BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780167|ref|YP_003064580.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780167|ref|YP_003064580.1| hypothetical protein CLIBASIA_00250 [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 164 bits (414), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF Sbjct: 1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60 Query: 61 DSSLDSKETLPVGCLLSL 78 DSSLDSKETLPVGCLLSL Sbjct: 61 DSSLDSKETLPVGCLLSL 78 >gi|254780648|ref|YP_003065061.1| GTPase ObgE [Candidatus Liberibacter asiaticus str. psy62] Length = 335 Score = 24.6 bits (52), Expect = 0.29, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 25/59 (42%) Query: 18 IKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLL 76 +K G K+F+ A + + H +G+ KH L H S+L+ C+L Sbjct: 201 VKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCIL 259 >537021.9.peg.74_1 Length = 196 Score = 22.7 bits (47), Expect = 1.2, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 2 VDHPIPHFQNDRGHSRIKIGVKKFMC 27 + P H+ N R SRI +F+C Sbjct: 169 LSSPSFHYWNKRRRSRILTRSLRFLC 194 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.140 0.461 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,433 Number of Sequences: 1233 Number of extensions: 1845 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 78 length of database: 328,796 effective HSP length: 48 effective length of query: 30 effective length of database: 269,612 effective search space: 8088360 effective search space used: 8088360 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.0 bits) S2: 31 (16.5 bits)