RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780169|ref|YP_003064582.1| hypothetical protein CLIBASIA_00260 [Candidatus Liberibacter asiaticus str. psy62] (54 letters) >gnl|CDD|184324 PRK13785, PRK13785, adenylosuccinate synthetase; Provisional. Length = 454 Score = 29.3 bits (66), Expect = 0.22 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 7 KKIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEIIQQL 45 K+ E+ V+ G A +F++D LFE+Y E ++L Sbjct: 166 KRALAED--VY-GLDASETPEAFDVDALFEEYREYGERL 201 >gnl|CDD|179510 PRK02947, PRK02947, hypothetical protein; Provisional. Length = 246 Score = 29.5 bits (67), Expect = 0.22 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Query: 24 PLFLSFNIDG-------LFEKYLEIIQQL 45 P+FLS N+DG L EKY + I +L Sbjct: 217 PVFLSANVDGGDEHNQALVEKYRDRIPRL 245 >gnl|CDD|177398 PHA02569, 39, DNA topoisomerase II large subunit; Provisional. Length = 602 Score = 27.8 bits (62), Expect = 0.62 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Query: 2 CTPLMKKIFVENKKV-FKGFKAQ--PLFLSFNIDGLFEKYLEIIQ---QLLSVI 49 C+ + I K KG P F F ++GL ++YL+II Q L+V+ Sbjct: 159 CSNGAENISWSTKPGKGKGTSVTFIPDFSHFEVNGLDQQYLDIILDRLQTLAVV 212 >gnl|CDD|163455 TIGR03743, SXT_TraD, conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains. Length = 634 Score = 24.5 bits (54), Expect = 6.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 26 FLSFNIDGLFEKYLEII 42 ++ I+ L EKYLE Sbjct: 308 YVESGIEPLLEKYLEKF 324 >gnl|CDD|185024 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional. Length = 530 Score = 24.5 bits (54), Expect = 7.1 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Query: 7 KKIF---VENKKVFKGFKAQPLFLSFNI 31 KK+ +E + + KGF PLF + N+ Sbjct: 313 KKLHRNALEVENLTKGFDNGPLFKNLNL 340 >gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed. Length = 932 Score = 24.0 bits (52), Expect = 8.8 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Query: 14 KKVFKGFKAQP------LFLSFNIDGLFEKYLEIIQQLLSVIASYV 53 +K FK F F I L ++ E I QLL +I YV Sbjct: 752 EKAFKHLDNTDPTLILYAFDLFAIQALLDEEGESIIQLLQLIYDYV 797 >gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed. Length = 1176 Score = 24.1 bits (53), Expect = 9.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Query: 9 IFVENKKVFKGFKAQPLFLSFNID 32 + V+++K+F+ K + +L I+ Sbjct: 544 LLVDDEKLFESLKKKLRWLLPEIE 567 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.144 0.409 Gapped Lambda K H 0.267 0.0746 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 860,520 Number of extensions: 37799 Number of successful extensions: 142 Number of sequences better than 10.0: 1 Number of HSP's gapped: 142 Number of HSP's successfully gapped: 19 Length of query: 54 Length of database: 5,994,473 Length adjustment: 26 Effective length of query: 28 Effective length of database: 5,432,665 Effective search space: 152114620 Effective search space used: 152114620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.0 bits)