RPSBLAST alignment for GI: 254780166 and conserved domain: COG0429

>gnl|CDD|30778 COG0429, COG0429, Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]. Length = 345
 Score = 40.7 bits (95), Expect = 4e-04
 Identities = 22/121 (18%), Positives = 43/121 (35%), Gaps = 22/121 (18%)

Query: 5   VKFFRSWRKYQFAFYDVGDKD---------APTILLIHGLASSVQTNWLFSGWIQLLCDQ 55
            K   +  + +       D D          P ++L HGL  S  + +   G ++ L  +
Sbjct: 45  PKVAYTRERLETPDGGFIDLDWSEDPRAAKKPLVVLFHGLEGSSNSPYA-RGLMRALSRR 103

Query: 56  GFRVIAFDNLGHGKSDKSYIENDYRLVFMA---ADAVSLLEHL----GISKVHVMGYSMG 108
           G+ V+ F   G          N    ++ +    D    L+ L        ++ +G+S+G
Sbjct: 104 GWLVVVFHFRGCSGE-----ANTSPRLYHSGETEDIRFFLDWLKARFPPRPLYAVGFSLG 158

Query: 109 A 109
            
Sbjct: 159 G 159