BLAST/PSIBLAST alignment of GI: 254780167 and GI: 23501634 at iteration 1
>gi|23501634|ref|NP_697761.1| hypothetical protein BR0747 [Brucella suis 1330] Length = 84
>gi|62289700|ref|YP_221493.1| hypothetical protein BruAb1_0764 [Brucella abortus bv. 1 str. 9-941] Length = 84
>gi|82699630|ref|YP_414204.1| hypothetical protein BAB1_0771 [Brucella melitensis biovar Abortus 2308] Length = 84
>gi|148560602|ref|YP_001258728.1| hypothetical protein BOV_0741 [Brucella ovis ATCC 25840] Length = 84
>gi|161618717|ref|YP_001592604.1| hypothetical protein BCAN_A0762 [Brucella canis ATCC 23365] Length = 84
>gi|163843019|ref|YP_001627423.1| hypothetical protein BSUIS_A0782 [Brucella suis ATCC 23445] Length = 84
>gi|189023950|ref|YP_001934718.1| hypothetical protein BAbS19_I07200 [Brucella abortus S19] Length = 84
>gi|225627248|ref|ZP_03785285.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] Length = 84
>gi|225852264|ref|YP_002732497.1| hypothetical protein BMEA_A0787 [Brucella melitensis ATCC 23457] Length = 84
>gi|237815189|ref|ZP_04594187.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] Length = 84
>gi|254693495|ref|ZP_05155323.1| hypothetical protein Babob3T_02294 [Brucella abortus bv. 3 str. Tulya] Length = 84
>gi|254697147|ref|ZP_05158975.1| hypothetical protein Babob28_05394 [Brucella abortus bv. 2 str. 86/8/59] Length = 84
>gi|254701524|ref|ZP_05163352.1| hypothetical protein Bsuib55_11801 [Brucella suis bv. 5 str. 513] Length = 84
>gi|254704073|ref|ZP_05165901.1| hypothetical protein Bsuib36_09109 [Brucella suis bv. 3 str. 686] Length = 84
>gi|254707026|ref|ZP_05168854.1| hypothetical protein BpinM_08572 [Brucella pinnipedialis M163/99/10] Length = 84
>gi|254709865|ref|ZP_05171676.1| hypothetical protein BpinB_06260 [Brucella pinnipedialis B2/94] Length = 84
>gi|254713866|ref|ZP_05175677.1| hypothetical protein BcetM6_11039 [Brucella ceti M644/93/1] Length = 84
>gi|254717077|ref|ZP_05178888.1| hypothetical protein BcetM_11763 [Brucella ceti M13/05/1] Length = 84
>gi|254718866|ref|ZP_05180677.1| hypothetical protein Bru83_04890 [Brucella sp. 83/13] Length = 84
>gi|254730043|ref|ZP_05188621.1| hypothetical protein Babob42_02309 [Brucella abortus bv. 4 str. 292] Length = 84
>gi|256031357|ref|ZP_05444971.1| hypothetical protein BpinM2_12022 [Brucella pinnipedialis M292/94/1] Length = 84
>gi|256060867|ref|ZP_05451027.1| hypothetical protein Bneo5_10962 [Brucella neotomae 5K33] Length = 84
>gi|256113281|ref|ZP_05454149.1| hypothetical protein Bmelb3E_11232 [Brucella melitensis bv. 3 str. Ether] Length = 84
>gi|256159479|ref|ZP_05457247.1| hypothetical protein BcetM4_10987 [Brucella ceti M490/95/1] Length = 84
>gi|256254765|ref|ZP_05460301.1| hypothetical protein BcetB_10804 [Brucella ceti B1/94] Length = 84
>gi|256264228|ref|ZP_05466760.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] Length = 84
>gi|256369180|ref|YP_003106688.1| hypothetical protein BMI_I745 [Brucella microti CCM 4915] Length = 84
>gi|260168491|ref|ZP_05755302.1| hypothetical protein BruF5_09017 [Brucella sp. F5/99] Length = 84
>gi|260545544|ref|ZP_05821285.1| conserved hypothetical protein [Brucella abortus NCTC 8038] Length = 84
>gi|260566679|ref|ZP_05837149.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] Length = 84
>gi|260757726|ref|ZP_05870074.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] Length = 84
>gi|260761551|ref|ZP_05873894.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] Length = 84
>gi|261213753|ref|ZP_05928034.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 84
>gi|261218888|ref|ZP_05933169.1| conserved hypothetical protein [Brucella ceti M13/05/1] Length = 84
>gi|261221944|ref|ZP_05936225.1| conserved hypothetical protein [Brucella ceti B1/94] Length = 84
>gi|261314494|ref|ZP_05953691.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 84
>gi|261317406|ref|ZP_05956603.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] Length = 84
>gi|261321613|ref|ZP_05960810.1| conserved hypothetical protein [Brucella ceti M644/93/1] Length = 84
>gi|261324864|ref|ZP_05964061.1| conserved hypothetical protein [Brucella neotomae 5K33] Length = 84
>gi|261752072|ref|ZP_05995781.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] Length = 84
>gi|261754731|ref|ZP_05998440.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] Length = 84
>gi|261757959|ref|ZP_06001668.1| conserved hypothetical protein [Brucella sp. F5/99] Length = 84
>gi|265983851|ref|ZP_06096586.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 84
>gi|265988443|ref|ZP_06101000.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] Length = 84
>gi|265994693|ref|ZP_06107250.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] Length = 84
>gi|265997907|ref|ZP_06110464.1| conserved hypothetical protein [Brucella ceti M490/95/1] Length = 84
>gi|294852111|ref|ZP_06792784.1| hypothetical protein BAZG_01027 [Brucella sp. NVSL 07-0026] Length = 84
>gi|306837631|ref|ZP_07470501.1| cytoplasmic protein [Brucella sp. NF 2653] Length = 84
>gi|306842004|ref|ZP_07474678.1| cytoplasmic protein [Brucella sp. BO2] Length = 84
>gi|306843693|ref|ZP_07476293.1| cytoplasmic protein [Brucella sp. BO1] Length = 84
>gi|23347552|gb|AAN29676.1| conserved hypothetical protein [Brucella suis 1330] Length = 84
>gi|62195832|gb|AAX74132.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] Length = 84
>gi|82615731|emb|CAJ10727.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] Length = 84
>gi|148371859|gb|ABQ61838.1| conserved hypothetical protein [Brucella ovis ATCC 25840] Length = 84
>gi|161335528|gb|ABX61833.1| Hypothetical protein BCAN_A0762 [Brucella canis ATCC 23365] Length = 84
>gi|163673742|gb|ABY37853.1| Hypothetical protein BSUIS_A0782 [Brucella suis ATCC 23445] Length = 84
>gi|189019522|gb|ACD72244.1| hypothetical protein BAbS19_I07200 [Brucella abortus S19] Length = 84
>gi|225617253|gb|EEH14298.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] Length = 84
>gi|225640629|gb|ACO00543.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] Length = 84
>gi|237790026|gb|EEP64236.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] Length = 84
>gi|255999340|gb|ACU47739.1| hypothetical protein BMI_I745 [Brucella microti CCM 4915] Length = 84
>gi|260096951|gb|EEW80826.1| conserved hypothetical protein [Brucella abortus NCTC 8038] Length = 84
>gi|260156197|gb|EEW91277.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] Length = 84
>gi|260668044|gb|EEX54984.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] Length = 84
>gi|260671983|gb|EEX58804.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] Length = 84
>gi|260915360|gb|EEX82221.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 84
>gi|260920528|gb|EEX87181.1| conserved hypothetical protein [Brucella ceti B1/94] Length = 84
>gi|260923977|gb|EEX90545.1| conserved hypothetical protein [Brucella ceti M13/05/1] Length = 84
>gi|261294303|gb|EEX97799.1| conserved hypothetical protein [Brucella ceti M644/93/1] Length = 84
>gi|261296629|gb|EEY00126.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] Length = 84
>gi|261300844|gb|EEY04341.1| conserved hypothetical protein [Brucella neotomae 5K33] Length = 84
>gi|261303520|gb|EEY07017.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 84
>gi|261737943|gb|EEY25939.1| conserved hypothetical protein [Brucella sp. F5/99] Length = 84
>gi|261741825|gb|EEY29751.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] Length = 84
>gi|261744484|gb|EEY32410.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] Length = 84
>gi|262552375|gb|EEZ08365.1| conserved hypothetical protein [Brucella ceti M490/95/1] Length = 84
>gi|262765806|gb|EEZ11595.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] Length = 84
>gi|263094474|gb|EEZ18296.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] Length = 84
>gi|264660640|gb|EEZ30901.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] Length = 84
>gi|264662443|gb|EEZ32704.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 84
>gi|294820700|gb|EFG37699.1| hypothetical protein BAZG_01027 [Brucella sp. NVSL 07-0026] Length = 84
>gi|306276003|gb|EFM57712.1| cytoplasmic protein [Brucella sp. BO1] Length = 84
>gi|306287932|gb|EFM59349.1| cytoplasmic protein [Brucella sp. BO2] Length = 84
>gi|306407280|gb|EFM63489.1| cytoplasmic protein [Brucella sp. NF 2653] Length = 84
>gi|326408770|gb|ADZ65835.1| conserved hypothetical protein [Brucella melitensis M28] Length = 84
>gi|326538488|gb|ADZ86703.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 84
 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 61/75 (81%)

Query: 1  MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60
          M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHV+++MG+E+E  CPYCSTLY +
Sbjct: 1  MSDHIIPHFQNDAGHNAIEIGVKEFMCVGANPPFDHPHVYLDMGDESEIVCPYCSTLYRY 60

Query: 61 DSSLDSKETLPVGCL 75
          ++ L + ET+P GC+
Sbjct: 61 NAKLHADETIPAGCV 75