7]
          Length = 231

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 55  QGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACS 114
           + +RVI  D  GHGKS +      + +   A D    ++ L ISK  ++G+S GA IA  
Sbjct: 38  RNYRVIVVDTRGHGKSPRGTA--SFTIAQFAKDLHDFMDELDISKAVILGFSDGANIAMK 95

Query: 115 MVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLGKKF-RKFADLD 173
            VL YP  V+++IL G                ++   +  I ++   +G     KFA   
Sbjct: 96  FVLKYPERVKALILNG--------------GNLNPKGVKPITQIPIEIGYGIASKFASKS 141

Query: 174 PGNDLKALASCLSMIRKPFCQ-DDLYRIDVPVLIAVGSQDDLAGS-PQELMSFIPSSQYL 231
            G    A    L M+  P  + ++L +I VP L+  G++D +  S  +E+   +P+++ L
Sbjct: 142 AGARKNAEMLGL-MVNDPNIEAEELSKITVPTLVISGTKDMIKESHTKEIAKALPNAK-L 199

Query: 232 NICRRDHLLA 241
            I    H +A
Sbjct: 200 AIIEGSHFIA 209


>gi|209548403|ref|YP_002280320.1| alpha/beta hydrolase fold [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534159|gb|ACI54094.1| alpha/beta hydrolase fold [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 267

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 105/247 (42%), Gaps = 29/247 (11%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYI 75
           +A Y  G    P ILL  GL  S   NW +   +  L + G RV+  D+ GHG+S +   
Sbjct: 37  YASYGAG---PPVILLHGGLGHS--GNWGYQ--LPALLESGRRVVLIDSRGHGRSTRDAR 89

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
              Y L  MA+D + +++ L + K   +G+S GA IA  +    PS V  V         
Sbjct: 90  PYTYEL--MASDVLDVMDELRLEKAAFIGWSDGACIALILAATAPSRVDGVFFFACN--- 144

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPG-NDLKALASCLSMIRKP--- 191
                +D    ++    P ID       +  R +A L    +D  +    +S++ +    
Sbjct: 145 -----MDPSGTLEFVPTPVIDRC---FSRHARDYAALSATPDDFNSFVEAVSLMMRTEPN 196

Query: 192 FCQDDLYRIDVPVLIAVGSQDDLAGSPQE---LMSFIPSSQYLNICRRDHLLAVG-DKQF 247
           +   DL RI VPV I +G  D+    P+    L   IP ++ + +    H   +    +F
Sbjct: 197 YQAGDLNRIRVPVAIVLGEHDEFI-KPEHAEYLARSIPDAEMIYLEGVSHFAPLQRPAEF 255

Query: 248 KQGVVNF 254
              V++F
Sbjct: 256 NAAVLSF 262


>gi|262279906|ref|ZP_06057691.1| alpha/beta hydrolase fold protein EstB [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260257|gb|EEY78990.1| alpha/beta hydrolase fold protein EstB [Acinetobacter calcoaceticus
           RUH2202]
          Length = 314

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 58/132 (43%), Gaps = 31/132 (23%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLC----DQGFRVIAFDNLGHGKSDKSYIEN 77
           G  + PTILLI GL + +    LF  W    C    DQGFRVI FDN   G S K   E 
Sbjct: 35  GKPEHPTILLIMGLGAQM----LF--WPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHEG 88

Query: 78  D---------------------YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMV 116
                                 Y L  MA D   L++ LG++K HV+G SMG  IA  + 
Sbjct: 89  KRLNTVKLMGRFALGLTNQGAPYTLHDMADDVSMLIDRLGVNKAHVIGASMGGMIAQILA 148

Query: 117 LFYPSYVRSVIL 128
             YP  V  + L
Sbjct: 149 AKYPEKVEKLGL 160


>gi|126090150|ref|YP_001041631.1| hypothetical protein Sbal_4513 [Shewanella baltica OS155]
 gi|126174443|ref|YP_001050592.1| alpha/beta hydrolase fold domain-containing protein [Shewanella
           baltica OS155]
 gi|125997648|gb|ABN61723.1| alpha/beta hydrolase fold [Shewanella baltica OS155]
 gi|125999806|gb|ABN63876.1| hypothetical protein Sbal_4513 [Shewanella baltica OS155]
          Length = 258

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (52%), Gaps = 7/117 (5%)

Query: 21  VGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYR 80
           V     P +LLIHGL  ++       G  Q+L  Q ++VI  D   HG S+  + E DY 
Sbjct: 4   VSTGQGPAVLLIHGLFGNLDN---LKGLGQVLESQ-YQVIRVDVPNHGLSEH-WDEMDYP 58

Query: 81  LVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
              +A   V+LL+ L I + H++G+SMG +IA +  L +P  + S++   +  V Y+
Sbjct: 59  R--LATAMVALLDELAIERAHIVGHSMGGKIAMATALAFPERIISMVAADIAPVAYE 113


>gi|111222823|ref|YP_713617.1| putative hydrolase [Frankia alni ACN14a]
 gi|111150355|emb|CAJ62052.1| putative hydrolase [Frankia alni ACN14a]
          Length = 297

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 6/111 (5%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           + + G  DAP +L++HG     +T   F+  I  L    FR IA D +G+G S K   + 
Sbjct: 33  YVEAGSPDAPAVLMLHGTGGHWET---FAPTIGPLSKH-FRCIAVDMVGNGFSSKP--DY 86

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           DY +       + LL+ LG+   +++G S+GA +A  + +  P  VR +IL
Sbjct: 87  DYEIAVYERHLLGLLDALGVQTTYIIGMSLGAWVAARLAIDEPDRVRKLIL 137


>gi|26987291|ref|NP_742716.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas putida KT2440]
 gi|24981936|gb|AAN66180.1|AE016245_9 acetoin dehydrogenase, dihydrolipoamide acetyltransferase component
           [Pseudomonas putida KT2440]
          Length = 368

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 64/111 (57%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++++G+   P ++L+HG    +  NWLF+    L  ++  RVIA D  GHG+S K+    
Sbjct: 125 WFELGEGGTP-LVLVHGFGGDL-NNWLFN-HPALAAER--RVIALDLPGHGESAKALQRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D  L  ++   ++LL+HL I+K H+ G+SMG  ++ ++    P  V S+ L
Sbjct: 180 D--LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSL 228


>gi|312138147|ref|YP_004005483.1| 2-hydroxymuconate-semialdehyde hydrolase [Rhodococcus equi 103S]
 gi|325674948|ref|ZP_08154635.1| 2-hydroxy-6-phenylhexa-2,4-dienoic acid hydrolase [Rhodococcus equi
           ATCC 33707]
 gi|311887486|emb|CBH46798.1| 2-hydroxymuconate-semialdehyde hydrolase [Rhodococcus equi 103S]
 gi|325554534|gb|EGD24209.1| 2-hydroxy-6-phenylhexa-2,4-dienoic acid hydrolase [Rhodococcus equi
           ATCC 33707]
          Length = 301

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSY 74
           +  +++ G  + PTI+L+HG      +   F+  I +L  Q F VIA D  G+G+SDK  
Sbjct: 23  KLHYHEAGVGNGPTIVLLHGGGPGASSWSNFAKNIPVLAQQ-FHVIAVDQPGYGRSDKPT 81

Query: 75  IENDYRLVFMAADAVSLLEHLGIS-KVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGS 133
               Y     A+    LL+ +GI+ +VH++G S+G   A    L YP     ++L G G 
Sbjct: 82  EHPQY-FRHSASALKDLLDTIGITERVHLLGNSLGGGAAVRFALDYPDRAGRLVLMGPGG 140

Query: 134 V 134
           +
Sbjct: 141 L 141


>gi|331681746|ref|ZP_08382379.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli H299]
 gi|331080948|gb|EGI52113.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli H299]
          Length = 288

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L   G+RVI  D  G GKS
Sbjct: 22  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVKAGYRVILLDCPGWGKS 79

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 80  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 138

Query: 131 VGS 133
            G+
Sbjct: 139 GGT 141


>gi|300775118|ref|ZP_07084980.1| alpha/beta hydrolase [Chryseobacterium gleum ATCC 35910]
 gi|300505858|gb|EFK36994.1| alpha/beta hydrolase [Chryseobacterium gleum ATCC 35910]
          Length = 300

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 62/126 (49%), Gaps = 21/126 (16%)

Query: 22  GDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS----------D 71
           G+K+   I+LI GL S +   W  + +  LL ++GFRVI FDN   G S          D
Sbjct: 23  GEKNTENIILISGLGSQM-IRWDIA-FCNLLVEKGFRVIRFDNRDSGCSVYNAKREIPAD 80

Query: 72  KSYIEN---------DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSY 122
           KS  E           Y L+ MA D + LL++L I K H+ G SMG  IA  +   YP  
Sbjct: 81  KSIEEVFAALSKEGIPYSLMDMANDVIGLLDYLKIEKAHIAGRSMGGIIAQLLGSNYPER 140

Query: 123 VRSVIL 128
           V S+ +
Sbjct: 141 VLSLTI 146


>gi|326794653|ref|YP_004312473.1| pyrimidine utilization protein D [Marinomonas mediterranea MMB-1]
 gi|326545417|gb|ADZ90637.1| pyrimidine utilization protein D [Marinomonas mediterranea MMB-1]
          Length = 258

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 16  FAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNLGHGKSDKS 73
           F      D  A T++L  GL  S       + W   L +  Q +RV+ +D LG G+S  +
Sbjct: 3   FEVLGSTDPSAQTVVLSSGLGGSA------NFWKPQLSELTQLYRVVVYDQLGTGRS-PA 55

Query: 74  YIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
            + + YR+  MA + + LL+H GI   HV+G+++G  +A  M L  P  + S++L
Sbjct: 56  VLPDQYRISNMADELLELLDHAGIQTCHVVGHALGGLVAMEMALKQPERLTSMVL 110


>gi|148545842|ref|YP_001265944.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas putida F1]
 gi|148509900|gb|ABQ76760.1| alpha/beta hydrolase fold [Pseudomonas putida F1]
          Length = 368

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 64/111 (57%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++++G+   P ++L+HG    +  NWLF+    L  ++  RVIA D  GHG+S K+    
Sbjct: 125 WFELGEGGTP-LVLVHGFGGDL-NNWLFN-HPALAAER--RVIALDLPGHGESAKALQRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D  L  ++   ++LL+HL I+K H+ G+SMG  ++ ++    P  V S+ L
Sbjct: 180 D--LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSL 228


>gi|56421409|ref|YP_148727.1| hypothetical protein GK2874 [Geobacillus kaustophilus HTA426]
 gi|56381251|dbj|BAD77159.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 270

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 9/106 (8%)

Query: 25  DAPTILLIHGLASSVQTNW--LFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLV 82
           +   +LL+HG   S  T W  L   W        FRV+A D LGHG+++       YR+ 
Sbjct: 17  EGEPLLLLHGFTGSADT-WRPLAPFWPD------FRVMAVDLLGHGRTEAPKDARRYRIE 69

Query: 83  FMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
             AAD  +LL+  G+ +V+V+GYSMG R+A +  +++P  VR ++L
Sbjct: 70  HAAADLAALLDEWGVEQVNVLGYSMGGRLALAFAVWHPRRVRRLVL 115


>gi|54022392|ref|YP_116634.1| putative hydrolase [Nocardia farcinica IFM 10152]
 gi|54013900|dbj|BAD55270.1| putative hydrolase [Nocardia farcinica IFM 10152]
          Length = 249

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 101/244 (41%), Gaps = 24/244 (9%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
            YD G   AP ILL+HGL  S +T   ++G +  L   G  V  FD  GHG+     +  
Sbjct: 2   LYDEGGAGAP-ILLLHGLMGSART---WAGHLDWLRGHG-HVYTFDAAGHGRPAPPELTT 56

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYD 137
           +  +  +A     + E +      V+G+SMG          +P  VR++++  +      
Sbjct: 57  EAFVADLAEATAGIGEPMA-----VIGHSMGGLHGWVFAAHHPERVRALVVEDIAPDFTG 111

Query: 138 SDVVDWQSLIDSF--LLPSIDEVQN---PLGKKF--RKFADLDPGNDLKALASCLSMIRK 190
               DW ++I+S+    P  D V +   P+  ++    F     G  L    +    I +
Sbjct: 112 RTAADWAAMIESWPQPFPDADAVLSYFGPVAGRYFLNSFEHGPQGYRLHGSVATFRDISE 171

Query: 191 PFCQDDLY----RIDVPVLIAVGSQD-DLAGSPQELMSFIPSSQYLNICRRDHLLAVGDK 245
            +     +     + VP L+  G       G  +E+ +  P ++Y+ +    HL  V D+
Sbjct: 172 EWGGRSFWAEWRAVRVPALLIEGEHTITPPGQMREMAAVNPHAEYVRVAGAGHL--VHDE 229

Query: 246 QFKQ 249
           Q ++
Sbjct: 230 QPRR 233


>gi|218688220|ref|YP_002396432.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli ED1a]
 gi|254810988|sp|B7MPB6|MHPC_ECO81 RecName: Full=2-hydroxy-6-oxononadienedioate/2-hydroxy-6-
           oxononatrienedioate hydrolase; AltName:
           Full=2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid
           5,6-hydrolase; AltName:
           Full=2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid
           5,6-hydrolase
 gi|218425784|emb|CAR06588.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Escherichia
           coli ED1a]
          Length = 293

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWL-FSGWIQLLCDQGFRVIAFDNLGHGKS 70
           +  +  F D G  D  T++L+HG      T W  FS  I  L   G+RVI  D  G GKS
Sbjct: 27  KTLRIHFNDCGQGDE-TVVLLHGSGPGA-TGWANFSRNIDPLVKAGYRVILLDCPGWGKS 84

Query: 71  DKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGG 130
           D S + +  R    A    S+++ L I+K+H++G SMG   + +  L +P  V  ++L G
Sbjct: 85  D-SIVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMG 143

Query: 131 VGS 133
            G+
Sbjct: 144 GGT 146


>gi|291618810|ref|YP_003521552.1| MhpC [Pantoea ananatis LMG 20103]
 gi|291153840|gb|ADD78424.1| MhpC [Pantoea ananatis LMG 20103]
 gi|327395137|dbj|BAK12559.1| arylesterase MhpC [Pantoea ananatis AJ13355]
          Length = 281

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 112/276 (40%), Gaps = 33/276 (11%)

Query: 5   VKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDN 64
           +  F+S   Y   + D G K  P +L  HG         ++   +  L ++G+R IAFD 
Sbjct: 10  MSLFKSKDGYNLYYKDWG-KGQP-VLFSHGWPLDAD---MWDSQLNFLAERGYRAIAFDR 64

Query: 65  LGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPS--Y 122
            G G+SD+ +   DY     A D   L+EHL +  V ++G+SMG       +  Y +   
Sbjct: 65  RGFGRSDQPWDGYDYDT--FADDIHCLIEHLQLRDVTLIGFSMGGGDVSRYIGKYGTDKV 122

Query: 123 VRSVILGGVGSVLYDSD------------------VVDWQSLIDSFLLP--SIDEVQNPL 162
            + V+LG V  +   +D                  + D    I+ F  P    +  Q   
Sbjct: 123 KKLVLLGAVTPIFGQTDDHPEGVEKSVFDGIKQGLLKDRAQFINEFAAPFYGTNAGQQVS 182

Query: 163 GKKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLA---GSPQ 219
                +  ++     LKA   C++   +   + DL ++DVP LI  GS D +     + +
Sbjct: 183 EGVLTQTLNIALLASLKATLDCVTAFAETDFRADLGKVDVPALIIHGSHDQIVPFEATGK 242

Query: 220 ELMSFIPSSQYLNICRRDHLLAVGDK-QFKQGVVNF 254
              + IP S+        H  AV  + Q  Q ++ F
Sbjct: 243 LAHALIPGSELKIYDNGPHGFAVTHQDQLNQDLLTF 278


>gi|120404956|ref|YP_954785.1| alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]
 gi|119957774|gb|ABM14779.1| epoxide hydrolase, Serine peptidase, MEROPS family S33
           [Mycobacterium vanbaalenii PYR-1]
          Length = 351

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 19  YDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEND 78
           + V + + P ++LIHG   S   +W     I  L   G+RV+A D  G+G+S K  ++  
Sbjct: 16  HAVEEGEGPLVVLIHGFPES-WYSWRHQ--IPALAAAGYRVVAIDQRGYGRSSKYRVQKA 72

Query: 79  YRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           YR+  +  D V +++  G+ +  V+G+  GA +A +    +P     V
Sbjct: 73  YRIKELVGDIVGVIDAYGVERAVVVGHDWGAPVAWTFAWLHPQRCAGV 120


>gi|325104529|ref|YP_004274183.1| alpha/beta hydrolase fold protein [Pedobacter saltans DSM 12145]
 gi|324973377|gb|ADY52361.1| alpha/beta hydrolase fold protein [Pedobacter saltans DSM 12145]
          Length = 332

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 16/131 (12%)

Query: 5   VKFFRSWRKYQFAFYDVGDK--DAPTILLIHGLASSVQTNWLFSGW---IQLLCDQGFRV 59
           ++F    +  + A+ D+  +  +   ILL+HG       N+  + W   I+ L  +GFRV
Sbjct: 43  LEFISQNQPLKMAYMDIQPEKPNGRNILLLHG------KNFNGAYWERTIKFLTTEGFRV 96

Query: 60  IAFDNLGHGKSDKSYIENDYRLVF--MAADAVSLLEHLGISKVHVMGYSMGARIACSMVL 117
           I  D +G GKS K      Y+  F  +A +  S+L+ L I    V+G+SMG  +A    L
Sbjct: 97  IVPDQIGFGKSTKP---QSYQYSFNQLAENTKSILDKLQIKDAMVLGHSMGGMLATRFAL 153

Query: 118 FYPSYVRSVIL 128
            YP + + +IL
Sbjct: 154 MYPDFTKKLIL 164


>gi|167031614|ref|YP_001666845.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pseudomonas putida GB-1]
 gi|166858102|gb|ABY96509.1| alpha/beta hydrolase fold [Pseudomonas putida GB-1]
          Length = 368

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 64/111 (57%), Gaps = 7/111 (6%)

Query: 18  FYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIEN 77
           ++++G+   P ++L+HG    +  NWLF+    L  ++  RVIA D  GHG+S K+    
Sbjct: 125 WFELGEGGTP-LVLVHGFGGDL-NNWLFN-HPALAAER--RVIALDLPGHGESAKALQRG 179

Query: 78  DYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVIL 128
           D  L  ++   ++LL+HL I+K H+ G+SMG  ++ ++    P  V S+ L
Sbjct: 180 D--LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSL 228


>gi|331698805|ref|YP_004335044.1| alpha/beta hydrolase fold protein [Pseudonocardia dioxanivorans
           CB1190]
 gi|326953494|gb|AEA27191.1| alpha/beta hydrolase fold protein [Pseudonocardia dioxanivorans
           CB1190]
          Length = 276

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 91/226 (40%), Gaps = 36/226 (15%)

Query: 29  ILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADA 88
           ++L+H LA S     ++  +   L   GF V+A D  GHG     +    + +  +A D 
Sbjct: 14  VVLLHPLALS---GAVWGEFATRLVAAGFDVVAPDARGHGAEPAPWDGAPFSIADLADDV 70

Query: 89  VSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQS--- 145
            +LL+ LG+ + HV+G SMG  IA  +   +P  V  ++L    +    +    W     
Sbjct: 71  ATLLDDLGVDRAHVVGMSMGGSIAVELAARHPGRVDRLVLADTTAWYGPNAPAAWTERAA 130

Query: 146 ------------------LIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSM 187
                               D F+  + DEV        R+ A +    D  A A+    
Sbjct: 131 RAVGVPRRRQIPFQTDRWFTDEFVRTAHDEV--------RRVAAVFTATDSLAHAAACRA 182

Query: 188 IRKPFCQDDLYRIDVPVLIAVGSQDDLAGSP---QELMSFIPSSQY 230
           +     ++ L  I  P L+  G ++DLA  P   + L   IP S++
Sbjct: 183 LGALDARERLASITAPTLVLTG-EEDLATPPSMGRALADGIPGSRF 227


>gi|91976297|ref|YP_568956.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB5]
 gi|91682753|gb|ABE39055.1| alpha/beta hydrolase fold [Rhodopseudomonas palustris BisB5]
          Length = 331

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 8   FRSWRKYQFAFYDVGDK-DAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLG 66
           F  +   +  +Y+ G   DAP ++L HG    +  +W     I+ L + G RVIA D  G
Sbjct: 9   FAEFNGIRMGYYEAGPTSDAPPMVLCHGW-PELAFSWRHQ--IKALSEAGIRVIAPDQRG 65

Query: 67  HGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSV 126
           +G++ +      Y +  +  D V+LL+HL I K   +G+  G  +   M L +P+ V  V
Sbjct: 66  YGETSRPEPVEAYDIEHLTGDLVALLDHLQIDKAIFVGHDWGGFVVWQMPLRHPARVAGV 125

Query: 127 I 127
           +
Sbjct: 126 V 126


>gi|288923223|ref|ZP_06417364.1| alpha/beta hydrolase fold protein [Frankia sp. EUN1f]
 gi|288345429|gb|EFC79817.1| alpha/beta hydrolase fold protein [Frankia sp. EUN1f]
          Length = 379

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 15/134 (11%)

Query: 8   FRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCD--QGFRVIAFDNL 65
           F +   Y+ A+   G    P +LLIHG+  +  T      W  L+ +  +G  VIA D L
Sbjct: 16  FVTVHGYRRAYLRAGR--GPALLLIHGIGDNSGT------WRDLIPELARGRTVIAPDLL 67

Query: 66  GHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRS 125
           GHG SDK     DY +   A     LL  LGI +V V+G+S+G  +A      +P+    
Sbjct: 68  GHGLSDKP--RGDYSVAGYACGMRDLLTVLGIERVTVVGHSLGGGVAMQFAYQFPARCER 125

Query: 126 VIL---GGVGSVLY 136
           ++L   GGVG  L+
Sbjct: 126 LVLVSAGGVGPDLH 139


>gi|213970843|ref|ZP_03398966.1| hydrolase, alpha/beta fold family [Pseudomonas syringae pv. tomato
           T1]
 gi|213924366|gb|EEB57938.1| hydrolase, alpha/beta fold family [Pseudomonas syringae pv. tomato
           T1]
          Length = 330

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 66/136 (48%), Gaps = 21/136 (15%)

Query: 12  RKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKS- 70
           ++ + A+  +G +  P +LL+ GL   +  +W     +  LC+QG+RVI +DN   G S 
Sbjct: 34  KEVRIAYQSIGSESDPALLLVMGLGGQL-IHW-PDEVVVALCEQGYRVIRYDNRDVGLST 91

Query: 71  ------DKSY------------IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIA 112
                 D +             + + Y L  MA DA+ L++ L I + HV+G SMG  IA
Sbjct: 92  WVQQPADANLTVEVLRYKLGLPVSSPYSLTDMADDALGLMDALQIRQFHVLGASMGGMIA 151

Query: 113 CSMVLFYPSYVRSVIL 128
             +    PS V S+ L
Sbjct: 152 QHLADLAPSRVESLTL 167


>gi|226943518|ref|YP_002798591.1| alpha/beta hydrolase fold protein [Azotobacter vinelandii DJ]
 gi|226718445|gb|ACO77616.1| Alpha/beta hydrolase fold protein [Azotobacter vinelandii DJ]
          Length = 319

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (45%), Gaps = 21/133 (15%)

Query: 15  QFAFYDVGDKDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHG------ 68
           Q A+  +G +  P ++L+ GL   +  +W     + L C QGFRVI FDN   G      
Sbjct: 28  QLAYQSIGRETDPALVLVMGLGGQL-IDWPDEVLLGL-CRQGFRVIRFDNRDVGLSAWRQ 85

Query: 69  ---KSDKSY----------IENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSM 115
              K   +Y          +   Y L  MA D ++L+  L + + HV+G SMG  IA  M
Sbjct: 86  EVPKVSLTYGVLRHRL