RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780167|ref|YP_003064580.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} (A:) Length = 87 Score = 126 bits (319), Expect = 9e-31 Identities = 46/77 (59%), Positives = 57/77 (74%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 M D+ IPHFQND G+ I+IGVK+FMC G + P DHPH+FI+MG +EK CPYCSTLY + Sbjct: 1 MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60 Query: 61 DSSLDSKETLPVGCLLS 77 D SL +T P GCL + Sbjct: 61 DPSLSYNQTNPTGCLYN 77 >2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} (A:) Length = 80 Score = 35.6 bits (82), Expect = 0.003 Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKH-CPYCSTLYHFDSSLDSKETLP 71 + + K C G L HP V++++ E C YC Y +S +K Sbjct: 22 VVVSTWKVACDGGEGALGHPRVWLSIPHETGFVECGYCDRRYIHESFAAAKLEHH 76 >2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} (A:) Length = 67 Score = 33.6 bits (77), Expect = 0.008 Identities = 12/46 (26%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Query: 27 CAGTSPPLDHPHVFINMG-EENEKHCPYCSTLYHFDSSLDSKETLP 71 C G L HP V++ + + CPYC Y S Sbjct: 18 CDGGEGALGHPRVWLQIPEDTGWVECPYCDCKYVLKGSKADALEHH 63 >1i7f_A Heat shock protein 33; HSP33, redox sensitive molecular chaperone; 2.70A {Escherichia coli} (A:179-292) Length = 114 Score = 27.1 bits (60), Expect = 1.0 Identities = 7/22 (31%), Positives = 11/22 (50%), Gaps = 3/22 (13%) Query: 43 MGEEN---EKHCPYCSTLYHFD 61 + E+ + HC YC Y F+ Sbjct: 74 ILAEDGEIDXHCDYCGNHYLFN 95 >1vzy_A 33 kDa chaperonin; chaperone, heat shock protein, crystal engineering, molecular chaperone, redox-active center, PSI; 1.97A {Bacillus subtilis} (A:238-291) Length = 54 Score = 25.0 bits (55), Expect = 3.2 Identities = 7/22 (31%), Positives = 11/22 (50%), Gaps = 3/22 (13%) Query: 43 MGEENEK---HCPYCSTLYHFD 61 M EE+ + C +C+ Y F Sbjct: 20 MIEEDGQAEAVCHFCNEKYLFT 41 >1aym_2 HRV16, human rhinovirus 16 coat protein; RNA, site-directed mutagenesis, icosahedral virus; HET: MYR DAO; 2.15A {Human rhinovirus SP} PDB: 1ayn_2* 1ncr_B* 1nd2_B* 1nd3_B* 1qju_2* 1qjx_2* 1qjy_2* 1c8m_2* 1d3e_2 1r1a_2* 2hwd_2* 2hwe_2* 2hwf_2* 1fpn_2* 1v9u_2* 3dpr_B* (2:) Length = 261 Score = 24.8 bits (54), Expect = 3.8 Identities = 8/19 (42%), Positives = 9/19 (47%), Gaps = 2/19 (10%) Query: 37 PHVFINMGEENEKH--CPY 53 PH FIN+ N PY Sbjct: 186 PHQFINLRSNNSATLIVPY 204 >1vq0_A 33 kDa chaperonin; TM1394, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: UNL; 2.20A {Thermotoga maritima} (A:245-302) Length = 58 Score = 24.3 bits (53), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 2/21 (9%) Query: 43 MGEEN--EKHCPYCSTLYHFD 61 M +E E C +C+T Y F Sbjct: 21 MRKEGKGEVVCKWCNTRYVFS 41 >1k82_A Formamidopyrimidine-DNA glycosylase; protein-DNA complex, DNA repair, beta sandwich, zinc finger, helix two-turns helix, hydrolase/DNA complex; HET: PED; 2.10A {Escherichia coli} (A:1-128) Length = 128 Score = 23.7 bits (51), Expect = 9.1 Identities = 6/41 (14%), Positives = 10/41 (24%) Query: 8 HFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENE 48 + + + PP H HV + M Sbjct: 61 ELPEGWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKV 101 >1ncq_B Coat protein VP2; HRV, pleconaril, icosahedral virus; HET: W11; 2.50A {Human rhinovirus 14} (B:) Length = 262 Score = 23.7 bits (51), Expect = 9.1 Identities = 8/19 (42%), Positives = 9/19 (47%), Gaps = 2/19 (10%) Query: 37 PHVFINMGEENEKH--CPY 53 PH FIN+ N PY Sbjct: 185 PHQFINLRTNNTATIVIPY 203 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.322 0.140 0.461 Gapped Lambda K H 0.267 0.0727 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 631,768 Number of extensions: 24118 Number of successful extensions: 252 Number of sequences better than 10.0: 1 Number of HSP's gapped: 249 Number of HSP's successfully gapped: 17 Length of query: 78 Length of database: 4,956,049 Length adjustment: 43 Effective length of query: 35 Effective length of database: 3,502,434 Effective search space: 122585190 Effective search space used: 122585190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.0 bits)