BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780167|ref|YP_003064580.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780167|ref|YP_003064580.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] gi|254039844|gb|ACT56640.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 164 bits (414), Expect = 5e-39, Method: Compositional matrix adjust. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF Sbjct: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 DSSLDSKETLPVGCLLSL Sbjct: 61 DSSLDSKETLPVGCLLSL 78 >gi|315122671|ref|YP_004063160.1| hypothetical protein CKC_04615 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496073|gb|ADR52672.1| hypothetical protein CKC_04615 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 78 Score = 134 bits (336), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 61/78 (78%), Positives = 69/78 (88%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +H I HFQND+GHS IKIGVK+FMCAG SPPLDHPHVFINMG +N+K+CPYCSTLYHF Sbjct: 1 MANHRILHFQNDKGHSSIKIGVKEFMCAGASPPLDHPHVFINMGSDNKKYCPYCSTLYHF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 D+SLDS+ETLP GC L L Sbjct: 61 DASLDSEETLPSGCFLPL 78 >gi|163760310|ref|ZP_02167393.1| hypothetical protein HPDFL43_08609 [Hoeflea phototrophica DFL-43] gi|162282709|gb|EDQ32997.1| hypothetical protein HPDFL43_08609 [Hoeflea phototrophica DFL-43] Length = 81 Score = 113 bits (283), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 49/77 (63%), Positives = 58/77 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GHS I+IGVK+FMC G +PP DHPH F++MG E EK CPYCSTLY F Sbjct: 1 MAGHKIPHFQNDAGHSAIEIGVKEFMCVGANPPFDHPHEFLDMGAETEKVCPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L ET+P GC L+ Sbjct: 61 NPALAETETVPAGCTLT 77 >gi|153009872|ref|YP_001371087.1| hypothetical protein Oant_2545 [Ochrobactrum anthropi ATCC 49188] gi|151561760|gb|ABS15258.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188] Length = 84 Score = 112 bits (280), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 61/75 (81%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHVF++MG+E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHAAIEIGVKEFMCVGANPPFDHPHVFLDMGDESEVVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETVPAGCV 75 >gi|239831575|ref|ZP_04679904.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239823842|gb|EEQ95410.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 126 Score = 112 bits (280), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 47/74 (63%), Positives = 60/74 (81%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHVF++MG+E+E CPYCSTLY + Sbjct: 43 MSDHIIPHFQNDAGHAAIEIGVKEFMCVGANPPFDHPHVFLDMGDESEAVCPYCSTLYRY 102 Query: 61 DSSLDSKETLPVGC 74 ++ L + ET+P GC Sbjct: 103 NAELHADETVPAGC 116 >gi|254689012|ref|ZP_05152266.1| hypothetical protein Babob68_02286 [Brucella abortus bv. 6 str. 870] gi|256257262|ref|ZP_05462798.1| hypothetical protein Babob9C_07873 [Brucella abortus bv. 9 str. C68] gi|260754505|ref|ZP_05866853.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260883534|ref|ZP_05895148.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|297248107|ref|ZP_06931825.1| hypothetical protein BAYG_01045 [Brucella abortus bv. 5 str. B3196] gi|260674613|gb|EEX61434.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260873062|gb|EEX80131.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|297175276|gb|EFH34623.1| hypothetical protein BAYG_01045 [Brucella abortus bv. 5 str. B3196] Length = 84 Score = 111 bits (278), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 61/75 (81%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHV+I+MG+E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHNAIEIGVKEFMCVGANPPFDHPHVYIDMGDESEIVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETIPAGCV 75 >gi|150396330|ref|YP_001326797.1| hypothetical protein Smed_1111 [Sinorhizobium medicae WSM419] gi|150027845|gb|ABR59962.1| conserved hypothetical protein [Sinorhizobium medicae WSM419] Length = 81 Score = 111 bits (277), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 49/77 (63%), Positives = 59/77 (76%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+F++MG+ENEK C YCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHRVIEIGVKEFMCTGASVPFDHPHIFVDMGDENEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + SL + ET+P GCL S Sbjct: 61 NPSLKATETIPPGCLFS 77 >gi|17987489|ref|NP_540123.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M] gi|256044437|ref|ZP_05447341.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. Rev.1] gi|260563788|ref|ZP_05834274.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|265990857|ref|ZP_06103414.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|17983187|gb|AAL52387.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M] gi|260153804|gb|EEW88896.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|263001641|gb|EEZ14216.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] Length = 84 Score = 111 bits (277), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 60/75 (80%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ IKIGVK+FMC G +PP DHPHV+++MG E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHNAIKIGVKEFMCVGANPPFDHPHVYLDMGNESEIVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETIPAGCV 75 >gi|15965234|ref|NP_385587.1| hypothetical protein SMc02115 [Sinorhizobium meliloti 1021] gi|307309257|ref|ZP_07588925.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti BL225C] gi|307316999|ref|ZP_07596440.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti AK83] gi|15074414|emb|CAC46060.1| Hypothetical unknown protein [Sinorhizobium meliloti 1021] gi|306897087|gb|EFN27832.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti AK83] gi|306900258|gb|EFN30875.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti BL225C] Length = 81 Score = 110 bits (275), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 48/77 (62%), Positives = 59/77 (76%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+F++MG+ENEK C YCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHRVIEIGVKEFMCTGASVPFDHPHIFVDMGDENEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + SL + ET+P GCL + Sbjct: 61 NPSLKATETIPPGCLFT 77 >gi|23501634|ref|NP_697761.1| hypothetical protein BR0747 [Brucella suis 1330] gi|62289700|ref|YP_221493.1| hypothetical protein BruAb1_0764 [Brucella abortus bv. 1 str. 9-941] gi|82699630|ref|YP_414204.1| hypothetical protein BAB1_0771 [Brucella melitensis biovar Abortus 2308] gi|148560602|ref|YP_001258728.1| hypothetical protein BOV_0741 [Brucella ovis ATCC 25840] gi|161618717|ref|YP_001592604.1| hypothetical protein BCAN_A0762 [Brucella canis ATCC 23365] gi|163843019|ref|YP_001627423.1| hypothetical protein BSUIS_A0782 [Brucella suis ATCC 23445] gi|189023950|ref|YP_001934718.1| hypothetical protein BAbS19_I07200 [Brucella abortus S19] gi|225627248|ref|ZP_03785285.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225852264|ref|YP_002732497.1| hypothetical protein BMEA_A0787 [Brucella melitensis ATCC 23457] gi|237815189|ref|ZP_04594187.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|254693495|ref|ZP_05155323.1| hypothetical protein Babob3T_02294 [Brucella abortus bv. 3 str. Tulya] gi|254697147|ref|ZP_05158975.1| hypothetical protein Babob28_05394 [Brucella abortus bv. 2 str. 86/8/59] gi|254701524|ref|ZP_05163352.1| hypothetical protein Bsuib55_11801 [Brucella suis bv. 5 str. 513] gi|254704073|ref|ZP_05165901.1| hypothetical protein Bsuib36_09109 [Brucella suis bv. 3 str. 686] gi|254707026|ref|ZP_05168854.1| hypothetical protein BpinM_08572 [Brucella pinnipedialis M163/99/10] gi|254709865|ref|ZP_05171676.1| hypothetical protein BpinB_06260 [Brucella pinnipedialis B2/94] gi|254713866|ref|ZP_05175677.1| hypothetical protein BcetM6_11039 [Brucella ceti M644/93/1] gi|254717077|ref|ZP_05178888.1| hypothetical protein BcetM_11763 [Brucella ceti M13/05/1] gi|254718866|ref|ZP_05180677.1| hypothetical protein Bru83_04890 [Brucella sp. 83/13] gi|254730043|ref|ZP_05188621.1| hypothetical protein Babob42_02309 [Brucella abortus bv. 4 str. 292] gi|256031357|ref|ZP_05444971.1| hypothetical protein BpinM2_12022 [Brucella pinnipedialis M292/94/1] gi|256060867|ref|ZP_05451027.1| hypothetical protein Bneo5_10962 [Brucella neotomae 5K33] gi|256113281|ref|ZP_05454149.1| hypothetical protein Bmelb3E_11232 [Brucella melitensis bv. 3 str. Ether] gi|256159479|ref|ZP_05457247.1| hypothetical protein BcetM4_10987 [Brucella ceti M490/95/1] gi|256254765|ref|ZP_05460301.1| hypothetical protein BcetB_10804 [Brucella ceti B1/94] gi|256264228|ref|ZP_05466760.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|256369180|ref|YP_003106688.1| hypothetical protein BMI_I745 [Brucella microti CCM 4915] gi|260168491|ref|ZP_05755302.1| hypothetical protein BruF5_09017 [Brucella sp. F5/99] gi|260545544|ref|ZP_05821285.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260566679|ref|ZP_05837149.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260757726|ref|ZP_05870074.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260761551|ref|ZP_05873894.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|261213753|ref|ZP_05928034.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|261218888|ref|ZP_05933169.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261221944|ref|ZP_05936225.1| conserved hypothetical protein [Brucella ceti B1/94] gi|261314494|ref|ZP_05953691.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261317406|ref|ZP_05956603.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261321613|ref|ZP_05960810.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261324864|ref|ZP_05964061.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261752072|ref|ZP_05995781.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261754731|ref|ZP_05998440.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|261757959|ref|ZP_06001668.1| conserved hypothetical protein [Brucella sp. F5/99] gi|265983851|ref|ZP_06096586.1| conserved hypothetical protein [Brucella sp. 83/13] gi|265988443|ref|ZP_06101000.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|265994693|ref|ZP_06107250.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|265997907|ref|ZP_06110464.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|294852111|ref|ZP_06792784.1| hypothetical protein BAZG_01027 [Brucella sp. NVSL 07-0026] gi|306837631|ref|ZP_07470501.1| cytoplasmic protein [Brucella sp. NF 2653] gi|306842004|ref|ZP_07474678.1| cytoplasmic protein [Brucella sp. BO2] gi|306843693|ref|ZP_07476293.1| cytoplasmic protein [Brucella sp. BO1] gi|23347552|gb|AAN29676.1| conserved hypothetical protein [Brucella suis 1330] gi|62195832|gb|AAX74132.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82615731|emb|CAJ10727.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] gi|148371859|gb|ABQ61838.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161335528|gb|ABX61833.1| Hypothetical protein BCAN_A0762 [Brucella canis ATCC 23365] gi|163673742|gb|ABY37853.1| Hypothetical protein BSUIS_A0782 [Brucella suis ATCC 23445] gi|189019522|gb|ACD72244.1| hypothetical protein BAbS19_I07200 [Brucella abortus S19] gi|225617253|gb|EEH14298.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225640629|gb|ACO00543.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] gi|237790026|gb|EEP64236.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|255999340|gb|ACU47739.1| hypothetical protein BMI_I745 [Brucella microti CCM 4915] gi|260096951|gb|EEW80826.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260156197|gb|EEW91277.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260668044|gb|EEX54984.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260671983|gb|EEX58804.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260915360|gb|EEX82221.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|260920528|gb|EEX87181.1| conserved hypothetical protein [Brucella ceti B1/94] gi|260923977|gb|EEX90545.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261294303|gb|EEX97799.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261296629|gb|EEY00126.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261300844|gb|EEY04341.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261303520|gb|EEY07017.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261737943|gb|EEY25939.1| conserved hypothetical protein [Brucella sp. F5/99] gi|261741825|gb|EEY29751.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261744484|gb|EEY32410.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|262552375|gb|EEZ08365.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|262765806|gb|EEZ11595.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|263094474|gb|EEZ18296.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|264660640|gb|EEZ30901.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|264662443|gb|EEZ32704.1| conserved hypothetical protein [Brucella sp. 83/13] gi|294820700|gb|EFG37699.1| hypothetical protein BAZG_01027 [Brucella sp. NVSL 07-0026] gi|306276003|gb|EFM57712.1| cytoplasmic protein [Brucella sp. BO1] gi|306287932|gb|EFM59349.1| cytoplasmic protein [Brucella sp. BO2] gi|306407280|gb|EFM63489.1| cytoplasmic protein [Brucella sp. NF 2653] gi|326408770|gb|ADZ65835.1| conserved hypothetical protein [Brucella melitensis M28] gi|326538488|gb|ADZ86703.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 84 Score = 110 bits (275), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 46/75 (61%), Positives = 61/75 (81%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHV+++MG+E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHNAIEIGVKEFMCVGANPPFDHPHVYLDMGDESEIVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETIPAGCV 75 >gi|227821883|ref|YP_002825853.1| hypothetical protein NGR_c13200 [Sinorhizobium fredii NGR234] gi|227340882|gb|ACP25100.1| hypothetical protein NGR_c13200 [Sinorhizobium fredii NGR234] Length = 140 Score = 110 bits (275), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 48/76 (63%), Positives = 59/76 (77%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY + Sbjct: 60 MAGHSIPHFQNDGGHQVIEIGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRY 119 Query: 61 DSSLDSKETLPVGCLL 76 ++SL + ET+P GCL Sbjct: 120 NASLKATETIPPGCLF 135 >gi|319784334|ref|YP_004143810.1| hypothetical protein Mesci_4651 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317170222|gb|ADV13760.1| hypothetical protein Mesci_4651 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 81 Score = 108 bits (269), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 46/75 (61%), Positives = 56/75 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M IPHFQND G+ I IGVK+FMC G +PP DHPHVF++MG++NEK CPYCSTLY + Sbjct: 1 MAGGSIPHFQNDAGYPAIDIGVKEFMCTGANPPFDHPHVFLDMGDDNEKVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 L + ETLP GC+ Sbjct: 61 SPKLKATETLPAGCI 75 >gi|260463335|ref|ZP_05811536.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] gi|259030925|gb|EEW32200.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 81 Score = 107 bits (268), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 55/75 (73%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M IPHFQND G I IGVK+FMC G +PP DHPHVF++MG++NEK CPYCSTLY + Sbjct: 1 MAGGSIPHFQNDAGFPAIDIGVKEFMCTGANPPFDHPHVFLDMGDDNEKVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 L + ETLP GCL Sbjct: 61 SPKLKATETLPAGCL 75 >gi|116251963|ref|YP_767801.1| hypothetical protein RL2207 [Rhizobium leguminosarum bv. viciae 3841] gi|209549165|ref|YP_002281082.1| hypothetical protein Rleg2_1566 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|241204491|ref|YP_002975587.1| hypothetical protein Rleg_1763 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|115256611|emb|CAK07699.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] gi|209534921|gb|ACI54856.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM2304] gi|240858381|gb|ACS56048.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 81 Score = 107 bits (268), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 46/76 (60%), Positives = 57/76 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY F Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASAPFDHPHIFIDMGDDNEKVCSYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 +S+L +T P GC+ Sbjct: 61 NSALKPSQTNPAGCVF 76 >gi|190891591|ref|YP_001978133.1| hypothetical protein RHECIAT_CH0001994 [Rhizobium etli CIAT 652] gi|218516838|ref|ZP_03513678.1| hypothetical protein Retl8_26169 [Rhizobium etli 8C-3] gi|218663451|ref|ZP_03519381.1| hypothetical protein RetlI_31263 [Rhizobium etli IE4771] gi|190696870|gb|ACE90955.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 81 Score = 107 bits (268), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 47/76 (61%), Positives = 57/76 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY F Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 +SSL +T P GC+ Sbjct: 61 NSSLKPSQTNPAGCVF 76 >gi|222148877|ref|YP_002549834.1| hypothetical protein Avi_2547 [Agrobacterium vitis S4] gi|221735863|gb|ACM36826.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 81 Score = 107 bits (267), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 46/76 (60%), Positives = 57/76 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH ++IGVK+FMC G S P DHPH+FI++G + EK CPYCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHRLVEIGVKEFMCTGASVPFDHPHIFIDLGHDTEKVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 +SSL + ET P GC+ Sbjct: 61 NSSLKATETNPAGCVF 76 >gi|327190787|gb|EGE57855.1| hypothetical protein RHECNPAF_371006 [Rhizobium etli CNPAF512] Length = 81 Score = 107 bits (267), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 47/76 (61%), Positives = 57/76 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY F Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 +SSL +T P GC+ Sbjct: 61 NSSLKPTQTNPAGCVF 76 >gi|159184822|ref|NP_354572.2| hypothetical protein Atu1573 [Agrobacterium tumefaciens str. C58] gi|325292967|ref|YP_004278831.1| hypothetical protein AGROH133_06362 [Agrobacterium sp. H13-3] gi|159140107|gb|AAK87357.2| hypothetical protein Atu1573 [Agrobacterium tumefaciens str. C58] gi|325060820|gb|ADY64511.1| hypothetical protein AGROH133_06362 [Agrobacterium sp. H13-3] Length = 81 Score = 106 bits (265), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 47/76 (61%), Positives = 59/76 (77%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GHS I+IGVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHSVIEIGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 + SL +++T P GC+ Sbjct: 61 NPSLKAEQTNPPGCVF 76 >gi|163868510|ref|YP_001609719.1| hypothetical protein Btr_1362 [Bartonella tribocorum CIP 105476] gi|161018166|emb|CAK01724.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 82 Score = 106 bits (264), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 56/75 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADHNIPHFQNDLGYKTIEIGVKEFMCVGATQPFDHPHIFIDMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 SSL +T P GCL Sbjct: 61 VSSLSYDQTNPTGCL 75 >gi|240850742|ref|YP_002972142.1| hypothetical protein Bgr_12110 [Bartonella grahamii as4aup] gi|240267865|gb|ACS51453.1| hypothetical protein Bgr_12110 [Bartonella grahamii as4aup] Length = 82 Score = 106 bits (264), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 56/75 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MGE +EK CPYCSTLY + Sbjct: 1 MADHNIPHFQNDLGYKTIEIGVKEFMCVGATQPFDHPHIFIDMGEADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 SL +T P GCL Sbjct: 61 VPSLSYNQTNPTGCL 75 >gi|86357522|ref|YP_469414.1| hypothetical protein RHE_CH01901 [Rhizobium etli CFN 42] gi|86281624|gb|ABC90687.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 81 Score = 105 bits (262), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 45/76 (59%), Positives = 57/76 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY + Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 ++SL +T P GC+ Sbjct: 61 NASLKPSQTNPAGCVF 76 >gi|165760869|pdb|2JZ8|A Chain A, Solution Nmr Structure Of Bh09830 From Bartonella Henselae Modeled With One Zn+2 Bound. Northeast Structural Genomics Consortium Target Bnr55 Length = 87 Score = 105 bits (262), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 46/77 (59%), Positives = 57/77 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D SL +T P GCL + Sbjct: 61 DPSLSYNQTNPTGCLYN 77 >gi|49475733|ref|YP_033774.1| hypothetical protein BH09830 [Bartonella henselae str. Houston-1] gi|49238540|emb|CAF27776.1| hypothetical protein BH09830 [Bartonella henselae str. Houston-1] Length = 79 Score = 105 bits (262), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 46/77 (59%), Positives = 57/77 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D SL +T P GCL + Sbjct: 61 DPSLSYNQTNPTGCLYN 77 >gi|49474346|ref|YP_032388.1| hypothetical protein BQ07600 [Bartonella quintana str. Toulouse] gi|49239850|emb|CAF26244.1| hypothetical protein BQ07600 [Bartonella quintana str. Toulouse] Length = 79 Score = 105 bits (262), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 57/75 (76%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADHNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 D SL +T P+GCL Sbjct: 61 DPSLPHDQTNPMGCL 75 >gi|118593895|ref|ZP_01551253.1| Hypothetical Cytosolic Protein [Stappia aggregata IAM 12614] gi|118433516|gb|EAV40185.1| Hypothetical Cytosolic Protein [Stappia aggregata IAM 12614] Length = 81 Score = 105 bits (261), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 43/77 (55%), Positives = 54/77 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQN GH + IG ++FMC G +PP DHPHVF++MG ENE CPYCSTLY F Sbjct: 1 MADHVVPHFQNSSGHDSVAIGAREFMCIGANPPFDHPHVFLDMGSENEVVCPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCLLS 77 D +L + E+ P C + Sbjct: 61 DKTLQATESSPSDCTWA 77 >gi|222085844|ref|YP_002544374.1| hypothetical protein Arad_2204 [Agrobacterium radiobacter K84] gi|221723292|gb|ACM26448.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 81 Score = 104 bits (259), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 45/78 (57%), Positives = 57/78 (73%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+FI++G+E+EK C YCSTLY + Sbjct: 1 MAGHNIPHFQNDGGHRVIEIGVKEFMCTGASVPYDHPHIFIDLGDESEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + SL + +T P GC+ Sbjct: 61 NPSLKADQTNPAGCVFQF 78 >gi|319408649|emb|CBI82304.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 82 Score = 103 bits (256), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 45/78 (57%), Positives = 58/78 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH I HFQNDRG+ I+IGVK+FMC G + P DHPH+FI+MG ++EK CPYCSTLY + Sbjct: 1 MSDHNILHFQNDRGYKIIEIGVKEFMCVGATEPFDHPHIFIDMGADDEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + SL +T P GC+ + Sbjct: 61 NHSLSFNQTNPTGCIYHI 78 >gi|114706995|ref|ZP_01439894.1| hypothetical protein FP2506_03049 [Fulvimarina pelagi HTCC2506] gi|114537545|gb|EAU40670.1| hypothetical protein FP2506_03049 [Fulvimarina pelagi HTCC2506] Length = 78 Score = 102 bits (254), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 45/77 (58%), Positives = 55/77 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND G+ I+IGV +FMC G +PP DHPHVF++MG+E EK C YCSTL+ + Sbjct: 1 MAGHQIPHFQNDAGYDVIEIGVTEFMCCGANPPHDHPHVFLDMGDEREKICAYCSTLFKY 60 Query: 61 DSSLDSKETLPVGCLLS 77 S L + ET P GCL Sbjct: 61 SSDLKATETRPAGCLFE 77 >gi|319898847|ref|YP_004158940.1| hypothetical protein BARCL_0681 [Bartonella clarridgeiae 73] gi|319402811|emb|CBI76362.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 82 Score = 100 bits (250), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 44/78 (56%), Positives = 55/78 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IP+FQND G+ I+IGVK+FMC G + P DHPH+FI MG +EK CPYCSTLY + Sbjct: 1 MADHNIPYFQNDNGYKIIEIGVKEFMCIGATEPFDHPHIFIEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + +L +T P GC L Sbjct: 61 NHTLSHDQTNPTGCTYHL 78 >gi|307945522|ref|ZP_07660858.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] gi|307771395|gb|EFO30620.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] Length = 129 Score = 100 bits (250), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 41/74 (55%), Positives = 51/74 (68%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHFQN GH + IG ++FMC G PP DHPHVF++MG ENE CPYCSTL+ + Sbjct: 49 MADQVVPHFQNTSGHESVAIGAREFMCIGARPPFDHPHVFLDMGTENEIVCPYCSTLFKY 108 Query: 61 DSSLDSKETLPVGC 74 DS+L E+ P C Sbjct: 109 DSTLQPTESSPADC 122 >gi|319405610|emb|CBI79233.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 84 Score = 100 bits (248), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 42/75 (56%), Positives = 55/75 (73%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IP+FQND G+ I+IGVK+FMC G + P DHPH+FI MG +EK CPYCSTLY + Sbjct: 1 MADYNIPYFQNDNGYKIIEIGVKEFMCIGATQPFDHPHIFIEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCL 75 + +L +T P GC+ Sbjct: 61 NHTLAYNQTNPTGCI 75 >gi|254470431|ref|ZP_05083835.1| conserved hypothetical protein [Pseudovibrio sp. JE062] gi|211960742|gb|EEA95938.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 87 Score = 100 bits (248), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 43/77 (55%), Positives = 54/77 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G IKIG K+FMC G PPLDHPHVF++MG ++ CPYCSTLYH+ Sbjct: 7 MADKVVPHFHNSNGVEAIKIGAKEFMCIGAKPPLDHPHVFLDMGADDNAVCPYCSTLYHY 66 Query: 61 DSSLDSKETLPVGCLLS 77 D+SL S E+ P C+ + Sbjct: 67 DASLGSHESNPADCVWT 83 >gi|319407176|emb|CBI80815.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 82 Score = 99.4 bits (246), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 42/78 (53%), Positives = 56/78 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IP+FQND G+ I+IGVK+FMC G + P DHPH+F+ MG +EK CPYCSTLY + Sbjct: 1 MADYNIPYFQNDNGYKTIEIGVKEFMCIGATQPFDHPHIFLEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + +L +T P+GC L Sbjct: 61 NHTLPHNQTNPIGCTYHL 78 >gi|110633471|ref|YP_673679.1| hypothetical protein Meso_1118 [Mesorhizobium sp. BNC1] gi|110284455|gb|ABG62514.1| conserved hypothetical protein [Chelativorans sp. BNC1] Length = 81 Score = 99.4 bits (246), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 40/77 (51%), Positives = 55/77 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G+ I+IG K+FMC G PP DHPHVF++MG++NE+ CPYCSTLY + Sbjct: 1 MAGHATPHFHNTNGYPSIEIGAKEFMCVGAKPPFDHPHVFLDMGDDNERVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L +E++P CL + Sbjct: 61 NPALKGEESVPADCLYT 77 >gi|319404157|emb|CBI77750.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 82 Score = 98.6 bits (244), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 42/78 (53%), Positives = 55/78 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IP+FQND G+ I+IGVK+FMC G + P DHPH+F+ MG +EK CPYCSTLY + Sbjct: 1 MADYNIPYFQNDNGYKTIEIGVKEFMCIGATQPFDHPHIFLEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + +L +T P GC L Sbjct: 61 NHTLPHNQTNPTGCTYHL 78 >gi|254504330|ref|ZP_05116481.1| hypothetical protein SADFL11_4369 [Labrenzia alexandrii DFL-11] gi|222440401|gb|EEE47080.1| hypothetical protein SADFL11_4369 [Labrenzia alexandrii DFL-11] Length = 99 Score = 98.6 bits (244), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 42/74 (56%), Positives = 50/74 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHFQN GH I IG K+FMC G PP DHPHVF++MG E E CPYCSTLY + Sbjct: 19 MADQVVPHFQNTSGHDSIAIGAKEFMCIGAHPPFDHPHVFLDMGSEKEVVCPYCSTLYKY 78 Query: 61 DSSLDSKETLPVGC 74 D++L E+ P C Sbjct: 79 DATLAPNESSPSDC 92 >gi|304391884|ref|ZP_07373826.1| putative cytoplasmic protein [Ahrensia sp. R2A130] gi|303296113|gb|EFL90471.1| putative cytoplasmic protein [Ahrensia sp. R2A130] Length = 81 Score = 97.4 bits (241), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 41/76 (53%), Positives = 56/76 (73%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +PHF ND G IKIGV++FMC G + P DHPHV+++MG+++EK CPYCSTL+ F Sbjct: 1 MAKAIVPHFHNDGGVPTIKIGVREFMCIGATAPYDHPHVYLDMGDDDEKVCPYCSTLFRF 60 Query: 61 DSSLDSKETLPVGCLL 76 D+SL + E+ P CL+ Sbjct: 61 DASLAANESDPANCLM 76 >gi|121602298|ref|YP_989157.1| hypothetical protein BARBAKC583_0870 [Bartonella bacilliformis KC583] gi|120614475|gb|ABM45076.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 82 Score = 97.4 bits (241), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 43/74 (58%), Positives = 53/74 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH I H QND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADHNILHLQNDCGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGC 74 + SL +T P GC Sbjct: 61 NPSLQHNQTNPAGC 74 >gi|39936495|ref|NP_948771.1| hypothetical protein RPA3432 [Rhodopseudomonas palustris CGA009] gi|192292286|ref|YP_001992891.1| hypothetical protein Rpal_3919 [Rhodopseudomonas palustris TIE-1] gi|39650351|emb|CAE28873.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009] gi|192286035|gb|ACF02416.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1] Length = 81 Score = 96.7 bits (239), Expect = 9e-19, Method: Compositional matrix adjust. Identities = 41/76 (53%), Positives = 54/76 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G + I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVATIEIGSREFMCVGAAPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 + L E P C+L Sbjct: 61 AADLKPGEARPPECVL 76 >gi|91977757|ref|YP_570416.1| hypothetical protein RPD_3291 [Rhodopseudomonas palustris BisB5] gi|91684213|gb|ABE40515.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5] Length = 81 Score = 96.3 bits (238), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 43/76 (56%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G I+IG K+FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVPMIEIGSKEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L S E P C+L Sbjct: 61 APDLKSGEARPPECVL 76 >gi|316933306|ref|YP_004108288.1| hypothetical protein Rpdx1_1944 [Rhodopseudomonas palustris DX-1] gi|315601020|gb|ADU43555.1| hypothetical protein Rpdx1_1944 [Rhodopseudomonas palustris DX-1] Length = 81 Score = 95.5 bits (236), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 41/76 (53%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G + I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVATIEIGSREFMCVGAAPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L E P C+L Sbjct: 61 APDLKPGEARPPECVL 76 >gi|85715626|ref|ZP_01046606.1| hypothetical protein NB311A_18296 [Nitrobacter sp. Nb-311A] gi|85697565|gb|EAQ35442.1| hypothetical protein NB311A_18296 [Nitrobacter sp. Nb-311A] Length = 81 Score = 94.7 bits (234), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 39/76 (51%), Positives = 55/76 (72%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G + I+IG ++FMC G +PP DHPHVF+++G++NE CPYCSTLY F Sbjct: 1 MSDHIVPHFHNDSGVAVIEIGSREFMCVGANPPFDHPHVFLDLGDDNEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + + P C++ Sbjct: 61 AADLGAGQARPSECVV 76 >gi|75676366|ref|YP_318787.1| hypothetical protein Nwi_2181 [Nitrobacter winogradskyi Nb-255] gi|74421236|gb|ABA05435.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] Length = 81 Score = 94.0 bits (232), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 39/76 (51%), Positives = 55/76 (72%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G + I+IG ++FMC G +PP DHPHVF+++G++ E CPYCSTLY F Sbjct: 1 MSDHVVPHFHNDSGVAVIEIGSREFMCVGANPPFDHPHVFLDLGDDGEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L ++ P GC++ Sbjct: 61 AADLGPGQSRPPGCVV 76 >gi|27380701|ref|NP_772230.1| hypothetical protein bsr5590 [Bradyrhizobium japonicum USDA 110] gi|27353866|dbj|BAC50855.1| bsr5590 [Bradyrhizobium japonicum USDA 110] Length = 81 Score = 94.0 bits (232), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 41/76 (53%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY F Sbjct: 1 MSDHVVPHFHNDAGVPVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + E P C+L Sbjct: 61 AADLKAGEARPPECVL 76 >gi|328543244|ref|YP_004303353.1| Hypothetical Cytosolic Protein [Polymorphum gilvum SL003B-26A1] gi|326412990|gb|ADZ70053.1| Hypothetical Cytosolic Protein [Polymorphum gilvum SL003B-26A1] Length = 81 Score = 93.2 bits (230), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 40/76 (52%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQN GH I+IG ++FMC G +PP DHPHVF++MG++++ CPYCSTLY F Sbjct: 1 MADHVIPHFQNGSGHDCIEIGAREFMCIGANPPFDHPHVFLDMGDDDQIVCPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L ++ P C Sbjct: 61 NPKLKPTQSEPGDCAW 76 >gi|86749253|ref|YP_485749.1| hypothetical protein RPB_2132 [Rhodopseudomonas palustris HaA2] gi|86572281|gb|ABD06838.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2] Length = 81 Score = 92.4 bits (228), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 41/76 (53%), Positives = 52/76 (68%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQN+ G I+IG K+FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNEAGVPMIEIGSKEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L E P C+L Sbjct: 61 APDLGPGEARPPECVL 76 >gi|90424639|ref|YP_533009.1| hypothetical protein RPC_3148 [Rhodopseudomonas palustris BisB18] gi|90106653|gb|ABD88690.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18] Length = 81 Score = 92.4 bits (228), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 41/77 (53%), Positives = 52/77 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G I+IG K+FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFHNDAGVPIIEIGSKEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + L E P C+L Sbjct: 61 AADLAPGEARPPECVLQ 77 >gi|298292007|ref|YP_003693946.1| hypothetical protein Snov_2029 [Starkeya novella DSM 506] gi|296928518|gb|ADH89327.1| Protein of unknown function DUF2327 [Starkeya novella DSM 506] Length = 82 Score = 92.4 bits (228), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 42/75 (56%), Positives = 49/75 (65%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H +PHF N G I IG K+FMC G PP DHPHVF++MG ++E CPYCSTLY F Sbjct: 1 MAGHVVPHFHNSAGVPSISIGAKEFMCVGALPPYDHPHVFLDMGSDDEIICPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCL 75 DS L E+ P G L Sbjct: 61 DSYLHGTESTPPGAL 75 >gi|115524318|ref|YP_781229.1| hypothetical protein RPE_2308 [Rhodopseudomonas palustris BisA53] gi|115518265|gb|ABJ06249.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53] Length = 81 Score = 92.0 bits (227), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 40/76 (52%), Positives = 52/76 (68%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVPIIEIGSREFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 + L P C+L Sbjct: 61 AADLAPGAARPPECVL 76 >gi|92118096|ref|YP_577825.1| hypothetical protein Nham_2583 [Nitrobacter hamburgensis X14] gi|91800990|gb|ABE63365.1| conserved hypothetical protein [Nitrobacter hamburgensis X14] Length = 81 Score = 89.7 bits (221), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G + I+IG ++FMC G +PP DHPHVF+++G ++E CPYCSTLY F Sbjct: 1 MSDHVVPHFHNDAGVAVIEIGSQEFMCVGANPPFDHPHVFLDLGNDSEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + P C++ Sbjct: 61 AADLGPGQARPPECVV 76 >gi|158425168|ref|YP_001526460.1| hypothetical protein AZC_3544 [Azorhizobium caulinodans ORS 571] gi|158332057|dbj|BAF89542.1| hypothetical protein [Azorhizobium caulinodans ORS 571] Length = 82 Score = 89.7 bits (221), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 37/77 (48%), Positives = 51/77 (66%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D IPHF ND G S I++G ++FMC G PP DHPH+FI++G + E C YCSTLY + Sbjct: 1 MADTGIPHFCNDLGVSVIEVGAREFMCIGAKPPFDHPHIFIDLGSDTEAVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L + P GC+ + Sbjct: 61 NPALKAGTAKPEGCVWA 77 >gi|209884654|ref|YP_002288511.1| hypothetical protein OCAR_5515 [Oligotropha carboxidovorans OM5] gi|209872850|gb|ACI92646.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5] Length = 81 Score = 89.0 bits (219), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 39/77 (50%), Positives = 52/77 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF N G S I+IG ++FMC G +PP DHPHVF+++G ++E CPYCSTLY F Sbjct: 1 MADHIVPHFHNGPGVSVIEIGSREFMCIGANPPFDHPHVFLDLGNDDEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLS 77 L + E P C++ Sbjct: 61 APDLAAGEARPPQCVVE 77 >gi|254561394|ref|YP_003068489.1| hypothetical protein METDI2977 [Methylobacterium extorquens DM4] gi|254268672|emb|CAX24631.1| conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 88 Score = 88.6 bits (218), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 47/76 (61%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G + I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVTVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLL 76 D L S P GC+ Sbjct: 61 DPKLKSGTAEPAGCVW 76 >gi|148256546|ref|YP_001241131.1| hypothetical protein BBta_5236 [Bradyrhizobium sp. BTAi1] gi|146408719|gb|ABQ37225.1| hypothetical protein BBta_5236 [Bradyrhizobium sp. BTAi1] Length = 80 Score = 88.2 bits (217), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 51/76 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ +PHF ND G I+IG ++FMC G +PP DHPHVF+++G + E CPYCSTLY + Sbjct: 1 MADNIVPHFHNDAGVPVIEIGSREFMCVGANPPFDHPHVFLDLGNDKEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L + E P C+L Sbjct: 61 APDLAAGEARPPECVL 76 >gi|299135325|ref|ZP_07028516.1| Protein of unknown function DUF2327 [Afipia sp. 1NLS2] gi|298590302|gb|EFI50506.1| Protein of unknown function DUF2327 [Afipia sp. 1NLS2] Length = 81 Score = 88.2 bits (217), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 38/77 (49%), Positives = 51/77 (66%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF N +G S I+IG ++FMC G +PP DHPHVF+++G ++E CPYCSTLY F Sbjct: 1 MADHIVPHFHNGQGVSVIEIGSREFMCIGANPPFDHPHVFLDLGNDDEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLS 77 L P C++ Sbjct: 61 AGDLAPGAARPPQCVVE 77 >gi|188581413|ref|YP_001924858.1| hypothetical protein Mpop_2161 [Methylobacterium populi BJ001] gi|179344911|gb|ACB80323.1| conserved hypothetical protein [Methylobacterium populi BJ001] Length = 84 Score = 87.4 bits (215), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 46/76 (60%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G S I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVSVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLL 76 D L P GC+ Sbjct: 61 DPKLKPGTAEPAGCVW 76 >gi|300021599|ref|YP_003754210.1| hypothetical protein Hden_0062 [Hyphomicrobium denitrificans ATCC 51888] gi|299523420|gb|ADJ21889.1| Protein of unknown function DUF2327 [Hyphomicrobium denitrificans ATCC 51888] Length = 80 Score = 87.0 bits (214), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 38/77 (49%), Positives = 51/77 (66%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M IPHF ND G RI +GVK+F C G P DHPH++++MG++N+ CPYCSTLY + Sbjct: 1 MAGALIPHFANDVGAERIFVGVKEFNCMGARAPFDHPHIYLDMGQDNQILCPYCSTLYIY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L + E+ P L+S Sbjct: 61 DPRLKADESDPKNSLVS 77 >gi|154247160|ref|YP_001418118.1| hypothetical protein Xaut_3232 [Xanthobacter autotrophicus Py2] gi|154161245|gb|ABS68461.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2] Length = 85 Score = 87.0 bits (214), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 37/74 (50%), Positives = 49/74 (66%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D IPHF ND G + I++G K+FMC G PP DHPH+FI++G + E CPYCSTLY + Sbjct: 1 MADTGIPHFCNDLGVTLIEVGSKEFMCVGAKPPFDHPHIFIDLGGDTEAVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGC 74 + +L + P C Sbjct: 61 NPALAAGAAKPEEC 74 >gi|218530435|ref|YP_002421251.1| hypothetical protein Mchl_2481 [Methylobacterium chloromethanicum CM4] gi|218522738|gb|ACK83323.1| conserved hypothetical protein [Methylobacterium chloromethanicum CM4] Length = 88 Score = 86.7 bits (213), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 37/76 (48%), Positives = 46/76 (60%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G + I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVTVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLL 76 D L P GC+ Sbjct: 61 DPKLKPGTAEPAGCVW 76 >gi|146339932|ref|YP_001204980.1| hypothetical protein BRADO2936 [Bradyrhizobium sp. ORS278] gi|146192738|emb|CAL76743.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 80 Score = 86.7 bits (213), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 50/76 (65%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ +PHF ND G I+IG +FMC G +PP DHPHVF+++G + E CPYCSTLY + Sbjct: 1 MADNIVPHFHNDAGVPVIEIGSHEFMCVGANPPFDHPHVFLDLGNDKEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L + E P C+L Sbjct: 61 APDLSAGEARPPECVL 76 >gi|163851627|ref|YP_001639670.1| hypothetical protein Mext_2204 [Methylobacterium extorquens PA1] gi|240138794|ref|YP_002963267.1| hypothetical protein MexAM1_META1p2196 [Methylobacterium extorquens AM1] gi|163663232|gb|ABY30599.1| conserved hypothetical protein [Methylobacterium extorquens PA1] gi|240008764|gb|ACS39990.1| conserved hypothetical protein [Methylobacterium extorquens AM1] Length = 88 Score = 86.7 bits (213), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 37/76 (48%), Positives = 46/76 (60%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G + I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVTVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLL 76 D L P GC+ Sbjct: 61 DPKLKPGTAEPAGCVW 76 >gi|312114674|ref|YP_004012270.1| hypothetical protein Rvan_1935 [Rhodomicrobium vannielii ATCC 17100] gi|311219803|gb|ADP71171.1| hypothetical protein Rvan_1935 [Rhodomicrobium vannielii ATCC 17100] Length = 84 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 36/72 (50%), Positives = 51/72 (70%) Query: 6 IPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLD 65 +PHF ND G +I IGVK+F C G PP+DHPHV+++MG +++ CPYCSTL+ +D++L Sbjct: 6 VPHFHNDIGVEKIHIGVKEFQCVGARPPVDHPHVYLDMGADDQIVCPYCSTLFIYDANLR 65 Query: 66 SKETLPVGCLLS 77 +T P CL Sbjct: 66 PDQTDPPYCLFE 77 >gi|217977167|ref|YP_002361314.1| hypothetical protein Msil_0983 [Methylocella silvestris BL2] gi|217502543|gb|ACK49952.1| conserved hypothetical protein [Methylocella silvestris BL2] Length = 84 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 35/64 (54%), Positives = 45/64 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G R+++ ++FMC G PP DHPH+FI+MG+ +E CPYCSTLY F Sbjct: 1 MAAHATPHFHNQPGVPRVRVSAREFMCVGALPPFDHPHIFIDMGDADEAICPYCSTLYVF 60 Query: 61 DSSL 64 D+SL Sbjct: 61 DASL 64 >gi|23007575|ref|ZP_00049386.1| COG4391: Uncharacterized protein conserved in bacteria [Magnetospirillum magnetotacticum MS-1] Length = 86 Score = 85.1 bits (209), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 37/77 (48%), Positives = 46/77 (59%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G I +G K+FMC G PP DHPHVF++MG + E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGLRVIAVGSKEFMCIGALPPFDHPHVFLDMGGDTEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L S P CL + Sbjct: 61 DPKLKSGTAEPADCLWT 77 >gi|182677916|ref|YP_001832062.1| hypothetical protein Bind_0924 [Beijerinckia indica subsp. indica ATCC 9039] gi|182633799|gb|ACB94573.1| conserved hypothetical protein [Beijerinckia indica subsp. indica ATCC 9039] Length = 86 Score = 83.6 bits (205), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 35/64 (54%), Positives = 45/64 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G +++G K+FMC G PP DHPH+FI+MG++NE CPYCST Y + Sbjct: 1 MASHSTPHFHNQPGVETVRVGAKEFMCVGALPPCDHPHIFIDMGDDNEAICPYCSTHYVY 60 Query: 61 DSSL 64 D+SL Sbjct: 61 DASL 64 >gi|83308648|emb|CAJ01556.1| conserved hypothetical protein, similar to Bradyrhizobium japonicum bsr5599 [uncultured bacterium] Length = 197 Score = 83.6 bits (205), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 34/66 (51%), Positives = 45/66 (68%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G ++++G K+FMC G PP DHPH+FI+MG+ N+ CPYCST Y + Sbjct: 106 MATHSTPHFHNQPGVLQVRVGAKEFMCVGALPPFDHPHIFIDMGDSNDAICPYCSTHYVY 165 Query: 61 DSSLDS 66 D+ LD Sbjct: 166 DARLDG 171 >gi|323136590|ref|ZP_08071671.1| hypothetical protein Met49242DRAFT_1058 [Methylocystis sp. ATCC 49242] gi|322397907|gb|EFY00428.1| hypothetical protein Met49242DRAFT_1058 [Methylocystis sp. ATCC 49242] Length = 82 Score = 83.6 bits (205), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 33/64 (51%), Positives = 48/64 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +H PHF N G ++I++G K+FMC G PP DHPHV+++MG +++ CPYCSTL+ + Sbjct: 1 MAEHSTPHFHNTPGVAQIRVGAKEFMCIGALPPFDHPHVYLDMGADSQAVCPYCSTLFVY 60 Query: 61 DSSL 64 D+SL Sbjct: 61 DASL 64 >gi|170747021|ref|YP_001753281.1| hypothetical protein Mrad2831_0587 [Methylobacterium radiotolerans JCM 2831] gi|170653543|gb|ACB22598.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM 2831] Length = 85 Score = 83.6 bits (205), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 35/76 (46%), Positives = 48/76 (63%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +PHF N+ G I +GVK+FMC G PP DHPHVF++MG ++E C YCSTLY + Sbjct: 1 MAGKAVPHFHNEPGVPVITVGVKEFMCIGALPPFDHPHVFLDMGADSEIICQYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + + P C+ Sbjct: 61 RAGLKADQAEPQACVW 76 >gi|296448470|ref|ZP_06890352.1| Protein of unknown function DUF2327 [Methylosinus trichosporium OB3b] gi|296254022|gb|EFH01167.1| Protein of unknown function DUF2327 [Methylosinus trichosporium OB3b] Length = 86 Score = 83.2 bits (204), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 35/58 (60%), Positives = 43/58 (74%) Query: 7 PHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSL 64 PHF N G ++I++G K+FMC G PP DHPHVFI+MG +E CPYCSTLY +D SL Sbjct: 7 PHFHNQPGVAKIRVGAKEFMCIGALPPFDHPHVFIDMGAADEAVCPYCSTLYVYDESL 64 >gi|220927244|ref|YP_002502546.1| hypothetical protein Mnod_7506 [Methylobacterium nodulans ORS 2060] gi|219951851|gb|ACL62243.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] Length = 85 Score = 82.8 bits (203), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 37/76 (48%), Positives = 45/76 (59%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G I +G K+FMC G PP DHPHVF++MG E+E C YCSTLY + Sbjct: 1 MADKAVPHFHNQDGVRVIHVGSKEFMCIGALPPFDHPHVFLDMGAESEIICQYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 S L P C+ Sbjct: 61 RSDLKPGTADPASCVW 76 >gi|154253046|ref|YP_001413870.1| hypothetical protein Plav_2605 [Parvibaculum lavamentivorans DS-1] gi|154156996|gb|ABS64213.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1] Length = 87 Score = 81.6 bits (200), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 37/71 (52%), Positives = 44/71 (61%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M P F N G I+ GVK+F C G PP DHPHVF++MG ENE C YCSTLY F Sbjct: 1 MSGGATPKFSNQAGVREIRTGVKEFECIGALPPFDHPHVFLDMGRENEIVCGYCSTLYRF 60 Query: 61 DSSLDSKETLP 71 D +L + +LP Sbjct: 61 DPALSADASLP 71 >gi|170744783|ref|YP_001773438.1| hypothetical protein M446_6759 [Methylobacterium sp. 4-46] gi|168199057|gb|ACA21004.1| conserved hypothetical protein [Methylobacterium sp. 4-46] Length = 85 Score = 79.3 bits (194), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 35/76 (46%), Positives = 43/76 (56%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G I +G K+FMC G PP DHPHVF++MG E+E C YCSTLY + Sbjct: 1 MADKAVPHFHNQDGARVIHVGSKEFMCIGALPPFDHPHVFLDMGAESEIICQYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L P + Sbjct: 61 RGDLKPGTADPASAVW 76 >gi|71023385|ref|XP_761922.1| hypothetical protein UM05775.1 [Ustilago maydis 521] gi|46100781|gb|EAK86014.1| hypothetical protein UM05775.1 [Ustilago maydis 521] Length = 211 Score = 40.0 bits (92), Expect = 0.096, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 18 IKIGVKKFM-CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFD 61 I++ K+ C G PL HP VFIN+ + K CPYC + D Sbjct: 162 IRLSSKRIAACDGGGGPLGHPKVFINLDKPGPKPCPYCGIRFELD 206 >gi|144899390|emb|CAM76254.1| protein conserved in bacteria [Magnetospirillum gryphiswaldense MSR-1] Length = 72 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 22/41 (53%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 I + C G + L HP V++NMG + + CPYCS Y Sbjct: 20 IVVETNHVACDGGNAGLGHPRVYLNMGHDRQVVCPYCSRTY 60 >gi|99034961|ref|ZP_01314765.1| hypothetical protein Wendoof_01000407 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] gi|225629851|ref|ZP_03787762.1| hypothetical protein WUni_002050 [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225630151|ref|YP_002726942.1| hypothetical protein WRi_003400 [Wolbachia sp. wRi] gi|225591295|gb|EEH12424.1| hypothetical protein WUni_002050 [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225592132|gb|ACN95151.1| hypothetical protein WRi_003400 [Wolbachia sp. wRi] Length = 63 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Query: 16 SRIKIGVKKFMCAG--TSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 S++++ +K C G HP ++++MGEE E CPYC + D ++++ Sbjct: 2 SKVRVNNRKVCCHGDENDEGSGHPLIYLDMGEEEEIACPYCEKTFVHDCTVEA 54 >gi|164662120|ref|XP_001732182.1| hypothetical protein MGL_0775 [Malassezia globosa CBS 7966] gi|159106084|gb|EDP44968.1| hypothetical protein MGL_0775 [Malassezia globosa CBS 7966] Length = 178 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 18/33 (54%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYH 59 C G PL HP VFIN+ + K CPYC Y Sbjct: 139 CDGGDGPLGHPRVFINLDKPEPKPCPYCGIRYQ 171 >gi|58585059|ref|YP_198632.1| NADH:ubiquinone oxidoreductase Fe-S subunit [Wolbachia endosymbiont strain TRS of Brugia malayi] gi|58419375|gb|AAW71390.1| NADH:ubiquinone oxidoreductase Fe-S subunit [Wolbachia endosymbiont strain TRS of Brugia malayi] Length = 65 Score = 37.7 bits (86), Expect = 0.50, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Query: 16 SRIKIGVKKFMC--AGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 + +++ +K C G + HP ++++MGEE E CPYC + D ++++ Sbjct: 2 AEVRVNKRKVCCHGDGNNEGSGHPLIYLDMGEEEEIACPYCEKTFVHDCTVEA 54 >gi|160935838|ref|ZP_02083213.1| hypothetical protein CLOBOL_00730 [Clostridium bolteae ATCC BAA-613] gi|158441582|gb|EDP19292.1| hypothetical protein CLOBOL_00730 [Clostridium bolteae ATCC BAA-613] Length = 501 Score = 37.4 bits (85), Expect = 0.67, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Query: 3 DHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDS 62 D P+P F N R ++ ++GVK +C G + PH F E+ E+H S +++ Sbjct: 131 DSPVPAFNNARAYA--EVGVKDIVCTGPC-HVPWPHRFSRYTEDGERHMSQVS----YET 183 Query: 63 SLDSKETL 70 L+S ET+ Sbjct: 184 VLESLETV 191 >gi|290562193|gb|ADD38493.1| NADH dehydrogenase iron-sulfur protein 6, mitochondrial [Lepeophtheirus salmonis] Length = 126 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 22/46 (47%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS 63 I++ + C G PL HP VFIN+ + C YC Y SS Sbjct: 80 IEVTERIVACDGGDGPLGHPRVFINLDDGEPSACIYCQLRYVLKSS 125 >gi|290462511|gb|ADD24303.1| NADH dehydrogenase iron-sulfur protein 6, mitochondrial [Lepeophtheirus salmonis] Length = 126 Score = 37.0 bits (84), Expect = 0.99, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 22/46 (47%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS 63 I++ + C G PL HP VFIN+ + C YC Y SS Sbjct: 80 IEVTERIVACDGGGGPLGHPRVFINLDDGEPSACIYCRLRYVLKSS 125 >gi|42520388|ref|NP_966303.1| hypothetical protein WD0525 [Wolbachia endosymbiont of Drosophila melanogaster] gi|42410126|gb|AAS14237.1| hypothetical protein WD_0525 [Wolbachia endosymbiont of Drosophila melanogaster] Length = 63 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query: 16 SRIKIGVKKFMCAG--TSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 S++++ +K C G HP + ++MGEE E CPYC + D ++++ Sbjct: 2 SKVRVNNRKVCCHGDENDEGSGHPLISLDMGEEEEIACPYCEKTFVHDCTVEA 54 >gi|239946681|ref|ZP_04698434.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes scapularis] gi|239920957|gb|EER20981.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes scapularis] Length = 54 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 27 CAGTSPPLDHPHVFINM-GEENEKHCPYCSTLYHF 60 C G PP DHP V++ + E+ E CPYCS + Sbjct: 17 CQGKEPPYDHPKVYLEIDKEKKEVICPYCSKKFKL 51 >gi|326403698|ref|YP_004283780.1| hypothetical protein ACMV_15510 [Acidiphilium multivorum AIU301] gi|325050560|dbj|BAJ80898.1| hypothetical protein ACMV_15510 [Acidiphilium multivorum AIU301] Length = 75 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 I++ + C G PL HP V++ + E+ E CPYCS Y ++ E Sbjct: 24 IQVRERTVACDGGGGPLGHPRVYLKI-EDREVTCPYCSRHYVLTGNVTPGE 73 >gi|67459780|ref|YP_247404.1| hypothetical protein RF_1388 [Rickettsia felis URRWXCal2] gi|67005313|gb|AAY62239.1| unknown [Rickettsia felis URRWXCal2] Length = 50 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 27 CAGTSPPLDHPHVFINM-GEENEKHCPYCSTLYHF 60 C G PP DHP V++ + E+ E CPYCS + Sbjct: 13 CQGKEPPYDHPKVYLEIDKEKKEIVCPYCSKKFKL 47 >gi|304320503|ref|YP_003854146.1| hypothetical protein PB2503_04647 [Parvularcula bermudensis HTCC2503] gi|303299405|gb|ADM09004.1| hypothetical protein PB2503_04647 [Parvularcula bermudensis HTCC2503] Length = 116 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Query: 23 KKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS-----LDSKETLPV 72 ++ +C G L HP VF +G C YC ++ FD S L+ + +P Sbjct: 35 RRVVCDGPGGGLGHPRVFYTIGTAGYAECGYCDRVFVFDPSRKGERLEGRAAIPA 89 >gi|170085147|ref|XP_001873797.1| predicted protein [Laccaria bicolor S238N-H82] gi|164651349|gb|EDR15589.1| predicted protein [Laccaria bicolor S238N-H82] Length = 141 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 23 KKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFD 61 +K +C G PL HP ++IN+ + + C YC + D Sbjct: 98 RKAVCDGGGGPLGHPKIYINLDQPGPRACGYCGIRFEQD 136 >gi|148260505|ref|YP_001234632.1| hypothetical protein Acry_1505 [Acidiphilium cryptum JF-5] gi|146402186|gb|ABQ30713.1| hypothetical protein Acry_1505 [Acidiphilium cryptum JF-5] Length = 75 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 I++ + C G PL HP V++ + E+ E CPYCS Y Sbjct: 24 IQVRERTVACDGGGGPLGHPRVYLKI-EDREVTCPYCSRHY 63 >gi|302877758|ref|YP_003846322.1| Zinc finger, CHCC-type [Gallionella capsiferriformans ES-2] gi|302580547|gb|ADL54558.1| Zinc finger, CHCC-type [Gallionella capsiferriformans ES-2] Length = 64 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 16/25 (64%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHF 60 HP V + + E E HCPYC TLY F Sbjct: 31 HPRVALALDGEGEAHCPYCGTLYKF 55 >gi|281212099|gb|EFA86260.1| putative NADH dehydrogenase [Polysphondylium pallidum PN500] Length = 112 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 ++I K C G + PL HP V+IN+ + C YC + Sbjct: 50 VEISADKIGCDGGNGPLGHPMVYINLDNAEPQACGYCGIRF 90 >gi|83859034|ref|ZP_00952555.1| hypothetical protein OA2633_11555 [Oceanicaulis alexandrii HTCC2633] gi|83852481|gb|EAP90334.1| hypothetical protein OA2633_11555 [Oceanicaulis alexandrii HTCC2633] Length = 66 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 21/46 (45%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS 63 I + K+ MC G L HP + MG+E+ C YC + S Sbjct: 15 IVVDQKRVMCDGGGGALGHPRTWYEMGDEDFVECGYCDRRFVLRGS 60 >gi|197106928|ref|YP_002132305.1| hypothetical protein PHZ_c3467 [Phenylobacterium zucineum HLK1] gi|196480348|gb|ACG79876.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1] Length = 101 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 14/51 (27%), Positives = 21/51 (41%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 + + + C G L HP V++ MGE CPYC + + E Sbjct: 36 VTVRSGRIACDGVGGALGHPRVWLEMGEATFVECPYCDRRFVLAEGSEGAE 86 >gi|260219792|emb|CBA26679.1| hypothetical protein Csp_H39800 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 68 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Query: 28 AGTSPPLDHPHVFINMGEENEKHCPYCSTLY------HFDS 62 AG HP V++++G E CPYC T+Y HFD Sbjct: 26 AGMQTWNTHPKVYLDVGRAGEAKCPYCGTVYKLKDGEHFDG 66 >gi|300692417|ref|YP_003753412.1| hypothetical protein RPSI07_2787 [Ralstonia solanacearum PSI07] gi|299079477|emb|CBJ52152.1| conserved protein of unknown function [Ralstonia solanacearum PSI07] Length = 65 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ + E CPYC T+Y ++ K Sbjct: 31 HPRVFLDIADTGEAKCPYCGTVYKLAPGVEVK 62 >gi|17545285|ref|NP_518687.1| hypothetical protein RSc0566 [Ralstonia solanacearum GMI1000] gi|17427577|emb|CAD14096.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000] Length = 65 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ + E CPYC T+Y ++ K Sbjct: 31 HPRVFLDVADTGEAKCPYCGTVYKLAPGVEVK 62 >gi|316967144|gb|EFV51620.1| conserved hypothetical protein [Trichinella spiralis] Length = 244 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCS-TLYHFDSSLDSKETLPVG--CLLSL 78 C G L HP VFIN+ + C YC Y+ + D E + +G C+L L Sbjct: 154 CDGGGTALGHPRVFINLDKPGNHACGYCGLRFYNENVPSDGSEQIEIGRICVLKL 208 >gi|299067870|emb|CBJ39081.1| conserved protein of unknown function [Ralstonia solanacearum CMR15] Length = 65 Score = 35.0 bits (79), Expect = 3.0, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ + E CPYC T+Y ++ K Sbjct: 31 HPRVFLDVADTGEAKCPYCGTVYKLAPGVEVK 62 >gi|83746082|ref|ZP_00943137.1| Hypothetical protein RRSL_04111 [Ralstonia solanacearum UW551] gi|207728026|ref|YP_002256420.1| hypothetical protein RSMK04357 [Ralstonia solanacearum MolK2] gi|207742422|ref|YP_002258814.1| hypothetical protein RSIPO_00610 [Ralstonia solanacearum IPO1609] gi|300705071|ref|YP_003746674.1| hypothetical protein RCFBP_20908 [Ralstonia solanacearum CFBP2957] gi|83727265|gb|EAP74388.1| Hypothetical protein RRSL_04111 [Ralstonia solanacearum UW551] gi|206591270|emb|CAQ56882.1| conserved hypothetical protein [Ralstonia solanacearum MolK2] gi|206593812|emb|CAQ60739.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609] gi|299072735|emb|CBJ44088.1| conserved protein of unknown function [Ralstonia solanacearum CFBP2957] Length = 65 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ + E CPYC T+Y ++ K Sbjct: 31 HPRVFLDIADTGEVRCPYCGTVYKLAPGVEVK 62 >gi|15893285|ref|NP_360999.1| hypothetical protein RC1362 [Rickettsia conorii str. Malish 7] gi|229587255|ref|YP_002845756.1| hypothetical protein RAF_ORF1248 [Rickettsia africae ESF-5] gi|15620506|gb|AAL03900.1| unknown [Rickettsia conorii str. Malish 7] gi|228022305|gb|ACP54013.1| Unknown [Rickettsia africae ESF-5] Length = 54 Score = 35.0 bits (79), Expect = 3.2, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 27 CAGTSPPLDHPHVFINM-GEENEKHCPYCSTLYHF 60 C G PP DHP V++ + ++ E CPYCS + Sbjct: 17 CQGKEPPYDHPKVYLEIDKKKKEVICPYCSKKFKL 51 >gi|187927587|ref|YP_001898074.1| hypothetical protein Rpic_0487 [Ralstonia pickettii 12J] gi|187724477|gb|ACD25642.1| conserved hypothetical protein [Ralstonia pickettii 12J] Length = 65 Score = 35.0 bits (79), Expect = 3.3, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ + E CPYC T+Y ++ K Sbjct: 31 HPRVFLDIADTGEAKCPYCGTVYKLAPGVELK 62 >gi|33598069|ref|NP_885712.1| hypothetical protein BPP3552 [Bordetella parapertussis 12822] gi|33566627|emb|CAE38836.1| conserved hypothetical protein [Bordetella parapertussis] Length = 70 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 15 HSRIKIGVKKF--MCAGTSPPLD--HPHVFINMGEENEKHCPYCSTLYHF 60 H I++G + CAG PL HP VF+++ + CPYC Y Sbjct: 12 HDAIEVGAEDLPVYCAGPKAPLWSMHPRVFLDVTHTGQASCPYCGAAYRL 61 >gi|319944569|ref|ZP_08018838.1| hypothetical protein HMPREF0551_1686 [Lautropia mirabilis ATCC 51599] gi|319742165|gb|EFV94583.1| hypothetical protein HMPREF0551_1686 [Lautropia mirabilis ATCC 51599] Length = 67 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 17/26 (65%) Query: 35 DHPHVFINMGEENEKHCPYCSTLYHF 60 HP V++++ E + CPYCSTLY Sbjct: 32 QHPRVYLDVTHEGQARCPYCSTLYRL 57 >gi|114568622|ref|YP_755302.1| hypothetical protein Mmar10_0068 [Maricaulis maris MCS10] gi|114339084|gb|ABI64364.1| hypothetical protein Mmar10_0068 [Maricaulis maris MCS10] Length = 65 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 19/35 (54%) Query: 24 KFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 + C G L HP V++ MG+++ CPYC + Sbjct: 20 RMACDGGGGALGHPRVYLEMGQDDFVECPYCDRRF 54 >gi|319761030|ref|YP_004124967.1| zinc finger, chcc-type [Alicycliphilus denitrificans BC] gi|330822888|ref|YP_004386191.1| hypothetical protein Alide2_0245 [Alicycliphilus denitrificans K601] gi|317115591|gb|ADU98079.1| Zinc finger, CHCC-type [Alicycliphilus denitrificans BC] gi|329308260|gb|AEB82675.1| hypothetical protein Alide2_0245 [Alicycliphilus denitrificans K601] Length = 68 Score = 35.0 bits (79), Expect = 3.6, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSS 63 HP VF+ + + + CPYC TLY + Sbjct: 34 HPRVFLEIAHQGQAQCPYCGTLYRLKAG 61 >gi|241662092|ref|YP_002980452.1| hypothetical protein Rpic12D_0474 [Ralstonia pickettii 12D] gi|309780634|ref|ZP_07675376.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] gi|240864119|gb|ACS61780.1| conserved hypothetical protein [Ralstonia pickettii 12D] gi|308920557|gb|EFP66212.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] Length = 65 Score = 35.0 bits (79), Expect = 3.6, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ + E CPYC T+Y ++ K Sbjct: 31 HPRVFLDIADTGEAKCPYCGTVYKLAPGVELK 62 >gi|83313311|ref|YP_423575.1| hypothetical protein amb4212 [Magnetospirillum magneticum AMB-1] gi|82948152|dbj|BAE53016.1| Uncharacterized protein conserved in bacteria [Magnetospirillum magneticum AMB-1] Length = 65 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 18 IKIGVKKFMCAG-TSPPLDHPHVFINMGEENEKHCPYCSTLY 58 + + K C G + L HP VF+++ E + CPYCS Y Sbjct: 13 VTVSAAKVACDGDVANGLGHPRVFLDLTAEGKIVCPYCSRTY 54 >gi|332112616|gb|EGJ12409.1| hypothetical protein RBXJA2T_18854 [Rubrivivax benzoatilyticus JA2] Length = 67 Score = 34.7 bits (78), Expect = 3.9, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 35 DHPHVFINMGEENEKHCPYCSTLYHFDSSL 64 +HP VFI++ E CPYC T+Y + Sbjct: 33 NHPRVFIDVATTGEGRCPYCGTVYKLAPGV 62 >gi|157826373|ref|YP_001494093.1| hypothetical protein A1C_06810 [Rickettsia akari str. Hartford] gi|157800331|gb|ABV75585.1| hypothetical protein A1C_06810 [Rickettsia akari str. Hartford] Length = 50 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 27 CAGTSPPLDHPHVFINM-GEENEKHCPYCSTLYHF 60 C G PP DHP +++ + E+ E CPYCS + Sbjct: 13 CHGKEPPYDHPKIYLEIDKEKKEVICPYCSKKFKL 47 >gi|91206201|ref|YP_538556.1| hypothetical protein RBE_1386 [Rickettsia bellii RML369-C] gi|157827811|ref|YP_001496875.1| hypothetical protein A1I_07700 [Rickettsia bellii OSU 85-389] gi|91069745|gb|ABE05467.1| unknown [Rickettsia bellii RML369-C] gi|157803115|gb|ABV79838.1| hypothetical protein A1I_07700 [Rickettsia bellii OSU 85-389] Length = 63 Score = 34.3 bits (77), Expect = 5.1, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 27 CAGTSPPLDHPHVFINM-GEENEKHCPYCSTLYHF 60 C G PP DHP V++ + E+ E C YCS + Sbjct: 25 CCGKEPPYDHPRVYLEIDKEKKEVSCLYCSKKFRL 59 >gi|198282839|ref|YP_002219160.1| hypothetical protein Lferr_0702 [Acidithiobacillus ferrooxidans ATCC 53993] gi|218667955|ref|YP_002425038.1| hypothetical protein AFE_0546 [Acidithiobacillus ferrooxidans ATCC 23270] gi|198247360|gb|ACH82953.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC 53993] gi|218520168|gb|ACK80754.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC 23270] Length = 70 Score = 34.3 bits (77), Expect = 6.3, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 15/23 (65%) Query: 36 HPHVFINMGEENEKHCPYCSTLY 58 HP VF+ + E E CPYC TLY Sbjct: 35 HPRVFLKIEETGEVRCPYCGTLY 57 >gi|242209999|ref|XP_002470844.1| hypothetical ubiquinone oxidoreductase 20 kD subunit [Postia placenta Mad-698-R] gi|242212403|ref|XP_002472035.1| predicted protein [Postia placenta Mad-698-R] gi|220728858|gb|EED82743.1| predicted protein [Postia placenta Mad-698-R] gi|220730071|gb|EED83934.1| hypothetical ubiquinone oxidoreductase 20 kD subunit [Postia placenta Mad-698-R] Length = 137 Score = 34.3 bits (77), Expect = 6.5, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 20/36 (55%) Query: 23 KKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 +K +C G PL HP +FIN+ + + C YC + Sbjct: 92 RKAVCDGGGGPLGHPKIFINLDKPGPRPCGYCGLRF 127 >gi|258543170|ref|YP_003188603.1| hypothetical protein APA01_21090 [Acetobacter pasteurianus IFO 3283-01] gi|256634248|dbj|BAI00224.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01] gi|256637308|dbj|BAI03277.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03] gi|256640360|dbj|BAI06322.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07] gi|256643417|dbj|BAI09372.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22] gi|256646472|dbj|BAI12420.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26] gi|256649525|dbj|BAI15466.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32] gi|256652511|dbj|BAI18445.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655569|dbj|BAI21496.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12] Length = 71 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Query: 4 HPIPHFQNDRGH-SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDS 62 +P+PH + GH I + +K C G L HP V++ +G ++ CPYCS L+ Sbjct: 7 NPVPHPK--LGHVETIMVDKRKIACDGGLGALGHPRVWLKIG-GHQTVCPYCSRLFVLQP 63 Query: 63 SLDS 66 ++ Sbjct: 64 DAEA 67 >gi|254420445|ref|ZP_05034169.1| hypothetical protein BBAL3_2755 [Brevundimonas sp. BAL3] gi|196186622|gb|EDX81598.1| hypothetical protein BBAL3_2755 [Brevundimonas sp. BAL3] Length = 79 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 22/43 (51%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 + + K+ C G L HP V+++MGE++ C YC + Sbjct: 14 EEVVVSTKRVACDGGGGALGHPLVYMDMGEDDFIECGYCDRRF 56 >gi|329890934|ref|ZP_08269277.1| zinc-finger domain protein [Brevundimonas diminuta ATCC 11568] gi|328846235|gb|EGF95799.1| zinc-finger domain protein [Brevundimonas diminuta ATCC 11568] Length = 63 Score = 33.9 bits (76), Expect = 8.2, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 20 IGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 + K+ C G L HP V+++MGE++ C YC + Sbjct: 2 VSTKRVACDGGGGALGHPLVYMDMGEDDFIECGYCDRRF 40 >gi|91083249|ref|XP_974018.1| PREDICTED: similar to CG8680 CG8680-PA [Tribolium castaneum] gi|270008233|gb|EFA04681.1| hypothetical protein TcasGA2_TC014412 [Tribolium castaneum] Length = 125 Score = 33.9 bits (76), Expect = 8.3, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 17/36 (47%) Query: 26 MCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFD 61 C G P HP V+IN+ + C YC Y+ D Sbjct: 87 WCDGGGGPTGHPKVYINLDKPGNHSCGYCGLRYYLD 122 >gi|156398040|ref|XP_001637997.1| predicted protein [Nematostella vectensis] gi|156225114|gb|EDO45934.1| predicted protein [Nematostella vectensis] Length = 95 Score = 33.5 bits (75), Expect = 8.7, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 20/45 (44%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDS 62 IKI + C G L HP VFIN+ E C YC + D Sbjct: 49 IKIKGRSVNCDGGGGALGHPKVFINLDPEGPHTCGYCGLRFIRDD 93 >gi|241048562|ref|XP_002407295.1| NADH ubiquinone oxidoreductase subunit, putative [Ixodes scapularis] gi|215492175|gb|EEC01816.1| NADH ubiquinone oxidoreductase subunit, putative [Ixodes scapularis] Length = 125 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 17/38 (44%) Query: 26 MCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS 63 C G P L HP VFIN+ C YC + D S Sbjct: 84 WCDGGDPALGHPRVFINLDAPGNHACGYCGLRFFQDPS 121 >gi|328872104|gb|EGG20471.1| putative NADH dehydrogenase [Dictyostelium fasciculatum] Length = 100 Score = 33.5 bits (75), Expect = 9.1, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 22/41 (53%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 I+I + C G + PL HP V+IN+ E + C YC + Sbjct: 52 IEIDGHRIGCDGGNGPLGHPMVYINLDGEKPQSCGYCGLRF 92 >gi|160895766|ref|YP_001561348.1| hypothetical protein Daci_0317 [Delftia acidovorans SPH-1] gi|160361350|gb|ABX32963.1| conserved hypothetical protein [Delftia acidovorans SPH-1] Length = 69 Score = 33.5 bits (75), Expect = 9.7, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSS 63 HP V++++ E CPYC TLY + Sbjct: 35 HPKVYLDVAHTGEAKCPYCGTLYRLKAG 62 Searching..................................................done Results from round 2 CONVERGED! >gi|227821883|ref|YP_002825853.1| hypothetical protein NGR_c13200 [Sinorhizobium fredii NGR234] gi|227340882|gb|ACP25100.1| hypothetical protein NGR_c13200 [Sinorhizobium fredii NGR234] Length = 140 Score = 146 bits (370), Expect = 8e-34, Method: Composition-based stats. Identities = 48/77 (62%), Positives = 59/77 (76%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY + Sbjct: 60 MAGHSIPHFQNDGGHQVIEIGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRY 119 Query: 61 DSSLDSKETLPVGCLLS 77 ++SL + ET+P GCL Sbjct: 120 NASLKATETIPPGCLFE 136 >gi|86357522|ref|YP_469414.1| hypothetical protein RHE_CH01901 [Rhizobium etli CFN 42] gi|86281624|gb|ABC90687.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 81 Score = 143 bits (360), Expect = 1e-32, Method: Composition-based stats. Identities = 45/78 (57%), Positives = 58/78 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY + Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 ++SL +T P GC+ + Sbjct: 61 NASLKPSQTNPAGCVFHV 78 >gi|327190787|gb|EGE57855.1| hypothetical protein RHECNPAF_371006 [Rhizobium etli CNPAF512] Length = 81 Score = 142 bits (359), Expect = 1e-32, Method: Composition-based stats. Identities = 47/78 (60%), Positives = 58/78 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY F Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 +SSL +T P GC+ + Sbjct: 61 NSSLKPTQTNPAGCVFHV 78 >gi|15965234|ref|NP_385587.1| hypothetical protein SMc02115 [Sinorhizobium meliloti 1021] gi|307309257|ref|ZP_07588925.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti BL225C] gi|307316999|ref|ZP_07596440.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti AK83] gi|15074414|emb|CAC46060.1| Hypothetical unknown protein [Sinorhizobium meliloti 1021] gi|306897087|gb|EFN27832.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti AK83] gi|306900258|gb|EFN30875.1| Protein of unknown function DUF2327 [Sinorhizobium meliloti BL225C] Length = 81 Score = 142 bits (359), Expect = 1e-32, Method: Composition-based stats. Identities = 48/77 (62%), Positives = 59/77 (76%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+F++MG+ENEK C YCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHRVIEIGVKEFMCTGASVPFDHPHIFVDMGDENEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + SL + ET+P GCL + Sbjct: 61 NPSLKATETIPPGCLFT 77 >gi|150396330|ref|YP_001326797.1| hypothetical protein Smed_1111 [Sinorhizobium medicae WSM419] gi|150027845|gb|ABR59962.1| conserved hypothetical protein [Sinorhizobium medicae WSM419] Length = 81 Score = 142 bits (359), Expect = 1e-32, Method: Composition-based stats. Identities = 49/77 (63%), Positives = 59/77 (76%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+F++MG+ENEK C YCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHRVIEIGVKEFMCTGASVPFDHPHIFVDMGDENEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + SL + ET+P GCL S Sbjct: 61 NPSLKATETIPPGCLFS 77 >gi|159184822|ref|NP_354572.2| hypothetical protein Atu1573 [Agrobacterium tumefaciens str. C58] gi|325292967|ref|YP_004278831.1| hypothetical protein AGROH133_06362 [Agrobacterium sp. H13-3] gi|159140107|gb|AAK87357.2| hypothetical protein Atu1573 [Agrobacterium tumefaciens str. C58] gi|325060820|gb|ADY64511.1| hypothetical protein AGROH133_06362 [Agrobacterium sp. H13-3] Length = 81 Score = 142 bits (359), Expect = 1e-32, Method: Composition-based stats. Identities = 47/78 (60%), Positives = 60/78 (76%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GHS I+IGVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHSVIEIGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + SL +++T P GC+ + Sbjct: 61 NPSLKAEQTNPPGCVFHV 78 >gi|222085844|ref|YP_002544374.1| hypothetical protein Arad_2204 [Agrobacterium radiobacter K84] gi|221723292|gb|ACM26448.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 81 Score = 142 bits (359), Expect = 2e-32, Method: Composition-based stats. Identities = 45/78 (57%), Positives = 57/78 (73%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I+IGVK+FMC G S P DHPH+FI++G+E+EK C YCSTLY + Sbjct: 1 MAGHNIPHFQNDGGHRVIEIGVKEFMCTGASVPYDHPHIFIDLGDESEKVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + SL + +T P GC+ Sbjct: 61 NPSLKADQTNPAGCVFQF 78 >gi|190891591|ref|YP_001978133.1| hypothetical protein RHECIAT_CH0001994 [Rhizobium etli CIAT 652] gi|218516838|ref|ZP_03513678.1| hypothetical protein Retl8_26169 [Rhizobium etli 8C-3] gi|218663451|ref|ZP_03519381.1| hypothetical protein RetlI_31263 [Rhizobium etli IE4771] gi|190696870|gb|ACE90955.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 81 Score = 142 bits (358), Expect = 2e-32, Method: Composition-based stats. Identities = 47/78 (60%), Positives = 58/78 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY F Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASVPFDHPHIFIDMGDDNEKVCSYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 +SSL +T P GC+ + Sbjct: 61 NSSLKPSQTNPAGCVFHV 78 >gi|116251963|ref|YP_767801.1| hypothetical protein RL2207 [Rhizobium leguminosarum bv. viciae 3841] gi|209549165|ref|YP_002281082.1| hypothetical protein Rleg2_1566 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|241204491|ref|YP_002975587.1| hypothetical protein Rleg_1763 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|115256611|emb|CAK07699.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] gi|209534921|gb|ACI54856.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM2304] gi|240858381|gb|ACS56048.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 81 Score = 141 bits (356), Expect = 3e-32, Method: Composition-based stats. Identities = 46/78 (58%), Positives = 58/78 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH I++GVK+FMC G S P DHPH+FI+MG++NEK C YCSTLY F Sbjct: 1 MAGHNIPHFQNDGGHRVIEVGVKEFMCTGASAPFDHPHIFIDMGDDNEKVCSYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 +S+L +T P GC+ + Sbjct: 61 NSALKPSQTNPAGCVFHV 78 >gi|165760869|pdb|2JZ8|A Chain A, Solution Nmr Structure Of Bh09830 From Bartonella Henselae Modeled With One Zn+2 Bound. Northeast Structural Genomics Consortium Target Bnr55 Length = 87 Score = 141 bits (356), Expect = 3e-32, Method: Composition-based stats. Identities = 46/77 (59%), Positives = 57/77 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D SL +T P GCL + Sbjct: 61 DPSLSYNQTNPTGCLYN 77 >gi|307945522|ref|ZP_07660858.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] gi|307771395|gb|EFO30620.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] Length = 129 Score = 141 bits (355), Expect = 4e-32, Method: Composition-based stats. Identities = 41/77 (53%), Positives = 52/77 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHFQN GH + IG ++FMC G PP DHPHVF++MG ENE CPYCSTL+ + Sbjct: 49 MADQVVPHFQNTSGHESVAIGAREFMCIGARPPFDHPHVFLDMGTENEIVCPYCSTLFKY 108 Query: 61 DSSLDSKETLPVGCLLS 77 DS+L E+ P C + Sbjct: 109 DSTLQPTESSPADCSWT 125 >gi|319784334|ref|YP_004143810.1| hypothetical protein Mesci_4651 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317170222|gb|ADV13760.1| hypothetical protein Mesci_4651 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 81 Score = 141 bits (355), Expect = 4e-32, Method: Composition-based stats. Identities = 46/76 (60%), Positives = 56/76 (73%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M IPHFQND G+ I IGVK+FMC G +PP DHPHVF++MG++NEK CPYCSTLY + Sbjct: 1 MAGGSIPHFQNDAGYPAIDIGVKEFMCTGANPPFDHPHVFLDMGDDNEKVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L + ETLP GC+ Sbjct: 61 SPKLKATETLPAGCIY 76 >gi|49475733|ref|YP_033774.1| hypothetical protein BH09830 [Bartonella henselae str. Houston-1] gi|49238540|emb|CAF27776.1| hypothetical protein BH09830 [Bartonella henselae str. Houston-1] Length = 79 Score = 140 bits (353), Expect = 6e-32, Method: Composition-based stats. Identities = 46/77 (59%), Positives = 57/77 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D SL +T P GCL + Sbjct: 61 DPSLSYNQTNPTGCLYN 77 >gi|91977757|ref|YP_570416.1| hypothetical protein RPD_3291 [Rhodopseudomonas palustris BisB5] gi|91684213|gb|ABE40515.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5] Length = 81 Score = 140 bits (353), Expect = 6e-32, Method: Composition-based stats. Identities = 43/76 (56%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G I+IG K+FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVPMIEIGSKEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L S E P C+L Sbjct: 61 APDLKSGEARPPECVL 76 >gi|240850742|ref|YP_002972142.1| hypothetical protein Bgr_12110 [Bartonella grahamii as4aup] gi|240267865|gb|ACS51453.1| hypothetical protein Bgr_12110 [Bartonella grahamii as4aup] Length = 82 Score = 139 bits (352), Expect = 8e-32, Method: Composition-based stats. Identities = 47/77 (61%), Positives = 56/77 (72%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MGE +EK CPYCSTLY + Sbjct: 1 MADHNIPHFQNDLGYKTIEIGVKEFMCVGATQPFDHPHIFIDMGEADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 SL +T P GCL Sbjct: 61 VPSLSYNQTNPTGCLYH 77 >gi|153009872|ref|YP_001371087.1| hypothetical protein Oant_2545 [Ochrobactrum anthropi ATCC 49188] gi|151561760|gb|ABS15258.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188] Length = 84 Score = 139 bits (352), Expect = 8e-32, Method: Composition-based stats. Identities = 47/77 (61%), Positives = 61/77 (79%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHVF++MG+E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHAAIEIGVKEFMCVGANPPFDHPHVFLDMGDESEVVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETVPAGCVYE 77 >gi|260463335|ref|ZP_05811536.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] gi|259030925|gb|EEW32200.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 81 Score = 139 bits (352), Expect = 9e-32, Method: Composition-based stats. Identities = 47/76 (61%), Positives = 55/76 (72%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M IPHFQND G I IGVK+FMC G +PP DHPHVF++MG++NEK CPYCSTLY + Sbjct: 1 MAGGSIPHFQNDAGFPAIDIGVKEFMCTGANPPFDHPHVFLDMGDDNEKVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L + ETLP GCL Sbjct: 61 SPKLKATETLPAGCLY 76 >gi|222148877|ref|YP_002549834.1| hypothetical protein Avi_2547 [Agrobacterium vitis S4] gi|221735863|gb|ACM36826.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 81 Score = 139 bits (351), Expect = 1e-31, Method: Composition-based stats. Identities = 46/78 (58%), Positives = 58/78 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GH ++IGVK+FMC G S P DHPH+FI++G + EK CPYCSTLY + Sbjct: 1 MAGHSIPHFQNDGGHRLVEIGVKEFMCTGASVPFDHPHIFIDLGHDTEKVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 +SSL + ET P GC+ + Sbjct: 61 NSSLKATETNPAGCVFHV 78 >gi|163868510|ref|YP_001609719.1| hypothetical protein Btr_1362 [Bartonella tribocorum CIP 105476] gi|161018166|emb|CAK01724.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 82 Score = 139 bits (351), Expect = 1e-31, Method: Composition-based stats. Identities = 47/77 (61%), Positives = 56/77 (72%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADHNIPHFQNDLGYKTIEIGVKEFMCVGATQPFDHPHIFIDMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 SSL +T P GCL Sbjct: 61 VSSLSYDQTNPTGCLYH 77 >gi|39936495|ref|NP_948771.1| hypothetical protein RPA3432 [Rhodopseudomonas palustris CGA009] gi|192292286|ref|YP_001992891.1| hypothetical protein Rpal_3919 [Rhodopseudomonas palustris TIE-1] gi|39650351|emb|CAE28873.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009] gi|192286035|gb|ACF02416.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1] Length = 81 Score = 139 bits (351), Expect = 1e-31, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 54/76 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G + I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVATIEIGSREFMCVGAAPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 + L E P C+L Sbjct: 61 AADLKPGEARPPECVL 76 >gi|23501634|ref|NP_697761.1| hypothetical protein BR0747 [Brucella suis 1330] gi|62289700|ref|YP_221493.1| hypothetical protein BruAb1_0764 [Brucella abortus bv. 1 str. 9-941] gi|82699630|ref|YP_414204.1| hypothetical protein BAB1_0771 [Brucella melitensis biovar Abortus 2308] gi|148560602|ref|YP_001258728.1| hypothetical protein BOV_0741 [Brucella ovis ATCC 25840] gi|161618717|ref|YP_001592604.1| hypothetical protein BCAN_A0762 [Brucella canis ATCC 23365] gi|163843019|ref|YP_001627423.1| hypothetical protein BSUIS_A0782 [Brucella suis ATCC 23445] gi|189023950|ref|YP_001934718.1| hypothetical protein BAbS19_I07200 [Brucella abortus S19] gi|225627248|ref|ZP_03785285.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225852264|ref|YP_002732497.1| hypothetical protein BMEA_A0787 [Brucella melitensis ATCC 23457] gi|237815189|ref|ZP_04594187.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|254693495|ref|ZP_05155323.1| hypothetical protein Babob3T_02294 [Brucella abortus bv. 3 str. Tulya] gi|254697147|ref|ZP_05158975.1| hypothetical protein Babob28_05394 [Brucella abortus bv. 2 str. 86/8/59] gi|254701524|ref|ZP_05163352.1| hypothetical protein Bsuib55_11801 [Brucella suis bv. 5 str. 513] gi|254704073|ref|ZP_05165901.1| hypothetical protein Bsuib36_09109 [Brucella suis bv. 3 str. 686] gi|254707026|ref|ZP_05168854.1| hypothetical protein BpinM_08572 [Brucella pinnipedialis M163/99/10] gi|254709865|ref|ZP_05171676.1| hypothetical protein BpinB_06260 [Brucella pinnipedialis B2/94] gi|254713866|ref|ZP_05175677.1| hypothetical protein BcetM6_11039 [Brucella ceti M644/93/1] gi|254717077|ref|ZP_05178888.1| hypothetical protein BcetM_11763 [Brucella ceti M13/05/1] gi|254718866|ref|ZP_05180677.1| hypothetical protein Bru83_04890 [Brucella sp. 83/13] gi|254730043|ref|ZP_05188621.1| hypothetical protein Babob42_02309 [Brucella abortus bv. 4 str. 292] gi|256031357|ref|ZP_05444971.1| hypothetical protein BpinM2_12022 [Brucella pinnipedialis M292/94/1] gi|256060867|ref|ZP_05451027.1| hypothetical protein Bneo5_10962 [Brucella neotomae 5K33] gi|256113281|ref|ZP_05454149.1| hypothetical protein Bmelb3E_11232 [Brucella melitensis bv. 3 str. Ether] gi|256159479|ref|ZP_05457247.1| hypothetical protein BcetM4_10987 [Brucella ceti M490/95/1] gi|256254765|ref|ZP_05460301.1| hypothetical protein BcetB_10804 [Brucella ceti B1/94] gi|256264228|ref|ZP_05466760.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|256369180|ref|YP_003106688.1| hypothetical protein BMI_I745 [Brucella microti CCM 4915] gi|260168491|ref|ZP_05755302.1| hypothetical protein BruF5_09017 [Brucella sp. F5/99] gi|260545544|ref|ZP_05821285.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260566679|ref|ZP_05837149.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260757726|ref|ZP_05870074.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260761551|ref|ZP_05873894.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|261213753|ref|ZP_05928034.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|261218888|ref|ZP_05933169.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261221944|ref|ZP_05936225.1| conserved hypothetical protein [Brucella ceti B1/94] gi|261314494|ref|ZP_05953691.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261317406|ref|ZP_05956603.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261321613|ref|ZP_05960810.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261324864|ref|ZP_05964061.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261752072|ref|ZP_05995781.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261754731|ref|ZP_05998440.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|261757959|ref|ZP_06001668.1| conserved hypothetical protein [Brucella sp. F5/99] gi|265983851|ref|ZP_06096586.1| conserved hypothetical protein [Brucella sp. 83/13] gi|265988443|ref|ZP_06101000.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|265994693|ref|ZP_06107250.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|265997907|ref|ZP_06110464.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|294852111|ref|ZP_06792784.1| hypothetical protein BAZG_01027 [Brucella sp. NVSL 07-0026] gi|306837631|ref|ZP_07470501.1| cytoplasmic protein [Brucella sp. NF 2653] gi|306842004|ref|ZP_07474678.1| cytoplasmic protein [Brucella sp. BO2] gi|306843693|ref|ZP_07476293.1| cytoplasmic protein [Brucella sp. BO1] gi|23347552|gb|AAN29676.1| conserved hypothetical protein [Brucella suis 1330] gi|62195832|gb|AAX74132.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82615731|emb|CAJ10727.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] gi|148371859|gb|ABQ61838.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161335528|gb|ABX61833.1| Hypothetical protein BCAN_A0762 [Brucella canis ATCC 23365] gi|163673742|gb|ABY37853.1| Hypothetical protein BSUIS_A0782 [Brucella suis ATCC 23445] gi|189019522|gb|ACD72244.1| hypothetical protein BAbS19_I07200 [Brucella abortus S19] gi|225617253|gb|EEH14298.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225640629|gb|ACO00543.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] gi|237790026|gb|EEP64236.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|255999340|gb|ACU47739.1| hypothetical protein BMI_I745 [Brucella microti CCM 4915] gi|260096951|gb|EEW80826.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260156197|gb|EEW91277.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260668044|gb|EEX54984.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260671983|gb|EEX58804.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260915360|gb|EEX82221.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|260920528|gb|EEX87181.1| conserved hypothetical protein [Brucella ceti B1/94] gi|260923977|gb|EEX90545.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261294303|gb|EEX97799.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261296629|gb|EEY00126.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261300844|gb|EEY04341.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261303520|gb|EEY07017.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261737943|gb|EEY25939.1| conserved hypothetical protein [Brucella sp. F5/99] gi|261741825|gb|EEY29751.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261744484|gb|EEY32410.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|262552375|gb|EEZ08365.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|262765806|gb|EEZ11595.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|263094474|gb|EEZ18296.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|264660640|gb|EEZ30901.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|264662443|gb|EEZ32704.1| conserved hypothetical protein [Brucella sp. 83/13] gi|294820700|gb|EFG37699.1| hypothetical protein BAZG_01027 [Brucella sp. NVSL 07-0026] gi|306276003|gb|EFM57712.1| cytoplasmic protein [Brucella sp. BO1] gi|306287932|gb|EFM59349.1| cytoplasmic protein [Brucella sp. BO2] gi|306407280|gb|EFM63489.1| cytoplasmic protein [Brucella sp. NF 2653] gi|326408770|gb|ADZ65835.1| conserved hypothetical protein [Brucella melitensis M28] gi|326538488|gb|ADZ86703.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 84 Score = 139 bits (350), Expect = 1e-31, Method: Composition-based stats. Identities = 46/77 (59%), Positives = 61/77 (79%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHV+++MG+E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHNAIEIGVKEFMCVGANPPFDHPHVYLDMGDESEIVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETIPAGCVYE 77 >gi|316933306|ref|YP_004108288.1| hypothetical protein Rpdx1_1944 [Rhodopseudomonas palustris DX-1] gi|315601020|gb|ADU43555.1| hypothetical protein Rpdx1_1944 [Rhodopseudomonas palustris DX-1] Length = 81 Score = 139 bits (350), Expect = 2e-31, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G + I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVATIEIGSREFMCVGAAPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L E P C+L Sbjct: 61 APDLKPGEARPPECVL 76 >gi|254689012|ref|ZP_05152266.1| hypothetical protein Babob68_02286 [Brucella abortus bv. 6 str. 870] gi|256257262|ref|ZP_05462798.1| hypothetical protein Babob9C_07873 [Brucella abortus bv. 9 str. C68] gi|260754505|ref|ZP_05866853.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260883534|ref|ZP_05895148.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|297248107|ref|ZP_06931825.1| hypothetical protein BAYG_01045 [Brucella abortus bv. 5 str. B3196] gi|260674613|gb|EEX61434.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260873062|gb|EEX80131.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|297175276|gb|EFH34623.1| hypothetical protein BAYG_01045 [Brucella abortus bv. 5 str. B3196] Length = 84 Score = 139 bits (350), Expect = 2e-31, Method: Composition-based stats. Identities = 47/77 (61%), Positives = 61/77 (79%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHV+I+MG+E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHNAIEIGVKEFMCVGANPPFDHPHVYIDMGDESEIVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETIPAGCVYE 77 >gi|90424639|ref|YP_533009.1| hypothetical protein RPC_3148 [Rhodopseudomonas palustris BisB18] gi|90106653|gb|ABD88690.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18] Length = 81 Score = 138 bits (349), Expect = 2e-31, Method: Composition-based stats. Identities = 41/77 (53%), Positives = 52/77 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G I+IG K+FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFHNDAGVPIIEIGSKEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + L E P C+L Sbjct: 61 AADLAPGEARPPECVLQ 77 >gi|49474346|ref|YP_032388.1| hypothetical protein BQ07600 [Bartonella quintana str. Toulouse] gi|49239850|emb|CAF26244.1| hypothetical protein BQ07600 [Bartonella quintana str. Toulouse] Length = 79 Score = 138 bits (349), Expect = 2e-31, Method: Composition-based stats. Identities = 47/77 (61%), Positives = 57/77 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADHNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D SL +T P+GCL Sbjct: 61 DPSLPHDQTNPMGCLYQ 77 >gi|27380701|ref|NP_772230.1| hypothetical protein bsr5590 [Bradyrhizobium japonicum USDA 110] gi|27353866|dbj|BAC50855.1| bsr5590 [Bradyrhizobium japonicum USDA 110] Length = 81 Score = 138 bits (349), Expect = 2e-31, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY F Sbjct: 1 MSDHVVPHFHNDAGVPVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + E P C+L Sbjct: 61 AADLKAGEARPPECVL 76 >gi|17987489|ref|NP_540123.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M] gi|256044437|ref|ZP_05447341.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. Rev.1] gi|260563788|ref|ZP_05834274.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|265990857|ref|ZP_06103414.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|17983187|gb|AAL52387.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M] gi|260153804|gb|EEW88896.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|263001641|gb|EEZ14216.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] Length = 84 Score = 138 bits (349), Expect = 2e-31, Method: Composition-based stats. Identities = 47/77 (61%), Positives = 60/77 (77%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ IKIGVK+FMC G +PP DHPHV+++MG E+E CPYCSTLY + Sbjct: 1 MSDHIIPHFQNDAGHNAIKIGVKEFMCVGANPPFDHPHVYLDMGNESEIVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 ++ L + ET+P GC+ Sbjct: 61 NAKLHADETIPAGCVYE 77 >gi|319408649|emb|CBI82304.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 82 Score = 138 bits (348), Expect = 2e-31, Method: Composition-based stats. Identities = 45/78 (57%), Positives = 58/78 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH I HFQNDRG+ I+IGVK+FMC G + P DHPH+FI+MG ++EK CPYCSTLY + Sbjct: 1 MSDHNILHFQNDRGYKIIEIGVKEFMCVGATEPFDHPHIFIDMGADDEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + SL +T P GC+ + Sbjct: 61 NHSLSFNQTNPTGCIYHI 78 >gi|85715626|ref|ZP_01046606.1| hypothetical protein NB311A_18296 [Nitrobacter sp. Nb-311A] gi|85697565|gb|EAQ35442.1| hypothetical protein NB311A_18296 [Nitrobacter sp. Nb-311A] Length = 81 Score = 138 bits (348), Expect = 3e-31, Method: Composition-based stats. Identities = 39/76 (51%), Positives = 55/76 (72%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G + I+IG ++FMC G +PP DHPHVF+++G++NE CPYCSTLY F Sbjct: 1 MSDHIVPHFHNDSGVAVIEIGSREFMCVGANPPFDHPHVFLDLGDDNEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + + P C++ Sbjct: 61 AADLGAGQARPSECVV 76 >gi|254561394|ref|YP_003068489.1| hypothetical protein METDI2977 [Methylobacterium extorquens DM4] gi|254268672|emb|CAX24631.1| conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 88 Score = 138 bits (347), Expect = 3e-31, Method: Composition-based stats. Identities = 38/77 (49%), Positives = 47/77 (61%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G + I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVTVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L S P GC+ Sbjct: 61 DPKLKSGTAEPAGCVWH 77 >gi|218530435|ref|YP_002421251.1| hypothetical protein Mchl_2481 [Methylobacterium chloromethanicum CM4] gi|218522738|gb|ACK83323.1| conserved hypothetical protein [Methylobacterium chloromethanicum CM4] Length = 88 Score = 138 bits (347), Expect = 3e-31, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 46/77 (59%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G + I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVTVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L P GC+ Sbjct: 61 DPKLKPGTAEPAGCVWH 77 >gi|188581413|ref|YP_001924858.1| hypothetical protein Mpop_2161 [Methylobacterium populi BJ001] gi|179344911|gb|ACB80323.1| conserved hypothetical protein [Methylobacterium populi BJ001] Length = 84 Score = 138 bits (347), Expect = 3e-31, Method: Composition-based stats. Identities = 38/77 (49%), Positives = 46/77 (59%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G S I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVSVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L P GC+ Sbjct: 61 DPKLKPGTAEPAGCVWH 77 >gi|115524318|ref|YP_781229.1| hypothetical protein RPE_2308 [Rhodopseudomonas palustris BisA53] gi|115518265|gb|ABJ06249.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53] Length = 81 Score = 138 bits (347), Expect = 4e-31, Method: Composition-based stats. Identities = 40/76 (52%), Positives = 52/76 (68%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQND G I+IG ++FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNDAGVPIIEIGSREFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 + L P C+L Sbjct: 61 AADLAPGAARPPECVL 76 >gi|319898847|ref|YP_004158940.1| hypothetical protein BARCL_0681 [Bartonella clarridgeiae 73] gi|319402811|emb|CBI76362.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 82 Score = 137 bits (346), Expect = 4e-31, Method: Composition-based stats. Identities = 44/78 (56%), Positives = 55/78 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IP+FQND G+ I+IGVK+FMC G + P DHPH+FI MG +EK CPYCSTLY + Sbjct: 1 MADHNIPYFQNDNGYKIIEIGVKEFMCIGATEPFDHPHIFIEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + +L +T P GC L Sbjct: 61 NHTLSHDQTNPTGCTYHL 78 >gi|110633471|ref|YP_673679.1| hypothetical protein Meso_1118 [Mesorhizobium sp. BNC1] gi|110284455|gb|ABG62514.1| conserved hypothetical protein [Chelativorans sp. BNC1] Length = 81 Score = 137 bits (346), Expect = 4e-31, Method: Composition-based stats. Identities = 40/77 (51%), Positives = 55/77 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G+ I+IG K+FMC G PP DHPHVF++MG++NE+ CPYCSTLY + Sbjct: 1 MAGHATPHFHNTNGYPSIEIGAKEFMCVGAKPPFDHPHVFLDMGDDNERVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L +E++P CL + Sbjct: 61 NPALKGEESVPADCLYT 77 >gi|163851627|ref|YP_001639670.1| hypothetical protein Mext_2204 [Methylobacterium extorquens PA1] gi|240138794|ref|YP_002963267.1| hypothetical protein MexAM1_META1p2196 [Methylobacterium extorquens AM1] gi|163663232|gb|ABY30599.1| conserved hypothetical protein [Methylobacterium extorquens PA1] gi|240008764|gb|ACS39990.1| conserved hypothetical protein [Methylobacterium extorquens AM1] Length = 88 Score = 137 bits (346), Expect = 4e-31, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 46/77 (59%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G + I +G K+FMC G PP DHPHVF++MG E E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGVTVIAVGSKEFMCIGALPPFDHPHVFLDMGSETEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L P GC+ Sbjct: 61 DPKLKPGTAEPAGCVWH 77 >gi|170747021|ref|YP_001753281.1| hypothetical protein Mrad2831_0587 [Methylobacterium radiotolerans JCM 2831] gi|170653543|gb|ACB22598.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM 2831] Length = 85 Score = 137 bits (346), Expect = 4e-31, Method: Composition-based stats. Identities = 35/76 (46%), Positives = 48/76 (63%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +PHF N+ G I +GVK+FMC G PP DHPHVF++MG ++E C YCSTLY + Sbjct: 1 MAGKAVPHFHNEPGVPVITVGVKEFMCIGALPPFDHPHVFLDMGADSEIICQYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + + P C+ Sbjct: 61 RAGLKADQAEPQACVW 76 >gi|121602298|ref|YP_989157.1| hypothetical protein BARBAKC583_0870 [Bartonella bacilliformis KC583] gi|120614475|gb|ABM45076.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 82 Score = 137 bits (346), Expect = 4e-31, Method: Composition-based stats. Identities = 43/78 (55%), Positives = 54/78 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH I H QND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADHNILHLQNDCGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + SL +T P GC + Sbjct: 61 NPSLQHNQTNPAGCTYHV 78 >gi|86749253|ref|YP_485749.1| hypothetical protein RPB_2132 [Rhodopseudomonas palustris HaA2] gi|86572281|gb|ABD06838.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2] Length = 81 Score = 137 bits (346), Expect = 5e-31, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 52/76 (68%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQN+ G I+IG K+FMC G +PP DHPHVF+++G +NE CPYCSTLY + Sbjct: 1 MSDHVVPHFQNEAGVPMIEIGSKEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L E P C+L Sbjct: 61 APDLGPGEARPPECVL 76 >gi|23007575|ref|ZP_00049386.1| COG4391: Uncharacterized protein conserved in bacteria [Magnetospirillum magnetotacticum MS-1] Length = 86 Score = 137 bits (345), Expect = 5e-31, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 46/77 (59%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G I +G K+FMC G PP DHPHVF++MG + E C YCSTL+ + Sbjct: 1 MADKAVPHFHNQAGLRVIAVGSKEFMCIGALPPFDHPHVFLDMGGDTEIICQYCSTLFRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L S P CL + Sbjct: 61 DPKLKSGTAEPADCLWT 77 >gi|75676366|ref|YP_318787.1| hypothetical protein Nwi_2181 [Nitrobacter winogradskyi Nb-255] gi|74421236|gb|ABA05435.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] Length = 81 Score = 137 bits (345), Expect = 6e-31, Method: Composition-based stats. Identities = 39/76 (51%), Positives = 55/76 (72%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G + I+IG ++FMC G +PP DHPHVF+++G++ E CPYCSTLY F Sbjct: 1 MSDHVVPHFHNDSGVAVIEIGSREFMCVGANPPFDHPHVFLDLGDDGEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L ++ P GC++ Sbjct: 61 AADLGPGQSRPPGCVV 76 >gi|239831575|ref|ZP_04679904.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239823842|gb|EEQ95410.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 126 Score = 136 bits (344), Expect = 7e-31, Method: Composition-based stats. Identities = 47/77 (61%), Positives = 60/77 (77%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQND GH+ I+IGVK+FMC G +PP DHPHVF++MG+E+E CPYCSTLY + Sbjct: 43 MSDHIIPHFQNDAGHAAIEIGVKEFMCVGANPPFDHPHVFLDMGDESEAVCPYCSTLYRY 102 Query: 61 DSSLDSKETLPVGCLLS 77 ++ L + ET+P GC Sbjct: 103 NAELHADETVPAGCAYE 119 >gi|254504330|ref|ZP_05116481.1| hypothetical protein SADFL11_4369 [Labrenzia alexandrii DFL-11] gi|222440401|gb|EEE47080.1| hypothetical protein SADFL11_4369 [Labrenzia alexandrii DFL-11] Length = 99 Score = 136 bits (344), Expect = 8e-31, Method: Composition-based stats. Identities = 42/76 (55%), Positives = 50/76 (65%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHFQN GH I IG K+FMC G PP DHPHVF++MG E E CPYCSTLY + Sbjct: 19 MADQVVPHFQNTSGHDSIAIGAKEFMCIGAHPPFDHPHVFLDMGSEKEVVCPYCSTLYKY 78 Query: 61 DSSLDSKETLPVGCLL 76 D++L E+ P C Sbjct: 79 DATLAPNESSPSDCTW 94 >gi|148256546|ref|YP_001241131.1| hypothetical protein BBta_5236 [Bradyrhizobium sp. BTAi1] gi|146408719|gb|ABQ37225.1| hypothetical protein BBta_5236 [Bradyrhizobium sp. BTAi1] Length = 80 Score = 136 bits (344), Expect = 8e-31, Method: Composition-based stats. Identities = 38/76 (50%), Positives = 51/76 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ +PHF ND G I+IG ++FMC G +PP DHPHVF+++G + E CPYCSTLY + Sbjct: 1 MADNIVPHFHNDAGVPVIEIGSREFMCVGANPPFDHPHVFLDLGNDKEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L + E P C+L Sbjct: 61 APDLAAGEARPPECVL 76 >gi|163760310|ref|ZP_02167393.1| hypothetical protein HPDFL43_08609 [Hoeflea phototrophica DFL-43] gi|162282709|gb|EDQ32997.1| hypothetical protein HPDFL43_08609 [Hoeflea phototrophica DFL-43] Length = 81 Score = 136 bits (343), Expect = 9e-31, Method: Composition-based stats. Identities = 49/77 (63%), Positives = 58/77 (75%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND GHS I+IGVK+FMC G +PP DHPH F++MG E EK CPYCSTLY F Sbjct: 1 MAGHKIPHFQNDAGHSAIEIGVKEFMCVGANPPFDHPHEFLDMGAETEKVCPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L ET+P GC L+ Sbjct: 61 NPALAETETVPAGCTLT 77 >gi|220927244|ref|YP_002502546.1| hypothetical protein Mnod_7506 [Methylobacterium nodulans ORS 2060] gi|219951851|gb|ACL62243.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] Length = 85 Score = 136 bits (343), Expect = 1e-30, Method: Composition-based stats. Identities = 37/76 (48%), Positives = 45/76 (59%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G I +G K+FMC G PP DHPHVF++MG E+E C YCSTLY + Sbjct: 1 MADKAVPHFHNQDGVRVIHVGSKEFMCIGALPPFDHPHVFLDMGAESEIICQYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 S L P C+ Sbjct: 61 RSDLKPGTADPASCVW 76 >gi|319404157|emb|CBI77750.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 82 Score = 136 bits (343), Expect = 1e-30, Method: Composition-based stats. Identities = 42/78 (53%), Positives = 55/78 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IP+FQND G+ I+IGVK+FMC G + P DHPH+F+ MG +EK CPYCSTLY + Sbjct: 1 MADYNIPYFQNDNGYKTIEIGVKEFMCIGATQPFDHPHIFLEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + +L +T P GC L Sbjct: 61 NHTLPHNQTNPTGCTYHL 78 >gi|209884654|ref|YP_002288511.1| hypothetical protein OCAR_5515 [Oligotropha carboxidovorans OM5] gi|209872850|gb|ACI92646.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5] Length = 81 Score = 136 bits (342), Expect = 1e-30, Method: Composition-based stats. Identities = 39/77 (50%), Positives = 52/77 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF N G S I+IG ++FMC G +PP DHPHVF+++G ++E CPYCSTLY F Sbjct: 1 MADHIVPHFHNGPGVSVIEIGSREFMCIGANPPFDHPHVFLDLGNDDEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLS 77 L + E P C++ Sbjct: 61 APDLAAGEARPPQCVVE 77 >gi|319405610|emb|CBI79233.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 84 Score = 136 bits (342), Expect = 1e-30, Method: Composition-based stats. Identities = 42/77 (54%), Positives = 55/77 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IP+FQND G+ I+IGVK+FMC G + P DHPH+FI MG +EK CPYCSTLY + Sbjct: 1 MADYNIPYFQNDNGYKIIEIGVKEFMCIGATQPFDHPHIFIEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L +T P GC+ Sbjct: 61 NHTLAYNQTNPTGCIYH 77 >gi|319407176|emb|CBI80815.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 82 Score = 135 bits (340), Expect = 2e-30, Method: Composition-based stats. Identities = 42/78 (53%), Positives = 56/78 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IP+FQND G+ I+IGVK+FMC G + P DHPH+F+ MG +EK CPYCSTLY + Sbjct: 1 MADYNIPYFQNDNGYKTIEIGVKEFMCIGATQPFDHPHIFLEMGAADEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLSL 78 + +L +T P+GC L Sbjct: 61 NHTLPHNQTNPIGCTYHL 78 >gi|92118096|ref|YP_577825.1| hypothetical protein Nham_2583 [Nitrobacter hamburgensis X14] gi|91800990|gb|ABE63365.1| conserved hypothetical protein [Nitrobacter hamburgensis X14] Length = 81 Score = 135 bits (340), Expect = 2e-30, Method: Composition-based stats. Identities = 38/76 (50%), Positives = 53/76 (69%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF ND G + I+IG ++FMC G +PP DHPHVF+++G ++E CPYCSTLY F Sbjct: 1 MSDHVVPHFHNDAGVAVIEIGSQEFMCVGANPPFDHPHVFLDLGNDSEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLL 76 + L + P C++ Sbjct: 61 AADLGPGQARPPECVV 76 >gi|118593895|ref|ZP_01551253.1| Hypothetical Cytosolic Protein [Stappia aggregata IAM 12614] gi|118433516|gb|EAV40185.1| Hypothetical Cytosolic Protein [Stappia aggregata IAM 12614] Length = 81 Score = 134 bits (338), Expect = 4e-30, Method: Composition-based stats. Identities = 43/77 (55%), Positives = 54/77 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHFQN GH + IG ++FMC G +PP DHPHVF++MG ENE CPYCSTLY F Sbjct: 1 MADHVVPHFQNSSGHDSVAIGAREFMCIGANPPFDHPHVFLDMGSENEVVCPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCLLS 77 D +L + E+ P C + Sbjct: 61 DKTLQATESSPSDCTWA 77 >gi|328543244|ref|YP_004303353.1| Hypothetical Cytosolic Protein [Polymorphum gilvum SL003B-26A1] gi|326412990|gb|ADZ70053.1| Hypothetical Cytosolic Protein [Polymorphum gilvum SL003B-26A1] Length = 81 Score = 134 bits (337), Expect = 4e-30, Method: Composition-based stats. Identities = 40/77 (51%), Positives = 53/77 (68%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH IPHFQN GH I+IG ++FMC G +PP DHPHVF++MG++++ CPYCSTLY F Sbjct: 1 MADHVIPHFQNGSGHDCIEIGAREFMCIGANPPFDHPHVFLDMGDDDQIVCPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCLLS 77 + L ++ P C Sbjct: 61 NPKLKPTQSEPGDCAWH 77 >gi|158425168|ref|YP_001526460.1| hypothetical protein AZC_3544 [Azorhizobium caulinodans ORS 571] gi|158332057|dbj|BAF89542.1| hypothetical protein [Azorhizobium caulinodans ORS 571] Length = 82 Score = 134 bits (337), Expect = 5e-30, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 51/77 (66%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D IPHF ND G S I++G ++FMC G PP DHPH+FI++G + E C YCSTLY + Sbjct: 1 MADTGIPHFCNDLGVSVIEVGAREFMCIGAKPPFDHPHIFIDLGSDTEAVCSYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L + P GC+ + Sbjct: 61 NPALKAGTAKPEGCVWA 77 >gi|146339932|ref|YP_001204980.1| hypothetical protein BRADO2936 [Bradyrhizobium sp. ORS278] gi|146192738|emb|CAL76743.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 80 Score = 133 bits (334), Expect = 1e-29, Method: Composition-based stats. Identities = 38/76 (50%), Positives = 50/76 (65%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ +PHF ND G I+IG +FMC G +PP DHPHVF+++G + E CPYCSTLY + Sbjct: 1 MADNIVPHFHNDAGVPVIEIGSHEFMCVGANPPFDHPHVFLDLGNDKEIICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L + E P C+L Sbjct: 61 APDLSAGEARPPECVL 76 >gi|254470431|ref|ZP_05083835.1| conserved hypothetical protein [Pseudovibrio sp. JE062] gi|211960742|gb|EEA95938.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 87 Score = 133 bits (334), Expect = 1e-29, Method: Composition-based stats. Identities = 43/77 (55%), Positives = 54/77 (70%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G IKIG K+FMC G PPLDHPHVF++MG ++ CPYCSTLYH+ Sbjct: 7 MADKVVPHFHNSNGVEAIKIGAKEFMCIGAKPPLDHPHVFLDMGADDNAVCPYCSTLYHY 66 Query: 61 DSSLDSKETLPVGCLLS 77 D+SL S E+ P C+ + Sbjct: 67 DASLGSHESNPADCVWT 83 >gi|114706995|ref|ZP_01439894.1| hypothetical protein FP2506_03049 [Fulvimarina pelagi HTCC2506] gi|114537545|gb|EAU40670.1| hypothetical protein FP2506_03049 [Fulvimarina pelagi HTCC2506] Length = 78 Score = 133 bits (334), Expect = 1e-29, Method: Composition-based stats. Identities = 45/77 (58%), Positives = 55/77 (71%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H IPHFQND G+ I+IGV +FMC G +PP DHPHVF++MG+E EK C YCSTL+ + Sbjct: 1 MAGHQIPHFQNDAGYDVIEIGVTEFMCCGANPPHDHPHVFLDMGDEREKICAYCSTLFKY 60 Query: 61 DSSLDSKETLPVGCLLS 77 S L + ET P GCL Sbjct: 61 SSDLKATETRPAGCLFE 77 >gi|299135325|ref|ZP_07028516.1| Protein of unknown function DUF2327 [Afipia sp. 1NLS2] gi|298590302|gb|EFI50506.1| Protein of unknown function DUF2327 [Afipia sp. 1NLS2] Length = 81 Score = 132 bits (333), Expect = 1e-29, Method: Composition-based stats. Identities = 38/77 (49%), Positives = 51/77 (66%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M DH +PHF N +G S I+IG ++FMC G +PP DHPHVF+++G ++E CPYCSTLY F Sbjct: 1 MADHIVPHFHNGQGVSVIEIGSREFMCIGANPPFDHPHVFLDLGNDDEIICPYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLS 77 L P C++ Sbjct: 61 AGDLAPGAARPPQCVVE 77 >gi|170744783|ref|YP_001773438.1| hypothetical protein M446_6759 [Methylobacterium sp. 4-46] gi|168199057|gb|ACA21004.1| conserved hypothetical protein [Methylobacterium sp. 4-46] Length = 85 Score = 131 bits (331), Expect = 3e-29, Method: Composition-based stats. Identities = 35/76 (46%), Positives = 43/76 (56%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D +PHF N G I +G K+FMC G PP DHPHVF++MG E+E C YCSTLY + Sbjct: 1 MADKAVPHFHNQDGARVIHVGSKEFMCIGALPPFDHPHVFLDMGAESEIICQYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLL 76 L P + Sbjct: 61 RGDLKPGTADPASAVW 76 >gi|304391884|ref|ZP_07373826.1| putative cytoplasmic protein [Ahrensia sp. R2A130] gi|303296113|gb|EFL90471.1| putative cytoplasmic protein [Ahrensia sp. R2A130] Length = 81 Score = 131 bits (329), Expect = 4e-29, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 56/76 (73%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +PHF ND G IKIGV++FMC G + P DHPHV+++MG+++EK CPYCSTL+ F Sbjct: 1 MAKAIVPHFHNDGGVPTIKIGVREFMCIGATAPYDHPHVYLDMGDDDEKVCPYCSTLFRF 60 Query: 61 DSSLDSKETLPVGCLL 76 D+SL + E+ P CL+ Sbjct: 61 DASLAANESDPANCLM 76 >gi|154247160|ref|YP_001418118.1| hypothetical protein Xaut_3232 [Xanthobacter autotrophicus Py2] gi|154161245|gb|ABS68461.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2] Length = 85 Score = 129 bits (325), Expect = 1e-28, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 49/77 (63%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D IPHF ND G + I++G K+FMC G PP DHPH+FI++G + E CPYCSTLY + Sbjct: 1 MADTGIPHFCNDLGVTLIEVGSKEFMCVGAKPPFDHPHIFIDLGGDTEAVCPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 + +L + P C Sbjct: 61 NPALAAGAAKPEECEWH 77 >gi|298292007|ref|YP_003693946.1| hypothetical protein Snov_2029 [Starkeya novella DSM 506] gi|296928518|gb|ADH89327.1| Protein of unknown function DUF2327 [Starkeya novella DSM 506] Length = 82 Score = 128 bits (322), Expect = 3e-28, Method: Composition-based stats. Identities = 42/77 (54%), Positives = 49/77 (63%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H +PHF N G I IG K+FMC G PP DHPHVF++MG ++E CPYCSTLY F Sbjct: 1 MAGHVVPHFHNSAGVPSISIGAKEFMCVGALPPYDHPHVFLDMGSDDEIICPYCSTLYKF 60 Query: 61 DSSLDSKETLPVGCLLS 77 DS L E+ P G L Sbjct: 61 DSYLHGTESTPPGALYE 77 >gi|315122671|ref|YP_004063160.1| hypothetical protein CKC_04615 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496073|gb|ADR52672.1| hypothetical protein CKC_04615 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 78 Score = 127 bits (320), Expect = 5e-28, Method: Composition-based stats. Identities = 61/78 (78%), Positives = 69/78 (88%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +H I HFQND+GHS IKIGVK+FMCAG SPPLDHPHVFINMG +N+K+CPYCSTLYHF Sbjct: 1 MANHRILHFQNDKGHSSIKIGVKEFMCAGASPPLDHPHVFINMGSDNKKYCPYCSTLYHF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 D+SLDS+ETLP GC L L Sbjct: 61 DASLDSEETLPSGCFLPL 78 >gi|254780167|ref|YP_003064580.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] gi|254039844|gb|ACT56640.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 127 bits (319), Expect = 5e-28, Method: Composition-based stats. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF Sbjct: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 DSSLDSKETLPVGCLLSL Sbjct: 61 DSSLDSKETLPVGCLLSL 78 >gi|312114674|ref|YP_004012270.1| hypothetical protein Rvan_1935 [Rhodomicrobium vannielii ATCC 17100] gi|311219803|gb|ADP71171.1| hypothetical protein Rvan_1935 [Rhodomicrobium vannielii ATCC 17100] Length = 84 Score = 124 bits (311), Expect = 5e-27, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 52/77 (67%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +PHF ND G +I IGVK+F C G PP+DHPHV+++MG +++ CPYCSTL+ + Sbjct: 1 MAKIGVPHFHNDIGVEKIHIGVKEFQCVGARPPVDHPHVYLDMGADDQIVCPYCSTLFIY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D++L +T P CL Sbjct: 61 DANLRPDQTDPPYCLFE 77 >gi|83308648|emb|CAJ01556.1| conserved hypothetical protein, similar to Bradyrhizobium japonicum bsr5599 [uncultured bacterium] Length = 197 Score = 124 bits (311), Expect = 5e-27, Method: Composition-based stats. Identities = 36/77 (46%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G ++++G K+FMC G PP DHPH+FI+MG+ N+ CPYCST Y + Sbjct: 106 MATHSTPHFHNQPGVLQVRVGAKEFMCVGALPPFDHPHIFIDMGDSNDAICPYCSTHYVY 165 Query: 61 DSSLDSKETLPVGCLLS 77 D+ LD P C Sbjct: 166 DARLDGG-CEPPECAFE 181 >gi|300021599|ref|YP_003754210.1| hypothetical protein Hden_0062 [Hyphomicrobium denitrificans ATCC 51888] gi|299523420|gb|ADJ21889.1| Protein of unknown function DUF2327 [Hyphomicrobium denitrificans ATCC 51888] Length = 80 Score = 123 bits (308), Expect = 1e-26, Method: Composition-based stats. Identities = 38/77 (49%), Positives = 51/77 (66%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M IPHF ND G RI +GVK+F C G P DHPH++++MG++N+ CPYCSTLY + Sbjct: 1 MAGALIPHFANDVGAERIFVGVKEFNCMGARAPFDHPHIYLDMGQDNQILCPYCSTLYIY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D L + E+ P L+S Sbjct: 61 DPRLKADESDPKNSLVS 77 >gi|154253046|ref|YP_001413870.1| hypothetical protein Plav_2605 [Parvibaculum lavamentivorans DS-1] gi|154156996|gb|ABS64213.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1] Length = 87 Score = 121 bits (305), Expect = 3e-26, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 44/77 (57%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M P F N G I+ GVK+F C G PP DHPHVF++MG ENE C YCSTLY F Sbjct: 1 MSGGATPKFSNQAGVREIRTGVKEFECIGALPPFDHPHVFLDMGRENEIVCGYCSTLYRF 60 Query: 61 DSSLDSKETLPVGCLLS 77 D +L + +LP Sbjct: 61 DPALSADASLPPEARYH 77 >gi|296448470|ref|ZP_06890352.1| Protein of unknown function DUF2327 [Methylosinus trichosporium OB3b] gi|296254022|gb|EFH01167.1| Protein of unknown function DUF2327 [Methylosinus trichosporium OB3b] Length = 86 Score = 121 bits (303), Expect = 4e-26, Method: Composition-based stats. Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M PHF N G ++I++G K+FMC G PP DHPHVFI+MG +E CPYCSTLY + Sbjct: 1 MAHGSTPHFHNQPGVAKIRVGAKEFMCIGALPPFDHPHVFIDMGAADEAVCPYCSTLYVY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D SL P C+ Sbjct: 61 DESLHGG-ADPAECVYQ 76 >gi|323136590|ref|ZP_08071671.1| hypothetical protein Met49242DRAFT_1058 [Methylocystis sp. ATCC 49242] gi|322397907|gb|EFY00428.1| hypothetical protein Met49242DRAFT_1058 [Methylocystis sp. ATCC 49242] Length = 82 Score = 121 bits (303), Expect = 4e-26, Method: Composition-based stats. Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M +H PHF N G ++I++G K+FMC G PP DHPHV+++MG +++ CPYCSTL+ + Sbjct: 1 MAEHSTPHFHNTPGVAQIRVGAKEFMCIGALPPFDHPHVYLDMGADSQAVCPYCSTLFVY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D+SL P C+ Sbjct: 61 DASLHGG-ADPAECVYH 76 >gi|217977167|ref|YP_002361314.1| hypothetical protein Msil_0983 [Methylocella silvestris BL2] gi|217502543|gb|ACK49952.1| conserved hypothetical protein [Methylocella silvestris BL2] Length = 84 Score = 117 bits (294), Expect = 5e-25, Method: Composition-based stats. Identities = 37/76 (48%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G R+++ ++FMC G PP DHPH+FI+MG+ +E CPYCSTLY F Sbjct: 1 MAAHATPHFHNQPGVPRVRVSAREFMCVGALPPFDHPHIFIDMGDADEAICPYCSTLYVF 60 Query: 61 DSSLDSKETLPVGCLL 76 D+SL P C+ Sbjct: 61 DASLR-GPCEPPECVF 75 >gi|182677916|ref|YP_001832062.1| hypothetical protein Bind_0924 [Beijerinckia indica subsp. indica ATCC 9039] gi|182633799|gb|ACB94573.1| conserved hypothetical protein [Beijerinckia indica subsp. indica ATCC 9039] Length = 86 Score = 117 bits (293), Expect = 5e-25, Method: Composition-based stats. Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M H PHF N G +++G K+FMC G PP DHPH+FI+MG++NE CPYCST Y + Sbjct: 1 MASHSTPHFHNQPGVETVRVGAKEFMCVGALPPCDHPHIFIDMGDDNEAICPYCSTHYVY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D+SL P C Sbjct: 61 DASLHGG-CEPPECRFE 76 >gi|144899390|emb|CAM76254.1| protein conserved in bacteria [Magnetospirillum gryphiswaldense MSR-1] Length = 72 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 22/44 (50%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYH 59 I + C G + L HP V++NMG + + CPYCS Y Sbjct: 18 ETIVVETNHVACDGGNAGLGHPRVYLNMGHDRQVVCPYCSRTYV 61 >gi|67459780|ref|YP_247404.1| hypothetical protein RF_1388 [Rickettsia felis URRWXCal2] gi|67005313|gb|AAY62239.1| unknown [Rickettsia felis URRWXCal2] Length = 50 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C G PP DHP V++ + +E E CPYCS + Sbjct: 13 CQGKEPPYDHPKVYLEIDKEKKEIVCPYCSKKFK 46 >gi|239946681|ref|ZP_04698434.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes scapularis] gi|239920957|gb|EER20981.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes scapularis] Length = 54 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C G PP DHP V++ + +E E CPYCS + Sbjct: 17 CQGKEPPYDHPKVYLEIDKEKKEVICPYCSKKFK 50 >gi|15893285|ref|NP_360999.1| hypothetical protein RC1362 [Rickettsia conorii str. Malish 7] gi|229587255|ref|YP_002845756.1| hypothetical protein RAF_ORF1248 [Rickettsia africae ESF-5] gi|15620506|gb|AAL03900.1| unknown [Rickettsia conorii str. Malish 7] gi|228022305|gb|ACP54013.1| Unknown [Rickettsia africae ESF-5] Length = 54 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMG-EENEKHCPYCSTLYH 59 C G PP DHP V++ + ++ E CPYCS + Sbjct: 17 CQGKEPPYDHPKVYLEIDKKKKEVICPYCSKKFK 50 >gi|157826373|ref|YP_001494093.1| hypothetical protein A1C_06810 [Rickettsia akari str. Hartford] gi|157800331|gb|ABV75585.1| hypothetical protein A1C_06810 [Rickettsia akari str. Hartford] Length = 50 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C G PP DHP +++ + +E E CPYCS + Sbjct: 13 CHGKEPPYDHPKIYLEIDKEKKEVICPYCSKKFK 46 >gi|319944569|ref|ZP_08018838.1| hypothetical protein HMPREF0551_1686 [Lautropia mirabilis ATCC 51599] gi|319742165|gb|EFV94583.1| hypothetical protein HMPREF0551_1686 [Lautropia mirabilis ATCC 51599] Length = 67 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLD 65 HP V++++ E + CPYCSTLY + Sbjct: 33 HPRVYLDVTHEGQARCPYCSTLYRLKPGVK 62 >gi|326403698|ref|YP_004283780.1| hypothetical protein ACMV_15510 [Acidiphilium multivorum AIU301] gi|325050560|dbj|BAJ80898.1| hypothetical protein ACMV_15510 [Acidiphilium multivorum AIU301] Length = 75 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 I++ + C G PL HP V++ + E+ E CPYCS Y ++ E Sbjct: 22 EMIQVRERTVACDGGGGPLGHPRVYLKI-EDREVTCPYCSRHYVLTGNVTPGE 73 >gi|157965004|ref|YP_001499828.1| hypothetical protein RMA_1344 [Rickettsia massiliae MTU5] gi|157844780|gb|ABV85281.1| hypothetical protein RMA_1344 [Rickettsia massiliae MTU5] Length = 60 Score = 41.4 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C G P DHP V++ + +E E CPYCS + Sbjct: 23 CQGKEPLYDHPKVYLEIDKEKKEVICPYCSKKFK 56 >gi|113866588|ref|YP_725077.1| hypothetical protein H16_A0560 [Ralstonia eutropha H16] gi|188591302|ref|YP_001795902.1| hypothetical protein RALTA_A0515 [Cupriavidus taiwanensis LMG 19424] gi|113525364|emb|CAJ91709.1| conserved hypothetical protein [Ralstonia eutropha H16] gi|170938196|emb|CAP63182.1| conserved hypothetical protein [Cupriavidus taiwanensis LMG 19424] Length = 64 Score = 41.4 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 17 RIKIGVKK--FMCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I+IG + C + P HP VF+++ + E CPYC T+Y Sbjct: 7 IIEIGAEDIPLHCPTANTPAWNYHPRVFLDVADTGEAKCPYCGTVYKLKP 56 >gi|326315140|ref|YP_004232812.1| hypothetical protein Acav_0322 [Acidovorax avenae subsp. avenae ATCC 19860] gi|323371976|gb|ADX44245.1| hypothetical protein Acav_0322 [Acidovorax avenae subsp. avenae ATCC 19860] Length = 68 Score = 41.0 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVG 73 HP V++++ E CPYC T+Y L + ET+ G Sbjct: 34 HPKVYLDVAHTGEAKCPYCGTVYR----LKAGETVRAG 67 >gi|187927587|ref|YP_001898074.1| hypothetical protein Rpic_0487 [Ralstonia pickettii 12J] gi|187724477|gb|ACD25642.1| conserved hypothetical protein [Ralstonia pickettii 12J] Length = 65 Score = 41.0 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I+IG C P HP VF+++ + E CPYC T+Y Sbjct: 7 PTIEIGADDLPLHCPTAKTPAWNYHPRVFLDIADTGEAKCPYCGTVYKLAP 57 >gi|94309437|ref|YP_582647.1| hypothetical protein Rmet_0492 [Cupriavidus metallidurans CH34] gi|93353289|gb|ABF07378.1| conserved hypothetical protein [Cupriavidus metallidurans CH34] Length = 64 Score = 41.0 bits (95), Expect = 0.056, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKK--FMCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 S ++IG + C + P HP VF+++ + E CPYC T+Y Sbjct: 6 SVVEIGAEDMPLHCPTANTPAWNYHPRVFLDVADTGEVRCPYCGTVYKLKP 56 >gi|148260505|ref|YP_001234632.1| hypothetical protein Acry_1505 [Acidiphilium cryptum JF-5] gi|146402186|gb|ABQ30713.1| hypothetical protein Acry_1505 [Acidiphilium cryptum JF-5] Length = 75 Score = 40.6 bits (94), Expect = 0.065, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 I++ + C G PL HP V++ + E+ E CPYCS Y + E Sbjct: 22 EMIQVRERTVACDGGGGPLGHPRVYLKI-EDREVTCPYCSRHYVLTGNATPGE 73 >gi|296116916|ref|ZP_06835518.1| hypothetical protein GXY_13953 [Gluconacetobacter hansenii ATCC 23769] gi|295976482|gb|EFG83258.1| hypothetical protein GXY_13953 [Gluconacetobacter hansenii ATCC 23769] Length = 71 Score = 40.6 bits (94), Expect = 0.066, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 I + + C G L HP VF+ + +++ CPYCS L+ + + Sbjct: 17 IETIVVDSRILSCDGGLGALGHPRVFLRI-ADHQTFCPYCSRLFVLNPEATPGDA 70 >gi|99034961|ref|ZP_01314765.1| hypothetical protein Wendoof_01000407 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] gi|225629851|ref|ZP_03787762.1| hypothetical protein WUni_002050 [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225630151|ref|YP_002726942.1| hypothetical protein WRi_003400 [Wolbachia sp. wRi] gi|225591295|gb|EEH12424.1| hypothetical protein WUni_002050 [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225592132|gb|ACN95151.1| hypothetical protein WRi_003400 [Wolbachia sp. wRi] Length = 63 Score = 40.6 bits (94), Expect = 0.068, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 21/31 (67%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 HP ++++MGEE E CPYC + D ++++ Sbjct: 24 HPLIYLDMGEEEEIACPYCEKTFVHDCTVEA 54 >gi|91206201|ref|YP_538556.1| hypothetical protein RBE_1386 [Rickettsia bellii RML369-C] gi|157827811|ref|YP_001496875.1| hypothetical protein A1I_07700 [Rickettsia bellii OSU 85-389] gi|91069745|gb|ABE05467.1| unknown [Rickettsia bellii RML369-C] gi|157803115|gb|ABV79838.1| hypothetical protein A1I_07700 [Rickettsia bellii OSU 85-389] Length = 63 Score = 40.6 bits (94), Expect = 0.070, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C G PP DHP V++ + +E E C YCS + Sbjct: 25 CCGKEPPYDHPRVYLEIDKEKKEVSCLYCSKKFR 58 >gi|58585059|ref|YP_198632.1| NADH:ubiquinone oxidoreductase Fe-S subunit [Wolbachia endosymbiont strain TRS of Brugia malayi] gi|58419375|gb|AAW71390.1| NADH:ubiquinone oxidoreductase Fe-S subunit [Wolbachia endosymbiont strain TRS of Brugia malayi] Length = 65 Score = 40.6 bits (94), Expect = 0.080, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 21/31 (67%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 HP ++++MGEE E CPYC + D ++++ Sbjct: 24 HPLIYLDMGEEEEIACPYCEKTFVHDCTVEA 54 >gi|34581049|ref|ZP_00142529.1| hypothetical protein [Rickettsia sibirica 246] gi|28262434|gb|EAA25938.1| unknown [Rickettsia sibirica 246] Length = 54 Score = 40.6 bits (94), Expect = 0.082, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMG-EENEKHCPYCSTLYH 59 C G P DHP V++ + ++ E CPYCS + Sbjct: 17 CQGKELPYDHPKVYLEIDKKKKEVICPYCSKKFK 50 >gi|241662092|ref|YP_002980452.1| hypothetical protein Rpic12D_0474 [Ralstonia pickettii 12D] gi|309780634|ref|ZP_07675376.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] gi|240864119|gb|ACS61780.1| conserved hypothetical protein [Ralstonia pickettii 12D] gi|308920557|gb|EFP66212.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] Length = 65 Score = 40.2 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 17 RIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I+IG C P HP VF+++ + E CPYC T+Y Sbjct: 8 SIEIGADDLPLHCPTAKTPAWNYHPRVFLDIADTGEAKCPYCGTVYKLAP 57 >gi|51474048|ref|YP_067805.1| hypothetical protein RT0872 [Rickettsia typhi str. Wilmington] gi|51460360|gb|AAU04323.1| rickettsial conserved hypothetical protein [Rickettsia typhi str. Wilmington] Length = 50 Score = 40.2 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C GT P HP V++ + +E NE CPYCS + Sbjct: 13 CYGTEPLYGHPKVYLEIDKEKNEIICPYCSKKFK 46 >gi|83313311|ref|YP_423575.1| hypothetical protein amb4212 [Magnetospirillum magneticum AMB-1] gi|82948152|dbj|BAE53016.1| Uncharacterized protein conserved in bacteria [Magnetospirillum magneticum AMB-1] Length = 65 Score = 40.2 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Query: 12 DRGHSRIKIGVKKFMCAGTSPP-LDHPHVFINMGEENEKHCPYCSTLYH 59 + + K C G L HP VF+++ E + CPYCS Y Sbjct: 7 QPAFDTVTVSAAKVACDGDVANGLGHPRVFLDLTAEGKIVCPYCSRTYV 55 >gi|300692417|ref|YP_003753412.1| hypothetical protein RPSI07_2787 [Ralstonia solanacearum PSI07] gi|299079477|emb|CBJ52152.1| conserved protein of unknown function [Ralstonia solanacearum PSI07] Length = 65 Score = 40.2 bits (93), Expect = 0.096, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I+IG C ++ P HP VF+++ + E CPYC T+Y Sbjct: 7 PIIEIGADDLPLHCPTSNTPAWNYHPRVFLDIADTGEAKCPYCGTVYKLAP 57 >gi|239813274|ref|YP_002942184.1| hypothetical protein Vapar_0255 [Variovorax paradoxus S110] gi|239799851|gb|ACS16918.1| conserved hypothetical protein [Variovorax paradoxus S110] Length = 69 Score = 40.2 bits (93), Expect = 0.096, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 HP V++++ E CPYC T+Y L + ET Sbjct: 35 HPKVYLDVARTGEAKCPYCGTVYR----LKAGET 64 >gi|160895766|ref|YP_001561348.1| hypothetical protein Daci_0317 [Delftia acidovorans SPH-1] gi|160361350|gb|ABX32963.1| conserved hypothetical protein [Delftia acidovorans SPH-1] Length = 69 Score = 40.2 bits (93), Expect = 0.098, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP V++++ E CPYC TLY L + E Sbjct: 35 HPKVYLDVAHTGEAKCPYCGTLYR----LKAGE 63 >gi|319790953|ref|YP_004152593.1| zinc finger, chcc-type [Variovorax paradoxus EPS] gi|315593416|gb|ADU34482.1| Zinc finger, CHCC-type [Variovorax paradoxus EPS] Length = 69 Score = 40.2 bits (93), Expect = 0.100, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPV 72 HP V++++ E CPYC T+Y L + E + Sbjct: 35 HPKVYLDVARTGEAKCPYCGTVYR----LKAGEAVSA 67 >gi|299067870|emb|CBJ39081.1| conserved protein of unknown function [Ralstonia solanacearum CMR15] Length = 65 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I+IG C ++ P HP VF+++ + E CPYC T+Y Sbjct: 7 PIIEIGADDLPLHCPTSNTPAWNYHPRVFLDVADTGEAKCPYCGTVYKLAP 57 >gi|83746082|ref|ZP_00943137.1| Hypothetical protein RRSL_04111 [Ralstonia solanacearum UW551] gi|207728026|ref|YP_002256420.1| hypothetical protein RSMK04357 [Ralstonia solanacearum MolK2] gi|207742422|ref|YP_002258814.1| hypothetical protein RSIPO_00610 [Ralstonia solanacearum IPO1609] gi|300705071|ref|YP_003746674.1| hypothetical protein RCFBP_20908 [Ralstonia solanacearum CFBP2957] gi|83727265|gb|EAP74388.1| Hypothetical protein RRSL_04111 [Ralstonia solanacearum UW551] gi|206591270|emb|CAQ56882.1| conserved hypothetical protein [Ralstonia solanacearum MolK2] gi|206593812|emb|CAQ60739.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609] gi|299072735|emb|CBJ44088.1| conserved protein of unknown function [Ralstonia solanacearum CFBP2957] Length = 65 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I+IG C + P HP VF+++ + E CPYC T+Y Sbjct: 7 PIIEIGADDLPLHCPTSKTPAWNYHPRVFLDIADTGEVRCPYCGTVYKLAP 57 >gi|330991542|ref|ZP_08315493.1| hypothetical protein SXCC_01449 [Gluconacetobacter sp. SXCC-1] gi|329761561|gb|EGG78054.1| hypothetical protein SXCC_01449 [Gluconacetobacter sp. SXCC-1] Length = 71 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 I + + C G L HP VF+ +G ++ CPYCS L+ + + Sbjct: 17 IETIVVDSRTLSCDGGLGALGHPRVFLRIGH-HQTFCPYCSRLFVLNPDAPAG 68 >gi|257094505|ref|YP_003168146.1| hypothetical protein CAP2UW1_2939 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257047029|gb|ACV36217.1| conserved hypothetical protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 65 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 16/32 (50%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ E CPYCS Y F L Sbjct: 32 HPRVFLDVTHSGEVVCPYCSAHYVFKGELPKG 63 >gi|17545285|ref|NP_518687.1| hypothetical protein RSc0566 [Ralstonia solanacearum GMI1000] gi|17427577|emb|CAD14096.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000] Length = 65 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I+IG C + P HP VF+++ + E CPYC T+Y Sbjct: 7 PIIEIGADDLPLHCPTSKTPAWNYHPRVFLDVADTGEAKCPYCGTVYKLAP 57 >gi|120608968|ref|YP_968646.1| hypothetical protein Aave_0265 [Acidovorax citrulli AAC00-1] gi|120587432|gb|ABM30872.1| conserved hypothetical protein [Acidovorax citrulli AAC00-1] Length = 68 Score = 39.1 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVG 73 HP V++++ E CPYC T+Y L + E + G Sbjct: 34 HPKVYLDVAHTGEAKCPYCGTVYR----LKAGEVVRAG 67 >gi|73540252|ref|YP_294772.1| hypothetical protein Reut_A0546 [Ralstonia eutropha JMP134] gi|72117665|gb|AAZ59928.1| conserved hypothetical protein [Ralstonia eutropha JMP134] Length = 64 Score = 39.1 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 17 RIKIGVKK--FMCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 ++IG + C + P HP VF+++ + E CPYC T+Y Sbjct: 7 TVEIGAEDIPLHCPTANTPAWNYHPRVFLDVVDTGEAKCPYCGTVYKLKP 56 >gi|157804274|ref|YP_001492823.1| hypothetical protein A1E_05635 [Rickettsia canadensis str. McKiel] gi|157785537|gb|ABV74038.1| hypothetical protein A1E_05635 [Rickettsia canadensis str. McKiel] Length = 54 Score = 39.1 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C G P DHP V++ + +E E CPYCS + Sbjct: 17 CCGKEPLYDHPKVYLEIDKEKKEVTCPYCSKKFK 50 >gi|294084836|ref|YP_003551596.1| hypothetical protein SAR116_1269 [Candidatus Puniceispirillum marinum IMCC1322] gi|292664411|gb|ADE39512.1| hypothetical protein SAR116_1269 [Candidatus Puniceispirillum marinum IMCC1322] Length = 66 Score = 39.1 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYH 59 C G L HP V++ +G +++ CPYCS + Sbjct: 27 CNGGGGALGHPLVWLTLGTDDKVVCPYCSRTFV 59 >gi|23015748|ref|ZP_00055516.1| COG4391: Uncharacterized protein conserved in bacteria [Magnetospirillum magnetotacticum MS-1] Length = 82 Score = 39.1 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Query: 12 DRGHSRIKIGVKKFMCAGTSPP-LDHPHVFINMGEENEKHCPYCSTLYH 59 + + C G L HP VF+++ E + CPYCS Y Sbjct: 24 QPAFDTVTVSAASVACDGDVANGLGHPRVFLDLTAEGKIVCPYCSRTYV 72 >gi|290562193|gb|ADD38493.1| NADH dehydrogenase iron-sulfur protein 6, mitochondrial [Lepeophtheirus salmonis] Length = 126 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 22/49 (44%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS 63 I++ + C G PL HP VFIN+ + C YC Y SS Sbjct: 77 VPPIEVTERIVACDGGDGPLGHPRVFINLDDGEPSACIYCQLRYVLKSS 125 >gi|217969629|ref|YP_002354863.1| hypothetical protein Tmz1t_1208 [Thauera sp. MZ1T] gi|217506956|gb|ACK53967.1| conserved hypothetical protein [Thauera sp. MZ1T] Length = 66 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 17/26 (65%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFD 61 HP VF+++ + E CPYCS Y F+ Sbjct: 33 HPRVFLDILKTGEAVCPYCSAHYVFN 58 >gi|33598069|ref|NP_885712.1| hypothetical protein BPP3552 [Bordetella parapertussis 12822] gi|33566627|emb|CAE38836.1| conserved hypothetical protein [Bordetella parapertussis] Length = 70 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Query: 15 HSRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 H I++G + CAG PL HP VF+++ + CPYC Y Sbjct: 12 HDAIEVGAEDLPVYCAGPKAPLWSMHPRVFLDVTHTGQASCPYCGAAYRLKP 63 >gi|114328628|ref|YP_745785.1| putative cytoplasmic protein [Granulibacter bethesdensis CGDNIH1] gi|114316802|gb|ABI62862.1| hypothetical cytosolic protein [Granulibacter bethesdensis CGDNIH1] Length = 85 Score = 39.1 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 11 NDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 N I + C G + PL HP V++ + + CPYCS LY + + Sbjct: 27 NAPASETILVDSHVVSCDGGNAPLGHPRVWLRIAGQR-VMCPYCSRLYVLTADAPA 81 >gi|121592618|ref|YP_984514.1| hypothetical protein Ajs_0183 [Acidovorax sp. JS42] gi|120604698|gb|ABM40438.1| conserved hypothetical protein [Acidovorax sp. JS42] Length = 68 Score = 38.7 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVG 73 HP V++++ E CPYC T+Y L + E + G Sbjct: 34 HPKVYLDVAHTGEAKCPYCGTVYR----LKAGEVVHSG 67 >gi|292572545|gb|ADE30460.1| hypothetical protein rpr22_CDS859 [Rickettsia prowazekii Rp22] Length = 50 Score = 38.7 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 27 CAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 C G P HP V++ + +E NE CPYCS + Sbjct: 13 CHGKEPLYGHPKVYLEIDKEKNEIICPYCSKKFK 46 >gi|241765556|ref|ZP_04763516.1| conserved hypothetical protein [Acidovorax delafieldii 2AN] gi|241364645|gb|EER59683.1| conserved hypothetical protein [Acidovorax delafieldii 2AN] Length = 68 Score = 38.7 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP V++++ E CPYC T+Y L + E Sbjct: 34 HPKVYLDVAHAGEAKCPYCGTVYR----LKAGE 62 >gi|260219792|emb|CBA26679.1| hypothetical protein Csp_H39800 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 68 Score = 38.3 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP V++++G E CPYC T+Y Sbjct: 34 HPKVYLDVGRAGEAKCPYCGTVYK 57 >gi|319761030|ref|YP_004124967.1| zinc finger, chcc-type [Alicycliphilus denitrificans BC] gi|330822888|ref|YP_004386191.1| hypothetical protein Alide2_0245 [Alicycliphilus denitrificans K601] gi|317115591|gb|ADU98079.1| Zinc finger, CHCC-type [Alicycliphilus denitrificans BC] gi|329308260|gb|AEB82675.1| hypothetical protein Alide2_0245 [Alicycliphilus denitrificans K601] Length = 68 Score = 38.3 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVG 73 HP VF+ + + + CPYC TLY L + E + G Sbjct: 34 HPRVFLEIAHQGQAQCPYCGTLYR----LKAGEIVHAG 67 >gi|258543170|ref|YP_003188603.1| hypothetical protein APA01_21090 [Acetobacter pasteurianus IFO 3283-01] gi|256634248|dbj|BAI00224.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01] gi|256637308|dbj|BAI03277.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03] gi|256640360|dbj|BAI06322.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07] gi|256643417|dbj|BAI09372.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22] gi|256646472|dbj|BAI12420.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26] gi|256649525|dbj|BAI15466.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32] gi|256652511|dbj|BAI18445.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655569|dbj|BAI21496.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12] Length = 71 Score = 38.3 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 I + +K C G L HP V++ +G ++ CPYCS L+ ++ Sbjct: 17 VETIMVDKRKIACDGGLGALGHPRVWLKIGG-HQTVCPYCSRLFVLQPDAEA 67 >gi|290462511|gb|ADD24303.1| NADH dehydrogenase iron-sulfur protein 6, mitochondrial [Lepeophtheirus salmonis] Length = 126 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 22/49 (44%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS 63 I++ + C G PL HP VFIN+ + C YC Y SS Sbjct: 77 VPPIEVTERIVACDGGGGPLGHPRVFINLDDGEPSACIYCRLRYVLKSS 125 >gi|121609432|ref|YP_997239.1| hypothetical protein Veis_2476 [Verminephrobacter eiseniae EF01-2] gi|121554072|gb|ABM58221.1| conserved hypothetical protein [Verminephrobacter eiseniae EF01-2] Length = 68 Score = 38.3 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Query: 35 DHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVG 73 +HP V++++ + CPYC T+Y L + P G Sbjct: 33 NHPKVYLDVARTGQAKCPYCGTVYR----LQAGAPAPAG 67 >gi|42520388|ref|NP_966303.1| hypothetical protein WD0525 [Wolbachia endosymbiont of Drosophila melanogaster] gi|42410126|gb|AAS14237.1| hypothetical protein WD_0525 [Wolbachia endosymbiont of Drosophila melanogaster] Length = 63 Score = 38.3 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 HP + ++MGEE E CPYC + D ++++ Sbjct: 24 HPLISLDMGEEEEIACPYCEKTFVHDCTVEA 54 >gi|332112616|gb|EGJ12409.1| hypothetical protein RBXJA2T_18854 [Rubrivivax benzoatilyticus JA2] Length = 67 Score = 38.3 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 35 DHPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 +HP VFI++ E CPYC T+Y + + Sbjct: 33 NHPRVFIDVATTGEGRCPYCGTVYKLAPGVHAS 65 >gi|91786115|ref|YP_547067.1| hypothetical protein Bpro_0204 [Polaromonas sp. JS666] gi|91695340|gb|ABE42169.1| conserved hypothetical protein [Polaromonas sp. JS666] Length = 69 Score = 37.9 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP V++++G + CPYC T+Y Sbjct: 35 HPKVYLDVGRTGQAKCPYCGTVYK 58 >gi|187479236|ref|YP_787261.1| hypothetical protein BAV2763 [Bordetella avium 197N] gi|115423823|emb|CAJ50374.1| conserved hypothetical protein [Bordetella avium 197N] Length = 64 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 + I++G + C G PL HP VF+++ CPYC T Y Sbjct: 7 AAIEVGAEDLPVYCPGPKAPLWSMHPRVFLDVAHTGSARCPYCGTEYRLKP 57 >gi|56475960|ref|YP_157549.1| hypothetical protein ebB32 [Aromatoleum aromaticum EbN1] gi|56312003|emb|CAI06648.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1] Length = 66 Score = 37.9 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHF 60 HP VF+++ +E E CPYCS Y F Sbjct: 33 HPRVFLDVLKEGEAVCPYCSAKYVF 57 >gi|253999851|ref|YP_003051914.1| hypothetical protein Msip34_2145 [Methylovorus sp. SIP3-4] gi|313201825|ref|YP_004040483.1| hypothetical protein MPQ_2096 [Methylovorus sp. MP688] gi|253986530|gb|ACT51387.1| conserved hypothetical protein [Methylovorus sp. SIP3-4] gi|312441141|gb|ADQ85247.1| conserved hypothetical protein [Methylovorus sp. MP688] Length = 64 Score = 37.9 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 HP VF+++ + CPYC T Y L + E Sbjct: 30 HPRVFLDITASGQAMCPYCGTKYR----LKAGEA 59 >gi|222109423|ref|YP_002551687.1| hypothetical protein Dtpsy_0202 [Acidovorax ebreus TPSY] gi|221728867|gb|ACM31687.1| conserved hypothetical protein [Acidovorax ebreus TPSY] Length = 68 Score = 37.9 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP V++++ E CPYC T+Y L + E Sbjct: 34 HPKVYLDVAHTGEAKCPYCGTVYR----LKAGE 62 >gi|281212099|gb|EFA86260.1| putative NADH dehydrogenase [Polysphondylium pallidum PN500] Length = 112 Score = 37.9 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYC 54 ++I K C G + PL HP V+IN+ + C YC Sbjct: 47 VKPVEISADKIGCDGGNGPLGHPMVYINLDNAEPQACGYC 86 >gi|152983298|ref|YP_001354539.1| hypothetical protein mma_2849 [Janthinobacterium sp. Marseille] gi|151283375|gb|ABR91785.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille] Length = 64 Score = 37.9 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 14/27 (51%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDS 62 HP VF+ + E CPYC TLY Sbjct: 31 HPRVFLELSHGGEAKCPYCGTLYRLKP 57 >gi|33594283|ref|NP_881927.1| hypothetical protein BP3399 [Bordetella pertussis Tohama I] gi|33602961|ref|NP_890521.1| hypothetical protein BB3987 [Bordetella bronchiseptica RB50] gi|33564358|emb|CAE43662.1| conserved hypothetical protein [Bordetella pertussis Tohama I] gi|33568592|emb|CAE34350.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] Length = 70 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 15 HSRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 H I++G + C G PL HP VF+++ + CPYC Y Sbjct: 12 HDAIEVGAEDLPVYCPGPKAPLWSMHPRVFLDVTHTGQASCPYCGAAYRLKP 63 >gi|171057987|ref|YP_001790336.1| hypothetical protein Lcho_1302 [Leptothrix cholodnii SP-6] gi|170775432|gb|ACB33571.1| conserved hypothetical protein [Leptothrix cholodnii SP-6] Length = 68 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP V+I++ E CPYC T+Y L + E Sbjct: 35 HPKVYIDVAGSGEGRCPYCGTVYR----LKAGE 63 >gi|71908908|ref|YP_286495.1| hypothetical protein Daro_3295 [Dechloromonas aromatica RCB] gi|71848529|gb|AAZ48025.1| conserved hypothetical protein [Dechloromonas aromatica RCB] Length = 62 Score = 37.1 bits (85), Expect = 0.76, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHF 60 HP VF+++ + E CPYCST Y F Sbjct: 29 HPRVFLDVLKTGEVTCPYCSTKYVF 53 >gi|83859034|ref|ZP_00952555.1| hypothetical protein OA2633_11555 [Oceanicaulis alexandrii HTCC2633] gi|83852481|gb|EAP90334.1| hypothetical protein OA2633_11555 [Oceanicaulis alexandrii HTCC2633] Length = 66 Score = 37.1 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLP 71 I + K+ MC G L HP + MG+E+ C YC + L + P Sbjct: 13 EVIVVDQKRVMCDGGGGALGHPRTWYEMGDEDFVECGYCDRRFV----LRGSKADP 64 >gi|91774980|ref|YP_544736.1| hypothetical protein Mfla_0625 [Methylobacillus flagellatus KT] gi|91708967|gb|ABE48895.1| conserved hypothetical protein [Methylobacillus flagellatus KT] Length = 63 Score = 37.1 bits (85), Expect = 0.82, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 HP +F+++ CPYC T Y L + ET Sbjct: 30 HPRIFLDVAATGHVACPYCGTKYR----LKAGET 59 >gi|163792689|ref|ZP_02186666.1| hypothetical protein BAL199_17618 [alpha proteobacterium BAL199] gi|159182394|gb|EDP66903.1| hypothetical protein BAL199_17618 [alpha proteobacterium BAL199] Length = 61 Score = 36.7 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEE-NEKHCPYCSTLYH 59 I++ C G L HP VF+ + E+ ++ CPYCS Y Sbjct: 6 ETIEVTSHTVACDGGGGALGHPRVFLEIDEDVHKVVCPYCSRTYV 50 >gi|57239573|ref|YP_180709.1| hypothetical protein Erum8460 [Ehrlichia ruminantium str. Welgevonden] gi|57161652|emb|CAH58581.1| hypothetical protein Erum8460 [Ehrlichia ruminantium str. Welgevonden] Length = 56 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 16/27 (59%) Query: 35 DHPHVFINMGEENEKHCPYCSTLYHFD 61 +HP +++ + E CPYCS + ++ Sbjct: 29 EHPKIYLTIRNGQEIVCPYCSKTFTYN 55 >gi|221069648|ref|ZP_03545753.1| conserved hypothetical protein [Comamonas testosteroni KF-1] gi|264676252|ref|YP_003276158.1| hypothetical protein CtCNB1_0116 [Comamonas testosteroni CNB-2] gi|299533412|ref|ZP_07046794.1| hypothetical protein CTS44_21515 [Comamonas testosteroni S44] gi|220714671|gb|EED70039.1| conserved hypothetical protein [Comamonas testosteroni KF-1] gi|262206764|gb|ACY30862.1| conserved hypothetical protein [Comamonas testosteroni CNB-2] gi|298718618|gb|EFI59593.1| hypothetical protein CTS44_21515 [Comamonas testosteroni S44] Length = 69 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP V++++ + + CPYC T Y L + E Sbjct: 35 HPKVYLDVAKTGDAKCPYCGTTYR----LKAGE 63 >gi|288574987|ref|ZP_06393344.1| hypothetical protein Dpep_2263 [Dethiosulfovibrio peptidovorans DSM 11002] gi|288570728|gb|EFC92285.1| hypothetical protein Dpep_2263 [Dethiosulfovibrio peptidovorans DSM 11002] Length = 146 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 8/48 (16%) Query: 34 LDHPHVFINMGEENE-------KHCPYCSTLYHFDSSLDSKETLPVGC 74 LD V I G+E E CPYCST++++ L E C Sbjct: 83 LDQEDVLIAEGDEPEGVDLYRPILCPYCSTMFYYRPDL-CDENDTAQC 129 >gi|332040646|gb|EGI77021.1| hypothetical protein HGR_08504 [Hylemonella gracilis ATCC 19624] Length = 68 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP +++++ E CPYC T+Y L + E Sbjct: 34 HPKIYLDVAHTGEAKCPYCGTVYR----LKAGE 62 >gi|162149306|ref|YP_001603767.1| hypothetical protein GDI_3538 [Gluconacetobacter diazotrophicus PAl 5] gi|209544962|ref|YP_002277191.1| hypothetical protein Gdia_2845 [Gluconacetobacter diazotrophicus PAl 5] gi|161787883|emb|CAP57481.1| hypothetical protein GDI3538 [Gluconacetobacter diazotrophicus PAl 5] gi|209532639|gb|ACI52576.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] Length = 78 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 + + + C G L HP V++ + +++ CPYCS L+ + Sbjct: 24 VETVIVQSRVLSCDGGLGALGHPRVWLRI-ADHQTFCPYCSRLFVLNPDAGDDSA 77 >gi|89899319|ref|YP_521790.1| hypothetical protein Rfer_0507 [Rhodoferax ferrireducens T118] gi|89344056|gb|ABD68259.1| conserved hypothetical protein [Rhodoferax ferrireducens T118] Length = 67 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP V++++ E CPYC T+Y L + E Sbjct: 34 HPKVYLDVAHSGEAKCPYCGTVYK----LKAGE 62 >gi|241760297|ref|ZP_04758392.1| conserved hypothetical protein [Neisseria flavescens SK114] gi|241319175|gb|EER55653.1| conserved hypothetical protein [Neisseria flavescens SK114] Length = 65 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+ + +E CPYC T Y D + Sbjct: 32 HPRVFLPIQSNSEIECPYCGTYYRLDGEIPHH 63 >gi|319637751|ref|ZP_07992517.1| zinc finger protein [Neisseria mucosa C102] gi|317400906|gb|EFV81561.1| zinc finger protein [Neisseria mucosa C102] Length = 65 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+ + +E CPYC T Y D + Sbjct: 32 HPRVFLPIQSNSEIECPYCGTYYRLDGEIPHH 63 >gi|164662120|ref|XP_001732182.1| hypothetical protein MGL_0775 [Malassezia globosa CBS 7966] gi|159106084|gb|EDP44968.1| hypothetical protein MGL_0775 [Malassezia globosa CBS 7966] Length = 178 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 18/33 (54%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYH 59 C G PL HP VFIN+ + K CPYC Y Sbjct: 139 CDGGDGPLGHPRVFINLDKPEPKPCPYCGIRYQ 171 >gi|114568622|ref|YP_755302.1| hypothetical protein Mmar10_0068 [Maricaulis maris MCS10] gi|114339084|gb|ABI64364.1| hypothetical protein Mmar10_0068 [Maricaulis maris MCS10] Length = 65 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYC 54 C G L HP V++ MG+++ CPYC Sbjct: 23 CDGGGGALGHPRVYLEMGQDDFVECPYC 50 >gi|163855225|ref|YP_001629523.1| hypothetical protein Bpet0920 [Bordetella petrii DSM 12804] gi|163258953|emb|CAP41252.1| conserved hypothetical protein [Bordetella petrii] Length = 70 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Query: 15 HSRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 H I+IG + C G PL HP VF+++ C YC Y Sbjct: 12 HETIEIGAEDLPVYCPGPKAPLWSMHPRVFLDITHTGSARCAYCGAEYRLKP 63 >gi|196003332|ref|XP_002111533.1| hypothetical protein TRIADDRAFT_17646 [Trichoplax adhaerens] gi|190585432|gb|EDV25500.1| hypothetical protein TRIADDRAFT_17646 [Trichoplax adhaerens] Length = 93 Score = 36.0 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 20/44 (45%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLY 58 IK+ + C G + L HP V+IN+ + C YC Y Sbjct: 46 VPPIKVKGRHVWCDGGNSALGHPKVYINLDSPGPQICAYCGLRY 89 >gi|293603659|ref|ZP_06686079.1| conserved hypothetical protein [Achromobacter piechaudii ATCC 43553] gi|292817927|gb|EFF76988.1| conserved hypothetical protein [Achromobacter piechaudii ATCC 43553] Length = 71 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Query: 13 RGHSRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 H I++G + C G PL HP VF+++ C YC Y + Sbjct: 10 NAHEVIEVGAEDLPVFCPGPKAPLWSMHPRVFLDVARTGSASCAYCGAQYRLKA 63 >gi|119182827|ref|XP_001242519.1| hypothetical protein CIMG_06415 [Coccidioides immitis RS] Length = 265 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 21/45 (46%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLP 71 C G PL HP +FIN + C YC + + + E+LP Sbjct: 192 CDGGGGPLGHPKIFINTDKPEIAVCGYCGLPFAHEHNRKFLESLP 236 >gi|303319447|ref|XP_003069723.1| NADH-ubiquinone oxidoreductase, putative [Coccidioides posadasii C735 delta SOWgp] gi|240109409|gb|EER27578.1| NADH-ubiquinone oxidoreductase, putative [Coccidioides posadasii C735 delta SOWgp] gi|320040826|gb|EFW22759.1| NADH-ubiquinone oxidoreductase [Coccidioides posadasii str. Silveira] Length = 216 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 21/45 (46%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLP 71 C G PL HP +FIN + C YC + + + E+LP Sbjct: 143 CDGGGGPLGHPKIFINTDKPEIAVCGYCGLPFAHEHNRKFLESLP 187 >gi|71023385|ref|XP_761922.1| hypothetical protein UM05775.1 [Ustilago maydis 521] gi|46100781|gb|EAK86014.1| hypothetical protein UM05775.1 [Ustilago maydis 521] Length = 211 Score = 35.6 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 20/40 (50%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDS 66 C G PL HP VFIN+ + K CPYC + D + Sbjct: 172 CDGGGGPLGHPKVFINLDKPGPKPCPYCGIRFELDHAAHH 211 >gi|119899066|ref|YP_934279.1| hypothetical protein azo2776 [Azoarcus sp. BH72] gi|119671479|emb|CAL95392.1| conserved hypothetical protein [Azoarcus sp. BH72] Length = 66 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 16/25 (64%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHF 60 HP VF+++ E + CPYCS Y F Sbjct: 33 HPRVFLDVLTEGKAVCPYCSAQYEF 57 >gi|134095780|ref|YP_001100855.1| hypothetical protein HEAR2612 [Herminiimonas arsenicoxydans] gi|133739683|emb|CAL62734.1| Conserved hypothetical protein [Herminiimonas arsenicoxydans] Length = 66 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 13/27 (48%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDS 62 HP VF+ E CPYC T+Y Sbjct: 33 HPRVFLEFSHGGEAKCPYCGTVYRLKP 59 >gi|171464120|ref|YP_001798233.1| hypothetical protein Pnec_1534 [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171193658|gb|ACB44619.1| conserved hypothetical protein [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 62 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+++ + E CPYC+T Y + Sbjct: 29 HPRVFLDITKTGEAKCPYCATEYKLIPGTEPH 60 >gi|241048562|ref|XP_002407295.1| NADH ubiquinone oxidoreductase subunit, putative [Ixodes scapularis] gi|215492175|gb|EEC01816.1| NADH ubiquinone oxidoreductase subunit, putative [Ixodes scapularis] Length = 125 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 18/41 (43%) Query: 27 CAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 C G P L HP VFIN+ C YC + D S S Sbjct: 85 CDGGDPALGHPRVFINLDAPGNHACGYCGLRFFQDPSHKSH 125 >gi|16124444|ref|NP_419008.1| hypothetical protein CC_0189 [Caulobacter crescentus CB15] gi|221233128|ref|YP_002515564.1| cytosolic protein [Caulobacter crescentus NA1000] gi|13421310|gb|AAK22176.1| hypothetical protein CC_0189 [Caulobacter crescentus CB15] gi|220962300|gb|ACL93656.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000] Length = 88 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 22/58 (37%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVG 73 I + + C G L HP V++ MG CPYC + + E L G Sbjct: 23 ETIAVHGHRIACDGVGGALGHPRVWLEMGAAGFVDCPYCDRRFVAATDAGHDEHLAPG 80 >gi|302877758|ref|YP_003846322.1| Zinc finger, CHCC-type [Gallionella capsiferriformans ES-2] gi|302580547|gb|ADL54558.1| Zinc finger, CHCC-type [Gallionella capsiferriformans ES-2] Length = 64 Score = 35.2 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 16/25 (64%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHF 60 HP V + + E E HCPYC TLY F Sbjct: 31 HPRVALALDGEGEAHCPYCGTLYKF 55 >gi|167626909|ref|YP_001677409.1| hypothetical protein Fphi_0687 [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|167596910|gb|ABZ86908.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25017] Length = 55 Score = 35.2 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 16/24 (66%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP V+I++ ++ CPYC T++ Sbjct: 29 HPRVYIDLKDKKTNTCPYCGTVFK 52 >gi|195031972|ref|XP_001988420.1| GH11154 [Drosophila grimshawi] gi|193904420|gb|EDW03287.1| GH11154 [Drosophila grimshawi] Length = 126 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYC 54 I+ + C G + PL HP V+IN+ + C YC Sbjct: 78 IETTERVVYCDGGNGPLGHPKVYINLDKPGNHICGYC 114 >gi|254420445|ref|ZP_05034169.1| hypothetical protein BBAL3_2755 [Brevundimonas sp. BAL3] gi|196186622|gb|EDX81598.1| hypothetical protein BBAL3_2755 [Brevundimonas sp. BAL3] Length = 79 Score = 35.2 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS 63 + + K+ C G L HP V+++MGE++ C YC + + Sbjct: 14 EEVVVSTKRVACDGGGGALGHPLVYMDMGEDDFIECGYCDRRFVLSAD 61 >gi|238020675|ref|ZP_04601101.1| hypothetical protein GCWU000324_00564 [Kingella oralis ATCC 51147] gi|237867655|gb|EEP68661.1| hypothetical protein GCWU000324_00564 [Kingella oralis ATCC 51147] Length = 73 Score = 34.8 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 HP VF+ + E CPYC T+Y + L Sbjct: 33 HPRVFLPIQSNGEIECPYCGTIYQLNGELPHHHA 66 >gi|160871582|ref|ZP_02061714.1| conserved hypothetical protein [Rickettsiella grylli] gi|159120381|gb|EDP45719.1| conserved hypothetical protein [Rickettsiella grylli] Length = 64 Score = 34.8 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 36 HPHVFINMGEENEKHCPYCSTLY 58 HP V++ +G+ CPYC T Y Sbjct: 36 HPRVYLPLGKTGSITCPYCGTEY 58 >gi|304320503|ref|YP_003854146.1| hypothetical protein PB2503_04647 [Parvularcula bermudensis HTCC2503] gi|303299405|gb|ADM09004.1| hypothetical protein PB2503_04647 [Parvularcula bermudensis HTCC2503] Length = 116 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 22/58 (37%) Query: 10 QNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 + ++ +C G L HP VF +G C YC ++ FD S + Sbjct: 22 HRPESLEVVFTDQRRVVCDGPGGGLGHPRVFYTIGTAGYAECGYCDRVFVFDPSRKGE 79 >gi|297539328|ref|YP_003675097.1| Zinc finger protein [Methylotenera sp. 301] gi|297258675|gb|ADI30520.1| Zinc finger, CHCC-type [Methylotenera sp. 301] Length = 62 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP VF+++ + CPYC T Y L + E Sbjct: 29 HPRVFLDVAKTGHVACPYCGTKYK----LKAGE 57 >gi|82702190|ref|YP_411756.1| hypothetical protein Nmul_A1061 [Nitrosospira multiformis ATCC 25196] gi|82410255|gb|ABB74364.1| conserved hypothetical protein [Nitrosospira multiformis ATCC 25196] Length = 67 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP VF+ + + E CPYC T Y Sbjct: 34 HPRVFLPIEDTGEALCPYCGTHYV 57 >gi|325141760|gb|EGC64212.1| hypothetical protein NMB9615945_1638 [Neisseria meningitidis 961-5945] gi|325197754|gb|ADY93210.1| conserved hypothetical protein [Neisseria meningitidis G2136] Length = 67 Score = 34.4 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 36 HPHVFINM--GEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+ + GE CPYC T Y FD + Sbjct: 31 HPRVFLPLCEGESGSVACPYCGTRYRFDGKMPHH 64 >gi|329911502|ref|ZP_08275553.1| hypothetical protein IMCC9480_524 [Oxalobacteraceae bacterium IMCC9480] gi|327545874|gb|EGF30985.1| hypothetical protein IMCC9480_524 [Oxalobacteraceae bacterium IMCC9480] Length = 65 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 HP VF++M E CPYC T+Y + + ET Sbjct: 33 HPRVFLDM-SHGEAKCPYCGTVYR----MKAGET 61 >gi|311104221|ref|YP_003977074.1| zinc-finger domain-containing protein [Achromobacter xylosoxidans A8] gi|310758910|gb|ADP14359.1| zinc-finger domain protein [Achromobacter xylosoxidans A8] Length = 73 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Query: 16 SRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 I++G C G PL HP VF+++ C YC Y Sbjct: 14 EVIEVGADDLPVFCPGPKAPLWSMHPRVFLDVARSGSASCAYCGAEYRLKP 64 >gi|198282839|ref|YP_002219160.1| hypothetical protein Lferr_0702 [Acidithiobacillus ferrooxidans ATCC 53993] gi|218667955|ref|YP_002425038.1| hypothetical protein AFE_0546 [Acidithiobacillus ferrooxidans ATCC 23270] gi|198247360|gb|ACH82953.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC 53993] gi|218520168|gb|ACK80754.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC 23270] Length = 70 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 15/24 (62%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP VF+ + E E CPYC TLY Sbjct: 35 HPRVFLKIEETGEVRCPYCGTLYV 58 >gi|254464184|ref|ZP_05077595.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] gi|206685092|gb|EDZ45574.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] Length = 60 Score = 34.0 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 20 IGVKKFMCAGTSPPLDHPHVFINMGEENEKH-CPYCSTLYHFDSSLDSKE 68 + +K C G+ L HP V++ + E++ CPYC Y + + + E Sbjct: 11 VDSRKVACDGSEGALGHPRVYLLIPEDDNFVECPYCDCKYVYRDAAKAAE 60 >gi|317402214|gb|EFV82804.1| hypothetical protein HMPREF0005_00235 [Achromobacter xylosoxidans C54] Length = 70 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Query: 15 HSRIKIGVKKF--MCAGTSPPL--DHPHVFINMGEENEKHCPYCSTLYHFDS 62 H I++G + C G PL HP VF+++ C YC Y Sbjct: 11 HEVIEVGAEDLPVFCPGPKAPLWSMHPRVFLDVAHTGSARCAYCGAEYKLKP 62 >gi|56707420|ref|YP_169316.1| hypothetical protein FTT_0264c [Francisella tularensis subsp. tularensis SCHU S4] gi|89255581|ref|YP_512942.1| hypothetical protein FTL_0144 [Francisella tularensis subsp. holarctica LVS] gi|110669891|ref|YP_666448.1| hypothetical protein FTF0264c [Francisella tularensis subsp. tularensis FSC198] gi|115314088|ref|YP_762811.1| hypothetical protein FTH_0137 [Francisella tularensis subsp. holarctica OSU18] gi|118496754|ref|YP_897804.1| hypothetical protein FTN_0139 [Francisella tularensis subsp. novicida U112] gi|134302640|ref|YP_001122609.1| hypothetical protein FTW_1823 [Francisella tularensis subsp. tularensis WY96-3418] gi|156501524|ref|YP_001427590.1| hypothetical protein FTA_0156 [Francisella tularensis subsp. holarctica FTNF002-00] gi|167010347|ref|ZP_02275278.1| hypothetical protein Ftulh_06420 [Francisella tularensis subsp. holarctica FSC200] gi|194324061|ref|ZP_03057836.1| hypothetical protein FTE_0429 [Francisella tularensis subsp. novicida FTE] gi|208779976|ref|ZP_03247319.1| hypothetical protein FTG_0979 [Francisella novicida FTG] gi|224456497|ref|ZP_03664970.1| hypothetical protein FtultM_01438 [Francisella tularensis subsp. tularensis MA00-2987] gi|254366982|ref|ZP_04983018.1| hypothetical protein FTHG_00151 [Francisella tularensis subsp. holarctica 257] gi|254368579|ref|ZP_04984595.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica FSC022] gi|254370884|ref|ZP_04986889.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|254372119|ref|ZP_04987612.1| conserved hypothetical protein [Francisella tularensis subsp. novicida GA99-3549] gi|254375265|ref|ZP_04990745.1| conserved hypothetical protein [Francisella novicida GA99-3548] gi|254874256|ref|ZP_05246966.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis MA00-2987] gi|290954415|ref|ZP_06559036.1| hypothetical protein FtulhU_09474 [Francisella tularensis subsp. holarctica URFT1] gi|295312157|ref|ZP_06802963.1| hypothetical protein FtulhU_09461 [Francisella tularensis subsp. holarctica URFT1] gi|56603912|emb|CAG44897.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis SCHU S4] gi|89143412|emb|CAJ78585.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica LVS] gi|110320224|emb|CAL08280.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC198] gi|115128987|gb|ABI82174.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica OSU18] gi|118422660|gb|ABK89050.1| hypothetical protein FTN_0139 [Francisella novicida U112] gi|134050417|gb|ABO47488.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis WY96-3418] gi|134252808|gb|EBA51902.1| hypothetical protein FTHG_00151 [Francisella tularensis subsp. holarctica 257] gi|151569127|gb|EDN34781.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|151569850|gb|EDN35504.1| conserved hypothetical protein [Francisella novicida GA99-3549] gi|151572983|gb|EDN38637.1| conserved hypothetical protein [Francisella novicida GA99-3548] gi|156252127|gb|ABU60633.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|157121482|gb|EDO65673.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica FSC022] gi|194321958|gb|EDX19441.1| hypothetical protein FTE_0429 [Francisella tularensis subsp. novicida FTE] gi|208743980|gb|EDZ90281.1| hypothetical protein FTG_0979 [Francisella novicida FTG] gi|254840255|gb|EET18691.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis MA00-2987] gi|282158562|gb|ADA77953.1| hypothetical protein NE061598_01495 [Francisella tularensis subsp. tularensis NE061598] gi|328675307|gb|AEB27982.1| hypothetical protein FN3523_0125 [Francisella cf. novicida 3523] gi|328676211|gb|AEB27081.1| hypothetical protein FNFX1_0133 [Francisella cf. novicida Fx1] Length = 57 Score = 34.0 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP V+I++ ++ CPYC T + Sbjct: 29 HPRVYIDLKDKKTNSCPYCGTTFK 52 >gi|329890934|ref|ZP_08269277.1| zinc-finger domain protein [Brevundimonas diminuta ATCC 11568] gi|328846235|gb|EGF95799.1| zinc-finger domain protein [Brevundimonas diminuta ATCC 11568] Length = 63 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 20 IGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 + K+ C G L HP V+++MGE++ C YC + + + Sbjct: 2 VSTKRVACDGGGGALGHPLVYMDMGEDDFIECGYCDRRFVLSAHPHPE 49 >gi|254796827|ref|YP_003081664.1| hypothetical protein NRI_0444 [Neorickettsia risticii str. Illinois] gi|254590071|gb|ACT69433.1| conserved hypothetical protein [Neorickettsia risticii str. Illinois] Length = 56 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKET 69 HP V++++ + CPYC ++ + D ET Sbjct: 23 HPLVYLDLQRDGRVTCPYCGAIFVHRGTNDDSET 56 >gi|197106928|ref|YP_002132305.1| hypothetical protein PHZ_c3467 [Phenylobacterium zucineum HLK1] gi|196480348|gb|ACG79876.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1] Length = 101 Score = 34.0 bits (77), Expect = 7.6, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 18/39 (46%) Query: 16 SRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYC 54 + + + C G L HP V++ MGE CPYC Sbjct: 34 EVVTVRSGRIACDGVGGALGHPRVWLEMGEATFVECPYC 72 >gi|121603065|ref|YP_980394.1| hypothetical protein Pnap_0148 [Polaromonas naphthalenivorans CJ2] gi|120592034|gb|ABM35473.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2] Length = 69 Score = 33.7 bits (76), Expect = 7.8, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP V++++ E CPYC +Y L + E Sbjct: 35 HPKVYLDVARTGEAKCPYCGEIYK----LKAGE 63 >gi|294788413|ref|ZP_06753656.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453] gi|294483844|gb|EFG31528.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453] Length = 62 Score = 33.7 bits (76), Expect = 7.8, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP VF+ + ++ CPYC T+Y D Sbjct: 30 HPRVFLPIQSNSQIECPYCGTMYQLDGEAKGH 61 >gi|328544888|ref|YP_004304997.1| Hsp33-like chaperonin [Polymorphum gilvum SL003B-26A1] gi|326414630|gb|ADZ71693.1| Hsp33-like chaperonin [Polymorphum gilvum SL003B-26A1] Length = 325 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Query: 29 GTSPPLDHPHVFINMGEENEKH--CPYCSTLYHFDS 62 G D PH M +++ C +CST Y FD Sbjct: 289 GILDSFD-PHELSEMVVDDKIVVTCEFCSTKYEFDP 323 >gi|295677577|ref|YP_003606101.1| Zinc finger, CHCC-type [Burkholderia sp. CCGE1002] gi|295437420|gb|ADG16590.1| Zinc finger, CHCC-type [Burkholderia sp. CCGE1002] Length = 64 Score = 33.7 bits (76), Expect = 8.0, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP VFI++ E CPYCST Y Sbjct: 32 HPRVFIDV-SHGEARCPYCSTRYK 54 >gi|209518340|ref|ZP_03267165.1| conserved hypothetical protein [Burkholderia sp. H160] gi|209501259|gb|EEA01290.1| conserved hypothetical protein [Burkholderia sp. H160] Length = 64 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP VFI++ E CPYCST Y Sbjct: 32 HPRVFIDV-SHGEARCPYCSTRYK 54 >gi|330842980|ref|XP_003293444.1| hypothetical protein DICPUDRAFT_42045 [Dictyostelium purpureum] gi|325076229|gb|EGC30033.1| hypothetical protein DICPUDRAFT_42045 [Dictyostelium purpureum] Length = 98 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYC 54 I++ K C G + PL HP V+IN+ + C YC Sbjct: 45 VKPIEVQDSKIGCDGGNGPLGHPMVYINLEGNTPQSCGYC 84 >gi|323527250|ref|YP_004229403.1| Zinc finger, CHCC-type [Burkholderia sp. CCGE1001] gi|323384252|gb|ADX56343.1| Zinc finger, CHCC-type [Burkholderia sp. CCGE1001] Length = 64 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP VFI++ E CPYCST Y Sbjct: 32 HPRVFIDV-SHGEARCPYCSTRYK 54 >gi|328872104|gb|EGG20471.1| putative NADH dehydrogenase [Dictyostelium fasciculatum] Length = 100 Score = 33.7 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 21/40 (52%) Query: 15 HSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYC 54 I+I + C G + PL HP V+IN+ E + C YC Sbjct: 49 VKPIEIDGHRIGCDGGNGPLGHPMVYINLDGEKPQSCGYC 88 >gi|307730887|ref|YP_003908111.1| Zinc finger, CHCC-type [Burkholderia sp. CCGE1003] gi|307585422|gb|ADN58820.1| Zinc finger, CHCC-type [Burkholderia sp. CCGE1003] Length = 64 Score = 33.7 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP VFI++ E CPYCST Y Sbjct: 32 HPRVFIDV-SHGEARCPYCSTRYK 54 >gi|170693438|ref|ZP_02884597.1| conserved hypothetical protein [Burkholderia graminis C4D1M] gi|170141593|gb|EDT09762.1| conserved hypothetical protein [Burkholderia graminis C4D1M] Length = 64 Score = 33.7 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP VFI++ E CPYCST Y Sbjct: 32 HPRVFIDV-SHGEARCPYCSTRYK 54 >gi|291614557|ref|YP_003524714.1| Zinc finger, CHCC-type [Sideroxydans lithotrophicus ES-1] gi|291584669|gb|ADE12327.1| Zinc finger, CHCC-type [Sideroxydans lithotrophicus ES-1] Length = 66 Score = 33.7 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 16/32 (50%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSK 67 HP V I + + E CPYC TLY F L Sbjct: 33 HPRVAIPVEKLGEARCPYCGTLYKFKGELPHG 64 >gi|254293911|ref|YP_003059934.1| hypothetical protein Hbal_1549 [Hirschia baltica ATCC 49814] gi|254042442|gb|ACT59237.1| hypothetical protein Hbal_1549 [Hirschia baltica ATCC 49814] Length = 65 Score = 33.7 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Query: 12 DRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLP 71 D H I I K C G L HP V+ +M E++ C YC + L E P Sbjct: 8 DIQHEIIVIDGHKTSCDGGGGALGHPLVWYDMVEDDIVECKYCDRRFV----LKGSEQDP 63 Query: 72 V 72 Sbjct: 64 T 64 >gi|187932196|ref|YP_001892181.1| hypothetical protein FTM_1585 [Francisella tularensis subsp. mediasiatica FSC147] gi|187713105|gb|ACD31402.1| conserved hypothetical protein [Francisella tularensis subsp. mediasiatica FSC147] Length = 57 Score = 33.7 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP V+I++ ++ CPYC T + Sbjct: 29 HPRVYIDLKDKKTNSCPYCGTTFK 52 >gi|74318153|ref|YP_315893.1| hypothetical protein Tbd_2135 [Thiobacillus denitrificans ATCC 25259] gi|74057648|gb|AAZ98088.1| hypothetical protein Tbd_2135 [Thiobacillus denitrificans ATCC 25259] Length = 78 Score = 33.7 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 36 HPHVFINMGEENEKHCPYCSTLYH 59 HP V++ + + CPYC TLY Sbjct: 45 HPRVYLPIEVRGDALCPYCGTLYR 68 >gi|253997246|ref|YP_003049310.1| hypothetical protein Mmol_1880 [Methylotenera mobilis JLW8] gi|253983925|gb|ACT48783.1| conserved hypothetical protein [Methylotenera mobilis JLW8] Length = 63 Score = 33.7 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Query: 36 HPHVFINMGEENEKHCPYCSTLYHFDSSLDSKE 68 HP VF+++ + CPYC T Y L + E Sbjct: 29 HPRVFLDVAKTGHVACPYCGTKYK----LKAGE 57 >gi|186475223|ref|YP_001856693.1| hypothetical protein Bphy_0455 [Burkholderia phymatum STM815] gi|184191682|gb|ACC69647.1| conserved hypothetical protein [Burkholderia phymatum STM815] Length = 64 Score = 33.7 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Query: 35 DHPHVFINMGEENEKHCPYCSTLYH 59 +HP VFI++ E CPYCST Y Sbjct: 31 NHPRVFIDV-THGEARCPYCSTRYK 54 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.314 0.157 0.590 Lambda K H 0.267 0.0480 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,829,879,587 Number of Sequences: 13984884 Number of extensions: 72006981 Number of successful extensions: 132014 Number of sequences better than 10.0: 239 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 87 Number of HSP's that attempted gapping in prelim test: 131664 Number of HSP's gapped (non-prelim): 405 length of query: 78 length of database: 4,792,584,752 effective HSP length: 49 effective length of query: 29 effective length of database: 4,107,325,436 effective search space: 119112437644 effective search space used: 119112437644 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.3 bits) S2: 76 (33.7 bits)