RPSBLAST alignment for GI: 254780166 and conserved domain: COG1506

>gnl|CDD|31695 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]. Length = 620
 Score = 49.4 bits (117), Expect = 9e-07
 Identities = 42/198 (21%), Positives = 69/198 (34%), Gaps = 34/198 (17%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFD---NLGHGKS-----DKSYI 75
           K  P I+ IHG   S Q  + F+  IQ+L   G+ V+A +   + G+G+         + 
Sbjct: 392 KKYPLIVYIHG-GPSAQVGYSFNPEIQVLASAGYAVLAPNYRGSTGYGREFADAIRGDWG 450

Query: 76  ENDYRLVFMAADAVSLLEHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGVGSVL 135
             D   +  A DA+  L  +   ++ + G S G  +        P +  +V +       
Sbjct: 451 GVDLEDLIAAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTPRFKAAVAV------- 503

Query: 136 YDSDVVDWQSLIDSFLLPSIDEVQNPLGKKFRKFADLDPGNDLKALASCLSMIRKPFCQD 195
             +  VDW                  L     +     P +  K         R P    
Sbjct: 504 --AGGVDWLLYFGES--------TEGLRFDPEENGGGPPEDREKYED------RSPIFYA 547

Query: 196 DLYRIDVPVLIAVGSQDD 213
           D   I  P+L+  G +DD
Sbjct: 548 D--NIKTPLLLIHGEEDD 563