RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780169|ref|YP_003064582.1| hypothetical protein CLIBASIA_00260 [Candidatus Liberibacter asiaticus str. psy62] (54 letters) >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure- function studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Length = 377 Score = 26.3 bits (57), Expect = 1.8 Identities = 10/49 (20%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Query: 10 FVENKKVFKGFKAQPLFLSFNIDGLF--EKYLEIIQQLLSVI--ASYVE 54 + K+ KA+ +S D LF + Q L + E Sbjct: 301 YENVKEALSRIKARYTLVSVTTDQLFKPIDLYKSKQLLEQSGVDLHFYE 349 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 24.5 bits (53), Expect = 6.3 Identities = 9/51 (17%), Positives = 17/51 (33%), Gaps = 19/51 (37%) Query: 8 KIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEI-------IQQLLSVIAS 51 ++ +F G Q N D FE+ ++ + L+ A Sbjct: 155 QLVA----IFGG---QG-----NTDDYFEELRDLYQTYHVLVGDLIKFSAE 193 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.328 0.144 0.409 Gapped Lambda K H 0.267 0.0527 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 444,320 Number of extensions: 14526 Number of successful extensions: 65 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 5 Length of query: 54 Length of database: 5,693,230 Length adjustment: 26 Effective length of query: 28 Effective length of database: 5,062,886 Effective search space: 141760808 Effective search space used: 141760808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.5 bits)