RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780167|ref|YP_003064580.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >gnl|CDD|150882 pfam10276, zf-CHCC, Zinc-finger domain. This is a short zinc-finger domain conserved from fungi to humans. It is Cx8Hx14Cx2C. Length = 40 Score = 55.4 bits (134), Expect = 3e-09 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 21 GVKKFMCAGTSPPLDHPHVFINMGEENEKH-CPYCSTLY 58 G ++ C G PL HP V+IN+ +E CPYC + Sbjct: 1 GGRRVSCDGGGGPLGHPRVYINLDDETGPVECPYCGLRF 39 >gnl|CDD|178874 PRK00114, hslO, Hsp33-like chaperonin; Reviewed. Length = 293 Score = 27.1 bits (61), Expect = 1.1 Identities = 6/16 (37%), Positives = 7/16 (43%) Query: 48 EKHCPYCSTLYHFDSS 63 E C +C Y FD Sbjct: 268 EMVCQFCGNKYLFDEE 283 >gnl|CDD|148058 pfam06226, DUF1007, Protein of unknown function (DUF1007). Family of conserved bacterial proteins with unknown function. Length = 212 Score = 26.1 bits (58), Expect = 1.9 Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 25 FMCAGTSPPLDHPHVFINM 43 + A + P HPHVFI+ Sbjct: 9 GLVALSLPAFAHPHVFIDA 27 >gnl|CDD|183852 PRK13030, PRK13030, 2-oxoacid ferredoxin oxidoreductase; Provisional. Length = 1159 Score = 26.1 bits (58), Expect = 2.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 28 AGTSPPLDHPHVFINMGE 45 G +P + HVF N+G+ Sbjct: 478 IGHAPFTETKHVFQNLGD 495 >gnl|CDD|179295 PRK01402, hslO, Hsp33-like chaperonin; Reviewed. Length = 328 Score = 25.7 bits (57), Expect = 2.8 Identities = 6/11 (54%), Positives = 8/11 (72%) Query: 51 CPYCSTLYHFD 61 C +CS +Y FD Sbjct: 311 CEFCSRVYRFD 321 >gnl|CDD|180808 PRK07048, PRK07048, serine/threonine dehydratase; Validated. Length = 321 Score = 25.4 bits (56), Expect = 3.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 32 PPLDHPHV 39 PP DHPHV Sbjct: 148 PPYDHPHV 155 >gnl|CDD|169040 PRK07636, ligB, ATP-dependent DNA ligase; Reviewed. Length = 275 Score = 25.1 bits (55), Expect = 4.6 Identities = 7/16 (43%), Positives = 8/16 (50%) Query: 33 PLDHPHVFINMGEENE 48 L HP+V I G E Sbjct: 132 LLPHPNVKIIEGIEGH 147 >gnl|CDD|181688 PRK09193, PRK09193, indolepyruvate ferredoxin oxidoreductase; Validated. Length = 1165 Score = 24.0 bits (53), Expect = 8.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 29 GTSPPLDHPHVFINMG 44 G +P D HVF N+G Sbjct: 492 GQAPFTDEKHVFQNLG 507 >gnl|CDD|180002 PRK05301, PRK05301, pyrroloquinoline quinone biosynthesis protein PqqE; Provisional. Length = 378 Score = 24.0 bits (53), Expect = 8.3 Identities = 5/6 (83%), Positives = 5/6 (83%) Query: 50 HCPYCS 55 CPYCS Sbjct: 29 QCPYCS 34 >gnl|CDD|181724 PRK09246, PRK09246, amidophosphoribosyltransferase; Provisional. Length = 501 Score = 24.0 bits (53), Expect = 9.0 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 21 GVKKFMCAGTSPPLDHPHVF-INM 43 G KK A +PP+ P+V+ I+M Sbjct: 385 GAKKVYFASAAPPVRFPNVYGIDM 408 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.140 0.461 Gapped Lambda K H 0.267 0.0630 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,236,527 Number of extensions: 58613 Number of successful extensions: 129 Number of sequences better than 10.0: 1 Number of HSP's gapped: 128 Number of HSP's successfully gapped: 17 Length of query: 78 Length of database: 5,994,473 Length adjustment: 48 Effective length of query: 30 Effective length of database: 4,957,289 Effective search space: 148718670 Effective search space used: 148718670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.2 bits)