>TIGR02734 crtI_fam phytoene desaturase; InterPro: IPR014105 Phytoene is converted to lycopene by desaturation at four (two symmetrical pairs of) sites. This is achieved by two enzymes (crtP and crtQ) in cyanobacteria (Gloeobacter being an exception) and plants, but by a single enzyme in most other bacteria and in fungi. This single enzyme is called the bacterial-type phytoene desaturase, or CrtI. Most members of this family are CrtI and are part of flavin containing amine oxidoreductase family. It is likely that all members act on either phytoene or on related compounds such as dehydrosqualene, for carotenoid biosynthesis..

Probab=98.47 E-value=1.1e-07 Score=71.30 Aligned_cols=65 Identities=37% Similarity=0.641 Sum_probs=46.3 Q ss_pred CEECCHHHHHHHHHHHHHCCCEEEEEECCCCCC-------CC-CCE------EEECHHHHH-HHHHCC--CHHHHHHCCC Q ss_conf 387753899999999997798599995687655-------57-713------667888999-999889--9478986268 Q gi|254780168|r 1 MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLS-------DS-GFG------IQISPNASR-ILKRIG--ILDQLEDIWI 63 (380) Q Consensus 1 iIvGaG~aGl~~A~~L~~~G~~v~i~Er~~~~~-------~~-g~g------i~l~p~~~~-~L~~lG--i~~~~~~~~~ 63 (380) T Consensus 2 ~VIGAG~gGLA~A~rL~~~G~~vtv~E~~d~pGGRA~~~~~~fGf~fD~GPTv~t~P~~~~elF~~~G~~~~~~v~L~~l 81 (526) T TIGR02734 2 VVIGAGFGGLALAIRLQAAGIRVTVVEKRDKPGGRAGVLEDDFGFRFDTGPTVITMPEALEELFALAGRDLADYVELVPL 81 (526) T ss_pred EEECCCHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEECCCCEEEECCCCEEECHHHHHHHHHHHCHHHHHHCCCCCC T ss_conf 68577768999999997379528998606898750556881575466058824544678999998834316964585315 Q ss_pred CC Q ss_conf 84 Q gi|254780168|r 64 EP 65 (380) Q Consensus 64 ~~ 65 (380) T Consensus 82 ~P 83 (526) T TIGR02734 82 DP 83 (526) T ss_pred CC T ss_conf 87

HHsearch alignment for GI: 254780168 and conserved domain: TIGR02734