RPSBLAST alignment for GI: 254780166 and conserved domain: KOG2564

>gnl|CDD|37775 KOG2564, KOG2564, KOG2564, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]. Length = 343
 Score = 41.9 bits (98), Expect = 2e-04
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 6/92 (6%)

Query: 24  KDAPTILLIHGLASSVQTNWLFSGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVF 83
            + P +LL+HG  SS  +  +F+  ++       R +A D  GHG++ K   E+D  L  
Sbjct: 72  TEGPILLLLHGGGSSALSFAIFASELKSKIRC--RCLALDLRGHGET-KVENEDDLSLET 128

Query: 84  MAADAVSLLEHL---GISKVHVMGYSMGARIA 112
           M+ D  ++++ L      ++ ++G+SMG  IA
Sbjct: 129 MSKDFGAVIKELFGELPPQIILVGHSMGGAIA 160